Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|040560
Gene name
Locationscaffold_2:552022..554108
Strand+
Gene length (bp)2086
Transcript length (bp)1101
Coding sequence length (bp)1101
Protein length (aa) 367

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00295 Glyco_hydro_28 Glycosyl hydrolases family 28 7.3E-59 42 350
PF07602 DUF1565 Protein of unknown function (DUF1565) 1.3E-04 191 284

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74213|PGLR1_ASPAC Endopolygalacturonase I OS=Aspergillus aculeatus GN=pgaI PE=1 SV=1 44 350 2.0E-65
sp|P49575|PGLRA_ASPPA Probable endopolygalacturonase A OS=Aspergillus parasiticus GN=pgaA PE=2 SV=1 3 350 1.0E-63
sp|P26215|PGLR_COCCA Polygalacturonase OS=Cochliobolus carbonum GN=PGN1 PE=3 SV=1 1 350 3.0E-63
sp|Q9Y834|PGLR1_PENOL Polygalacturonase 1 OS=Penicillium olsonii GN=PG1 PE=3 SV=1 20 350 4.0E-63
sp|Q4WR80|PGLR_ASPFU Probable endopolygalacturonase AFUA_1G17220 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_1G17220 PE=3 SV=1 2 350 3.0E-62
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74213|PGLR1_ASPAC Endopolygalacturonase I OS=Aspergillus aculeatus GN=pgaI PE=1 SV=1 44 350 2.0E-65
sp|P49575|PGLRA_ASPPA Probable endopolygalacturonase A OS=Aspergillus parasiticus GN=pgaA PE=2 SV=1 3 350 1.0E-63
sp|P26215|PGLR_COCCA Polygalacturonase OS=Cochliobolus carbonum GN=PGN1 PE=3 SV=1 1 350 3.0E-63
sp|Q9Y834|PGLR1_PENOL Polygalacturonase 1 OS=Penicillium olsonii GN=PG1 PE=3 SV=1 20 350 4.0E-63
sp|Q4WR80|PGLR_ASPFU Probable endopolygalacturonase AFUA_1G17220 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_1G17220 PE=3 SV=1 2 350 3.0E-62
sp|B0XPA1|PGLR_ASPFC Probable endopolygalacturonase AFUB_016610 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=AFUB_016610 PE=3 SV=1 2 350 3.0E-62
sp|O42824|PGLR_PENJA Polygalacturonase OS=Penicillium janthinellum PE=3 SV=1 44 350 4.0E-62
sp|Q5B508|PGLRB_EMENI Endopolygalacturonase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pgaB PE=1 SV=2 42 350 5.0E-62
sp|Q00446|PGLR1_COLLN Endopolygalacturonase 1 OS=Colletotrichum lindemuthianum GN=PG1 PE=3 SV=1 1 350 3.0E-61
sp|A1D145|PGLR_NEOFI Probable endopolygalacturonase NFIA_008150 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NFIA_008150 PE=3 SV=1 2 350 4.0E-61
sp|A1CVV8|PGLRA_NEOFI Probable endopolygalacturonase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=pgaA PE=3 SV=1 21 350 9.0E-61
sp|Q4WQT2|PGLRA_ASPFU Probable endopolygalacturonase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pgaA PE=3 SV=1 21 350 1.0E-60
sp|B0Y4Z4|PGLRA_ASPFC Probable endopolygalacturonase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=pgaA PE=3 SV=1 21 350 1.0E-60
sp|Q9Y833|PGLR2_PENOL Polygalacturonase 2 OS=Penicillium olsonii GN=PG2 PE=3 SV=1 42 350 2.0E-60
sp|O42809|PGLRE_ASPNG Endopolygalacturonase E OS=Aspergillus niger GN=pgaE PE=1 SV=1 44 350 2.0E-59
sp|Q70HJ4|PGLR2_ASPAC Probable endopolygalacturonase II OS=Aspergillus aculeatus GN=pgaII PE=2 SV=1 42 350 7.0E-59
sp|Q9P4W3|PGLRB_ASPNG Endopolygalacturonase B OS=Aspergillus niger GN=pgaB PE=1 SV=1 42 350 9.0E-59
sp|A2QCV8|PGLRB_ASPNC Probable endopolygalacturonase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=pgaB PE=3 SV=1 42 350 9.0E-59
sp|A2QBB6|PGLRE_ASPNC Probable endopolygalacturonase E OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=pgaE PE=3 SV=1 44 350 1.0E-58
sp|O93883|PGLR_PENGR Polygalacturonase OS=Penicillium griseoroseum GN=PGG1 PE=3 SV=1 28 350 2.0E-58
sp|P26213|PGLR1_ASPNG Endopolygalacturonase I OS=Aspergillus niger GN=pgaI PE=1 SV=1 45 354 6.0E-58
sp|A2QAH3|PGLR1_ASPNC Probable endopolygalacturonase I OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=pgaI PE=3 SV=1 45 354 6.0E-58
sp|P35335|PGLRB_ASPOR Endopolygalacturonase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pgaB PE=2 SV=2 3 350 5.0E-57
sp|Q1HAY5|PGLRB_ASPKA Probable endopolygalacturonase B OS=Aspergillus kawachii GN=pgaB PE=3 SV=1 42 350 6.0E-57
sp|Q12554|PGLRC_ASPNG Probable endopolygalacturonase C OS=Aspergillus niger GN=pgaC PE=3 SV=1 3 354 7.0E-57
sp|A2QL39|PGLRC_ASPNC Probable endopolygalacturonase C OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=pgaC PE=3 SV=1 42 354 1.0E-56
sp|B8N7Z8|PGLRB_ASPFN Probable endopolygalacturonase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=pgaB PE=3 SV=1 3 350 2.0E-56
sp|Q9P4W4|PGLRA_ASPNG Endopolygalacturonase A OS=Aspergillus niger GN=pgaA PE=1 SV=1 15 350 2.0E-56
sp|A2R8F8|PGLRA_ASPNC Probable endopolygalacturonase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=pgaA PE=3 SV=1 15 350 2.0E-56
sp|Q8NK99|PGLRA_ASPKW Probable endopolygalacturonase A OS=Aspergillus kawachii (strain NBRC 4308) GN=pgaA PE=3 SV=1 15 350 4.0E-56
sp|P41749|PGLRA_ASPFL Endopolygalacturonase A OS=Aspergillus flavus GN=pgaA PE=2 SV=1 3 350 5.0E-56
sp|Q9Y718|PGLR_PENDI Polygalacturonase OS=Penicillium digitatum GN=PG1 PE=3 SV=1 20 350 2.0E-55
sp|Q9P358|PGLRA_ASPAW Endopolygalacturonase A OS=Aspergillus awamori GN=pgaA PE=1 SV=1 15 350 7.0E-55
sp|Q12708|PGLR1_SCLSC Endo-polygalacturonase OS=Sclerotinia sclerotiorum GN=PG1 PE=3 SV=1 17 350 9.0E-55
sp|Q70HJ3|PGLRC_ASPAC Probable endopolygalacturonase C OS=Aspergillus aculeatus GN=pgaC PE=2 SV=1 42 336 6.0E-54
sp|P47180|PGLR_YEAST Polygalacturonase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PGU1 PE=1 SV=1 5 348 6.0E-54
sp|Q2UHL4|PGLR1_ASPOR Endopolygalacturonase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pgaI PE=1 SV=1 45 354 5.0E-53
sp|B8N8M2|PGLR1_ASPFN Probable endopolygalacturonase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=pgaI PE=3 SV=1 45 354 5.0E-53
sp|O59925|PGLR_PENEN Polygalacturonase OS=Penicillium expansum GN=PEPG1 PE=3 SV=1 3 352 7.0E-53
sp|Q5ATQ3|PGLR_EMENI Endopolygalacturonase AN8327 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN8327 PE=1 SV=1 14 350 7.0E-53
sp|Q0CMU3|PGLR1_ASPTN Probable endopolygalacturonase I OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=pgaI PE=3 SV=1 45 350 8.0E-53
sp|Q9P4W2|PGLRD_ASPNG Endopolygalacturonase D OS=Aspergillus niger GN=pgaD PE=3 SV=1 6 350 1.0E-52
sp|A2QTU0|PGLRD_ASPNC Probable endopolygalacturonase D OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=pgaD PE=3 SV=1 6 350 1.0E-52
sp|A1DBR6|PGLRD_NEOFI Probable endopolygalacturonase D OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=pgaD PE=3 SV=1 6 358 3.0E-51
sp|P41750|PGLRB_ASPFL Endopolygalacturonase B OS=Aspergillus flavus GN=pgaB PE=2 SV=1 45 354 6.0E-51
sp|Q4WBE1|PGLRB_ASPFU Probable endopolygalacturonase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pgaB PE=3 SV=1 42 350 3.0E-49
sp|B0YAH0|PGLRB_ASPFC Probable endopolygalacturonase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=pgaB PE=3 SV=1 42 350 3.0E-49
sp|Q5AYH4|PGLRD_EMENI Probable endopolygalacturonase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pgaD PE=3 SV=1 41 350 1.0E-48
sp|A1CIV8|PGLR1_ASPCL Probable endopolygalacturonase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=pgaI PE=3 SV=1 42 350 1.0E-48
sp|A1DAQ2|PGLRB_NEOFI Probable endopolygalacturonase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=pgaB PE=3 SV=1 20 350 3.0E-48
sp|Q07181|PGLR_GIBFU Polygalacturonase OS=Gibberella fujikuroi GN=PGA PE=1 SV=1 1 350 6.0E-48
sp|Q8NK98|PGLR2_ASPKW Probable endopolygalacturonase II OS=Aspergillus kawachii (strain NBRC 4308) GN=pgaII PE=3 SV=2 42 350 7.0E-48
sp|Q9P359|PGLR2_ASPAW Endopolygalacturonase II OS=Aspergillus awamori GN=pgaII PE=1 SV=1 42 350 9.0E-48
sp|P26214|PGLR2_ASPNG Endopolygalacturonase II OS=Aspergillus niger GN=pgaII PE=1 SV=1 42 350 4.0E-47
sp|A2R5S4|PGLR2_ASPNC Probable endopolygalacturonase II OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=pgaII PE=3 SV=1 42 350 4.0E-47
sp|O97400|PGLR_PHACE Polygalacturonase OS=Phaedon cochleariae PE=2 SV=1 8 350 5.0E-47
sp|Q2UT29|PGLRD_ASPOR Probable endopolygalacturonase D OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pgaD PE=3 SV=2 29 358 4.0E-46
sp|B8MW78|PGLRD_ASPFN Probable endopolygalacturonase D OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=pgaD PE=3 SV=1 29 358 8.0E-46
sp|P19805|PGLR2_ASPTU Endopolygalacturonase II OS=Aspergillus tubingensis GN=pgaII PE=1 SV=1 42 350 1.0E-45
sp|A1DLC1|PGLRX_NEOFI Probable exopolygalacturonase X OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=pgaX PE=3 SV=2 55 233 7.0E-13
sp|Q5ARN5|PGLX2_EMENI Exopolygalacturonase X-2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pgaX-2 PE=2 SV=1 58 293 8.0E-13
sp|Q4WCZ8|PGLRX_ASPFU Probable exopolygalacturonase X OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pgaX PE=3 SV=2 54 233 2.0E-12
sp|B0YDE8|PGLRX_ASPFC Probable exopolygalacturonase X OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=pgaX PE=3 SV=2 54 233 2.0E-12
sp|Q27UB3|PGLRX_ASPNG Exopolygalacturonase X OS=Aspergillus niger GN=pgaX PE=3 SV=1 55 233 2.0E-11
sp|A2R060|PGLRX_ASPNC Probable exopolygalacturonase X OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=pgaX PE=3 SV=1 55 233 2.0E-11
sp|Q00293|PGLRX_ASPTU Exopolygalacturonase X OS=Aspergillus tubingensis GN=pgaX PE=1 SV=1 55 233 2.0E-11
sp|Q5ASG9|PGLX1_EMENI Exopolygalacturonase X-1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pgaX-1 PE=1 SV=1 55 259 3.0E-11
sp|Q27UB2|PGXA_ASPNG Exopolygalacturonase A OS=Aspergillus niger GN=pgxA PE=3 SV=1 82 233 1.0E-10
sp|A2QW66|PGXA_ASPNC Probable exopolygalacturonase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=pgxA PE=3 SV=1 82 233 1.0E-10
sp|P49062|PGLR1_ARATH Exopolygalacturonase clone GBGE184 OS=Arabidopsis thaliana GN=PGA3 PE=2 SV=1 67 295 1.0E-10
sp|Q0CGP0|PGLRX_ASPTN Probable exopolygalacturonase X OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=pgaX PE=3 SV=1 55 233 2.0E-10
sp|Q02096|PGLR_PERAE Polygalacturonase OS=Persea americana PE=2 SV=1 93 293 3.0E-10
sp|Q9UUZ2|XGHA_ASPTU Endo-xylogalacturonan hydrolase A OS=Aspergillus tubingensis GN=xghA PE=1 SV=1 3 274 4.0E-10
sp|Q8RY29|ADPG2_ARATH Polygalacturonase ADPG2 OS=Arabidopsis thaliana GN=ADPG2 PE=2 SV=2 97 311 1.0E-09
sp|Q9LW07|PGLR3_ARATH Probable polygalacturonase At3g15720 OS=Arabidopsis thaliana GN=At3g15720 PE=1 SV=1 50 293 1.0E-09
sp|Q949Z1|PGLR4_ARATH Polygalacturonase At1g48100 OS=Arabidopsis thaliana GN=At1g48100 PE=2 SV=1 91 293 2.0E-09
sp|A2QK83|XGHA_ASPNC Probable endo-xylogalacturonan hydrolase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=xghA PE=3 SV=1 68 275 2.0E-09
sp|Q5B7U1|XGHA_EMENI Probable endo-xylogalacturonan hydrolase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=xghA PE=3 SV=1 31 356 8.0E-09
sp|Q40312|PGLR_MEDSA Polygalacturonase OS=Medicago sativa PE=2 SV=1 155 311 1.0E-08
sp|P48979|PGLR_PRUPE Polygalacturonase OS=Prunus persica PE=2 SV=1 142 311 2.0E-08
sp|O23147|ADPG1_ARATH Polygalacturonase ADPG1 OS=Arabidopsis thaliana GN=ADPG1 PE=2 SV=1 102 293 2.0E-08
sp|P05117|PGLR_SOLLC Polygalacturonase-2 OS=Solanum lycopersicum GN=PG2 PE=1 SV=1 175 293 3.0E-08
sp|Q00359|PGLRX_COCCA Exopolygalacturonase OS=Cochliobolus carbonum GN=PGX1 PE=3 SV=1 48 293 7.0E-08
sp|B8NPS8|XGHA_ASPFN Probable endo-xylogalacturonan hydrolase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=xghA PE=3 SV=1 171 260 2.0E-07
sp|Q2UBD8|XGHA_ASPOR Probable endo-xylogalacturonan hydrolase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=xghA PE=3 SV=1 171 260 2.0E-07
sp|I1BYN6|RPG16_RHIO9 Exopolygalacturonase rpg16 OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=rpg16 PE=1 SV=1 43 233 2.0E-07
sp|B8NG16|PGLRX_ASPFN Probable exopolygalacturonase X OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=pgaX PE=3 SV=1 82 233 2.0E-07
sp|I1BYM7|RPG15_RHIO9 Exopolygalacturonase rpg15 OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=rpg15 PE=1 SV=1 6 260 3.0E-07
sp|P43212|PGLR2_CRYJA Polygalacturonase OS=Cryptomeria japonica PE=1 SV=1 137 311 3.0E-07
sp|O22818|PGLR6_ARATH Probable polygalacturonase At2g43860 OS=Arabidopsis thaliana GN=At2g43860 PE=2 SV=1 99 311 3.0E-07
sp|Q0CXI3|PGXC_ASPTN Probable exopolygalacturonase C OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=pgxC PE=3 SV=1 1 293 4.0E-07
sp|Q39766|PGLR_GOSBA Polygalacturonase OS=Gossypium barbadense GN=G9 PE=2 SV=1 182 293 6.0E-07
sp|Q39786|PGLR_GOSHI Polygalacturonase OS=Gossypium hirsutum GN=G9 PE=2 SV=1 182 293 6.0E-07
sp|P48978|PGLR_MALDO Polygalacturonase OS=Malus domestica PE=2 SV=1 182 293 7.0E-07
sp|Q6H9K0|PGLR2_PLAAC Exopolygalacturonase (Fragment) OS=Platanus acerifolia GN=plaa2 PE=1 SV=1 182 293 7.0E-07
sp|A1DBT5|XGHA_NEOFI Probable endo-xylogalacturonan hydrolase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=xghA PE=3 SV=1 181 275 9.0E-07
sp|A2RAY7|RGXC_ASPNC Putative galacturan 1,4-alpha-galacturonidase C OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=rgxC PE=2 SV=1 86 264 2.0E-06
sp|Q9SFB7|QRT2_ARATH Polygalacturonase QRT2 OS=Arabidopsis thaliana GN=QRT2 PE=1 SV=2 182 260 2.0E-06
sp|Q4WBT4|XGHA_ASPFU Probable endo-xylogalacturonan hydrolase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=xghA PE=3 SV=2 171 277 2.0E-06
sp|Q4WBK6|PGXB_ASPFU Probable exopolygalacturonase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pgxB PE=3 SV=2 55 311 2.0E-06
sp|B0Y9F8|XGHA_ASPFC Probable endo-xylogalacturonan hydrolase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=xghA PE=3 SV=2 171 275 3.0E-06
sp|P35339|PGLR3_MAIZE Exopolygalacturonase OS=Zea mays GN=PG2C PE=2 SV=1 91 307 3.0E-06
sp|B0YAA4|PGXB_ASPFC Probable exopolygalacturonase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=pgxB PE=3 SV=2 55 311 3.0E-06
sp|P35336|PGLR_ACTDE Polygalacturonase OS=Actinidia deliciosa PE=2 SV=1 182 293 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005975 carbohydrate metabolic process Yes
GO:0004650 polygalacturonase activity Yes
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0008152 metabolic process No
GO:0003674 molecular_function No
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds No
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|040560
MLLKLLSSLLLLATTRAARVRRESDCVGTINSMDDVADAVRCTTVVLNSFTVPAGQTLNIDLLDGSTVNMNGDIH
FGNQTWAGPLFQVSGDSVTFNGNGHTFDGGGPFYWDGLGGNGGVTKPAPMMKIRTSGTFSNVKVLNSPARTYSIS
NPGPLVIDGLTIDNSLGDLPNSNSNGKAAGHNTDGFDASTEDLTIQNSVIMNQDDCLAINRGANIVFRGNTCSGG
HGISVGSINSDVTVNGITISGNRIINNDQALRIKTIVDATNSRVTNITYSGNTATGIRRFGIIIDQSYPSTIATP
GNGVQISAVNFVPPQTSIEVNDNAQRVAVNCGVGSCVGNWDWSNLDVSGGVAGDITNFNGIIGFDE*
Coding >AgabiH97|040560
ATGCTACTGAAATTGTTATCTAGTCTTTTGTTGTTGGCCACCACTCGGGCCGCTCGGGTTCGTAGGGAAAGTGAT
TGTGTAGGAACTATCAATTCGATGGATGATGTTGCGGACGCCGTTCGATGCACTACTGTTGTATTGAACAGCTTT
ACAGTTCCTGCCGGACAGACTCTTAACATCGATCTTTTGGACGGTTCAACAGTCAATATGAACGGTGACATCCAC
TTCGGGAACCAGACTTGGGCAGGACCCCTCTTCCAAGTTAGCGGAGACTCGGTTACATTTAATGGAAATGGGCAT
ACCTTCGACGGAGGAGGTCCCTTCTACTGGGATGGCCTTGGGGGTAATGGTGGGGTCACCAAACCTGCGCCAATG
ATGAAGATCAGGACATCTGGTACATTCTCGAACGTGAAAGTCCTCAACTCCCCAGCTAGGACTTATTCCATTTCA
AATCCTGGGCCTCTTGTCATCGACGGGTTGACCATTGATAATTCTCTCGGAGATCTTCCAAACTCGAACAGTAAT
GGGAAAGCAGCAGGCCACAACACCGATGGATTTGATGCAAGTACCGAGGACTTGACGATCCAAAACAGTGTTATC
ATGAATCAAGATGATTGCCTTGCCATCAACAGAGGTGCTAACATTGTCTTCCGAGGAAACACCTGCTCAGGAGGA
CATGGAATTTCCGTGGGCTCCATCAATTCCGATGTTACCGTCAATGGCATCACCATCTCCGGCAACAGGATCATC
AATAATGACCAAGCTTTGCGTATCAAAACCATAGTCGATGCTACTAATAGTAGAGTGACAAACATCACTTATTCT
GGTAACACCGCGACTGGAATTAGAAGGTTTGGTATCATAATCGACCAGAGTTATCCCTCAACAATCGCTACTCCT
GGTAATGGCGTTCAAATATCGGCTGTGAATTTCGTCCCTCCTCAAACCTCCATCGAGGTCAATGATAATGCCCAA
AGAGTCGCTGTCAATTGCGGCGTCGGGTCTTGCGTGGGTAATTGGGACTGGTCTAATTTGGACGTTTCAGGAGGA
GTTGCAGGTGATATCACCAATTTCAATGGAATAATAGGATTTGACGAGTAA
Transcript >AgabiH97|040560
ATGCTACTGAAATTGTTATCTAGTCTTTTGTTGTTGGCCACCACTCGGGCCGCTCGGGTTCGTAGGGAAAGTGAT
TGTGTAGGAACTATCAATTCGATGGATGATGTTGCGGACGCCGTTCGATGCACTACTGTTGTATTGAACAGCTTT
ACAGTTCCTGCCGGACAGACTCTTAACATCGATCTTTTGGACGGTTCAACAGTCAATATGAACGGTGACATCCAC
TTCGGGAACCAGACTTGGGCAGGACCCCTCTTCCAAGTTAGCGGAGACTCGGTTACATTTAATGGAAATGGGCAT
ACCTTCGACGGAGGAGGTCCCTTCTACTGGGATGGCCTTGGGGGTAATGGTGGGGTCACCAAACCTGCGCCAATG
ATGAAGATCAGGACATCTGGTACATTCTCGAACGTGAAAGTCCTCAACTCCCCAGCTAGGACTTATTCCATTTCA
AATCCTGGGCCTCTTGTCATCGACGGGTTGACCATTGATAATTCTCTCGGAGATCTTCCAAACTCGAACAGTAAT
GGGAAAGCAGCAGGCCACAACACCGATGGATTTGATGCAAGTACCGAGGACTTGACGATCCAAAACAGTGTTATC
ATGAATCAAGATGATTGCCTTGCCATCAACAGAGGTGCTAACATTGTCTTCCGAGGAAACACCTGCTCAGGAGGA
CATGGAATTTCCGTGGGCTCCATCAATTCCGATGTTACCGTCAATGGCATCACCATCTCCGGCAACAGGATCATC
AATAATGACCAAGCTTTGCGTATCAAAACCATAGTCGATGCTACTAATAGTAGAGTGACAAACATCACTTATTCT
GGTAACACCGCGACTGGAATTAGAAGGTTTGGTATCATAATCGACCAGAGTTATCCCTCAACAATCGCTACTCCT
GGTAATGGCGTTCAAATATCGGCTGTGAATTTCGTCCCTCCTCAAACCTCCATCGAGGTCAATGATAATGCCCAA
AGAGTCGCTGTCAATTGCGGCGTCGGGTCTTGCGTGGGTAATTGGGACTGGTCTAATTTGGACGTTTCAGGAGGA
GTTGCAGGTGATATCACCAATTTCAATGGAATAATAGGATTTGACGAGTAA
Gene >AgabiH97|040560
ATGCTACTGAAATTGTTATCTAGTCTTTTGTTGTTGGCCACCACTCGGGCCGCTCGGGTTCGTAGGGAAAGTGAT
TGTGTAGGAACTATCAATTCGATGGATGGTATGTGCTCATCCTTTCAACGCTGCTGCGGTAGTGACCTGACTGTC
AATTCTATTTATCTAGATGTTGCGGACGCCGTTCGATGCACTACTGTTGTATTGAACAGCTTTACAGTTCCTGCC
GGACAGACTCTTAACATCGATCTTTTGGACGGTTCAACAGTCAATATGAGTGAGTACCCTGCGGGCTGCTTGAGT
GGGAACTTCTTTCGAATCTGAATTTCTAGACGGTGACATCCACTTCGGGAACCAGACTTGGGCAGGACCCCTCTT
CCAAGTTAGGTGAGACAGGCACTCAGGTCACCTTCGAGTTTTGTGAACCTCATTTGACGTAACTTCCAGCGGAGA
CTCGGTTACATGTAAGCTCGAGAAACAGATATATTTATGTCTGTGAATCTCATATGAGACTCTAGTTAATGGAAA
TGGGCATACCTTCGACGGAGGAGGTCCCTTCTACTGGGTACGTCTAGCGACAATGTTAATCAAATTACTCCAGGC
TTACTGACTCGTCGCCGGATGGAAGGATGGCCTTGGGGGTAATGGTGGGGTCACCAAACCTGCGCCAATGATGAA
GTACGTTAGCGAGATTATCTTGCGTTCGCTTAACCTTCTAGTTAACTGGTCCATAGGATCAGGACATCTGGTACA
TTCTCGGTATGCTCTCGTCCAGCTTGAACTGAGGTTTCCCTCCCCTGATCTTGATATACACTTCTTATCAAAGAA
CGTGAAAGTCCTCAACTCCCCAGCTAGGACTTATTCCATTTCAAATCCTGGGCCTCTTGTCATCGACGGGTTGAC
CATTGATAATTGTACCAGACTTTCTAACTTCCAACATTCTCCATTTTGATCCAATATTCAATAGCTCTCGGAGAT
CTTCCAAACTCGAACAGTAATGGGAAAGCAGCAGGCCACAACACCGATGGATTTGATGCAAGTACCGAGGACTTG
ACGATCCAAAACAGGTATGTCTCATTAATGTTTATCGCACATTCAAATATAGTAATCAACTTACCGTATTTAGTG
TTATCATGAATCAAGTACGTTATTAACCCGCTTCCGGCGGCTTCAGTACACTCTCCTAACGGCGAAACCCAAGGA
TGATTGCCTTGCCATCAACAGAGGTGCTAACATTGTCTTCCGAGGAAACACCTGCTCAGGAGGACATGGAATTTC
CGTGGTACGCAGATCATCCCCGCGATGCAAATGGCAAAGTTTTAGACATAAACCCCTGTAGGGCTCCATCAATTC
CGATGTTACCGTCAATGGCATCACCATCTCCGGCAACAGGATCATCAATAAGTTGAGCCGCTTTCTACCCCTACT
CTGAGGCATTACATTAATACTTCTATAGTGACCAAGCTTTGCGTATCAAAACCATAGTCGATGCTACTAATAGTA
GAGTGACAAACATCACTTATTCTGTGAGCAAACAAGTTTCAGAGGCCTCAACCTTGACAGGTCTACTAGAAAGCT
GAATAATTTCGAAGGGTAACACCGCGACTGGAATTAGAAGGTTTGGTATCATAATCGACCAGGTTCTTTACTTTT
TTCAAGATGACCCTCGATTAATGCTCACATGCTGACCAGAGTTATCCCTCAACAATCGCTACTCCTGGTAATGGC
GTTCAAATATCGGTGAGTTCATCCATCGCCCGAGTTGGTATGATCTGTCGCCAAACGAATTTCTTTAGGCTGTGA
ATTTCGTCCCTCCTCAAACCTCCATCGAGGTCAATGATAATGCCCAAAGAGTCGCTGTCAATTGCGGCGTCGGGT
CTTGCGTGGGTAAGTAGCACAACTTAAACGTCGGGTTGTGGTATTCACGTCAATACTCTTAGGTAATTGGGACTG
GTCTAATTTGGACGTTTCAGGAGGAGTTGCAGGTAAAGAGAATTACCTAGCACGTCTTCGCTAATGAACATAACC
TCAACATTAATCCCTAGGTGATATCACCAATTTCAATGGAATAATAGGATTTGACGAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail