Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|040680
Gene name
Locationscaffold_2:577399..578792
Strand+
Gene length (bp)1393
Transcript length (bp)879
Coding sequence length (bp)879
Protein length (aa) 293

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16 3.6E-18 100 240

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A3DBX3|GUB_CLOTH Beta-glucanase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=licB PE=1 SV=1 99 252 3.0E-13
sp|Q84C00|GUB_CLOTM Beta-glucanase OS=Clostridium thermocellum GN=licB PE=1 SV=1 99 252 1.0E-12
sp|Q53317|XYND_RUMFL Xylanase/beta-glucanase OS=Ruminococcus flavefaciens GN=xynD PE=3 SV=2 67 252 3.0E-07
sp|O14412|GUB_ORPSP Beta-glucanase OS=Orpinomyces sp. (strain PC-2) GN=licA PE=1 SV=1 99 253 2.0E-06
sp|P23904|GUB_PAEMA Beta-glucanase OS=Paenibacillus macerans PE=1 SV=2 106 253 2.0E-06
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A3DBX3|GUB_CLOTH Beta-glucanase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=licB PE=1 SV=1 99 252 3.0E-13
sp|Q84C00|GUB_CLOTM Beta-glucanase OS=Clostridium thermocellum GN=licB PE=1 SV=1 99 252 1.0E-12
sp|Q53317|XYND_RUMFL Xylanase/beta-glucanase OS=Ruminococcus flavefaciens GN=xynD PE=3 SV=2 67 252 3.0E-07
sp|O14412|GUB_ORPSP Beta-glucanase OS=Orpinomyces sp. (strain PC-2) GN=licA PE=1 SV=1 99 253 2.0E-06
sp|P23904|GUB_PAEMA Beta-glucanase OS=Paenibacillus macerans PE=1 SV=2 106 253 2.0E-06
sp|P04957|GUB_BACSU Beta-glucanase OS=Bacillus subtilis (strain 168) GN=bglS PE=1 SV=2 95 253 6.0E-06
sp|P45797|GUB_PAEPO Beta-glucanase OS=Paenibacillus polymyxa GN=gluB PE=3 SV=1 106 253 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0008152 metabolic process No
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 42 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|040680
MEAPFRFGLMGFYFHMAAYKTTRAQLASFITLLLVQVSVQAACDTYTVSGIPGGFTRRLFADFSNVSPGGDAASL
LSSFGIGISSDTVRSTPIPRTSVPSNIALGNGALNLKVSRYSGSGAVQSAEMVTRDTFKFASVRTSMKSSKTPGV
VEGNFFYLNDNQEIDWETLTSTISTSSQCVPAGIWATNQRAFAGAPATDATIPFTFDPTADFHEYRIDWSSDATA
FYIDGQRKARFTQNVPTQAGHWIWNVWSSGDPCWSNGPPTADSITQIRSIEMFTGWTSTVSGNVCSA*
Coding >AgabiH97|040680
ATGGAAGCCCCTTTCCGCTTTGGTCTCATGGGATTCTACTTTCACATGGCGGCGTATAAAACTACTAGAGCTCAG
CTGGCATCTTTCATCACTCTGCTGCTAGTCCAAGTGTCAGTGCAGGCAGCTTGCGATACCTACACCGTCAGCGGA
ATTCCTGGTGGCTTCACCCGGCGATTGTTTGCAGATTTTTCTAATGTATCCCCCGGCGGTGATGCTGCGTCTCTT
CTCAGCTCTTTTGGGATAGGCATCAGCTCTGACACTGTTCGTTCTACGCCCATTCCTCGGACCTCTGTTCCGTCA
AACATAGCTCTGGGAAATGGAGCTTTGAATCTTAAGGTCTCCCGGTATTCCGGCAGCGGAGCAGTCCAAAGCGCG
GAGATGGTCACGCGCGACACTTTCAAATTTGCTTCAGTTCGTACTTCCATGAAATCAAGCAAAACTCCGGGTGTT
GTCGAGGGCAACTTTTTTTATCTGAATGACAATCAAGAAATTGATTGGGAAACTTTGACGAGTACCATATCCACT
TCTAGTCAATGTGTTCCCGCCGGAATTTGGGCGACAAACCAGCGCGCATTCGCAGGTGCGCCGGCGACCGACGCA
ACAATTCCATTCACTTTTGATCCCACCGCGGATTTCCATGAGTATCGTATTGATTGGTCGTCTGACGCCACAGCA
TTCTATATCGATGGACAACGGAAGGCTCGCTTCACGCAGAATGTTCCGACGCAAGCGGGTCATTGGATTTGGAAT
GTATGGAGCAGTGGAGATCCTTGCTGGTCGAACGGTCCTCCCACAGCGGACTCTATAACTCAAATTCGGTCAATT
GAAATGTTCACAGGATGGACTTCAACGGTCTCCGGGAATGTGTGCAGCGCATAA
Transcript >AgabiH97|040680
ATGGAAGCCCCTTTCCGCTTTGGTCTCATGGGATTCTACTTTCACATGGCGGCGTATAAAACTACTAGAGCTCAG
CTGGCATCTTTCATCACTCTGCTGCTAGTCCAAGTGTCAGTGCAGGCAGCTTGCGATACCTACACCGTCAGCGGA
ATTCCTGGTGGCTTCACCCGGCGATTGTTTGCAGATTTTTCTAATGTATCCCCCGGCGGTGATGCTGCGTCTCTT
CTCAGCTCTTTTGGGATAGGCATCAGCTCTGACACTGTTCGTTCTACGCCCATTCCTCGGACCTCTGTTCCGTCA
AACATAGCTCTGGGAAATGGAGCTTTGAATCTTAAGGTCTCCCGGTATTCCGGCAGCGGAGCAGTCCAAAGCGCG
GAGATGGTCACGCGCGACACTTTCAAATTTGCTTCAGTTCGTACTTCCATGAAATCAAGCAAAACTCCGGGTGTT
GTCGAGGGCAACTTTTTTTATCTGAATGACAATCAAGAAATTGATTGGGAAACTTTGACGAGTACCATATCCACT
TCTAGTCAATGTGTTCCCGCCGGAATTTGGGCGACAAACCAGCGCGCATTCGCAGGTGCGCCGGCGACCGACGCA
ACAATTCCATTCACTTTTGATCCCACCGCGGATTTCCATGAGTATCGTATTGATTGGTCGTCTGACGCCACAGCA
TTCTATATCGATGGACAACGGAAGGCTCGCTTCACGCAGAATGTTCCGACGCAAGCGGGTCATTGGATTTGGAAT
GTATGGAGCAGTGGAGATCCTTGCTGGTCGAACGGTCCTCCCACAGCGGACTCTATAACTCAAATTCGGTCAATT
GAAATGTTCACAGGATGGACTTCAACGGTCTCCGGGAATGTGTGCAGCGCATAA
Gene >AgabiH97|040680
ATGGGTCAGAGCTTTATCAGCTTCTCAGTGATGCGGACGACATCTAATTGTCATCTCCACATGTAAAGAAGCCCC
TTTCCGCGTGAGTCGAGACCAGGTCGAAACCAAAATCTCTGGACCAAGTGTGCACTTGACCAAGAGAGTTTGGTC
TCATGGGATTCTACTTTCACATGGCGGCGTATAAAACTACTAGGTGAGCTCTGCACTAGAATACAACAAACAAGT
GATGACACCTCACTTCAGAGCTCAGCTGGCATCTTTCATCACTCTGCTGCTAGTCCAAGTGTCAGTGCAGGCAGC
TTGCGATACCTACACCGTCAGCGGAATTCCTGGTGGCTTCACCCGGCGATTGTTTGCAGATTTTTCTAATGTATC
CCCCGGCGGTGATGCTGCGTCTCTTCTCAGGTAATTATATTATGGAACTTCTGAAAATGGTCCATGATATCGACC
GCAAACTAGCTCTTTTGGGATAGGCATCAGCTCTGACACTGTTCGTTCTACGCCCATTCCTCGGACCTCTGTTCC
GTCAAACATAGCTCTGGGAAATGGAGCTTTGAATCTTAAGGTCTCCCGGTATTCCGGCAGCGGAGCAGTCCAAAG
CGCGGAGATGGTCACGCGCGACACTTTCAAATTTGCTTCAGTTCGTACTTCCATGAAATCAAGCAAAACTCCGGG
TGTTGTCGAGGGCAACTTTTTTTATCGTAAGTATGTGAAACTTTTCACCTTTTGGAGTCTTGATGAAAGTACTCT
TTTTAAGTGAATGACAATCAAGAAATTGATTGGGAAACTTTGACGAGTACCATATCCACTTCTAGTCAATGTGTT
CCCGCCGGAATTTGGGCGACAAACCAGGTGAGAAATGCCGGCAAATACATTTCTGTAATGGATAGCTCTTTGTTA
ACTTTTATGTTAGCGCGCATTCGCAGGTGCGCCGGCGACCGACGCAACAATTCCATTCACTTTTGATCCCACCGC
GGATTTCCATGGTGTGTATAATTCAATCATCAATGCTGAGGTTGTACCATGAAGCTCATATAAATATGCAGAGTA
TCGTATTGATGTGAGCTCTCATCTTGTAACCAAAAAAGCTTACTCAATTATGAACTATGCAGTGGTCGTCTGACG
CCACAGCATTCTATATCGATGGACAACGGAAGGCTCGCTTCACGCAGAATGTAAATTATCTTCTTAGATCACTCT
ACCAACACAAGCTTACCGAATTTGTATCTAGGTTCCGACGCAAGCGGGTCATTGGATTTGGAATGTATGGAGCAG
TGGAGATCCTTGCTGGTCGAACGGTCCTCCCACAGCGGACTCTATAACTCAAATTCGGTCAATTGAAATGTTCAC
AGGATGGACTTCAACGGTCTCCGGGAATGTGTGCAGCGCATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail