Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|040520
Gene name
Locationscaffold_2:541700..543354
Strand-
Gene length (bp)1654
Transcript length (bp)924
Coding sequence length (bp)924
Protein length (aa) 308

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05721 PhyH Phytanoyl-CoA dioxygenase (PhyH) 2.8E-46 14 263

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q0IIB1|PHYD1_BOVIN Phytanoyl-CoA dioxygenase domain-containing protein 1 OS=Bos taurus GN=PHYHD1 PE=2 SV=1 3 293 4.0E-72
sp|Q5SRE7|PHYD1_HUMAN Phytanoyl-CoA dioxygenase domain-containing protein 1 OS=Homo sapiens GN=PHYHD1 PE=1 SV=2 3 295 8.0E-71
sp|Q5U3U0|PHYD1_DANRE Phytanoyl-CoA dioxygenase domain-containing protein 1 OS=Danio rerio GN=phyhd1 PE=2 SV=1 3 295 2.0E-68
sp|Q9NAM7|PHYD1_CAEEL Phytanoyl-CoA dioxygenase domain-containing protein 1 homolog OS=Caenorhabditis elegans GN=Y105C5B.9 PE=3 SV=1 13 293 6.0E-68
sp|Q9DB26|PHYD1_MOUSE Phytanoyl-CoA dioxygenase domain-containing protein 1 OS=Mus musculus GN=Phyhd1 PE=1 SV=2 3 293 8.0E-68
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q0IIB1|PHYD1_BOVIN Phytanoyl-CoA dioxygenase domain-containing protein 1 OS=Bos taurus GN=PHYHD1 PE=2 SV=1 3 293 4.0E-72
sp|Q5SRE7|PHYD1_HUMAN Phytanoyl-CoA dioxygenase domain-containing protein 1 OS=Homo sapiens GN=PHYHD1 PE=1 SV=2 3 295 8.0E-71
sp|Q5U3U0|PHYD1_DANRE Phytanoyl-CoA dioxygenase domain-containing protein 1 OS=Danio rerio GN=phyhd1 PE=2 SV=1 3 295 2.0E-68
sp|Q9NAM7|PHYD1_CAEEL Phytanoyl-CoA dioxygenase domain-containing protein 1 homolog OS=Caenorhabditis elegans GN=Y105C5B.9 PE=3 SV=1 13 293 6.0E-68
sp|Q9DB26|PHYD1_MOUSE Phytanoyl-CoA dioxygenase domain-containing protein 1 OS=Mus musculus GN=Phyhd1 PE=1 SV=2 3 293 8.0E-68
sp|Q5BJP9|PHYD1_RAT Phytanoyl-CoA dioxygenase domain-containing protein 1 OS=Rattus norvegicus GN=Phyhd1 PE=2 SV=1 3 293 2.0E-66
sp|P0C660|PHYD1_CAEBR Phytanoyl-CoA dioxygenase domain-containing protein 1 homolog OS=Caenorhabditis briggsae GN=CBG00325 PE=3 SV=1 14 295 3.0E-66
sp|Q54XH6|PHYD1_DICDI Phytanoyl-CoA dioxygenase domain-containing protein 1 homolog OS=Dictyostelium discoideum GN=phyhd1 PE=3 SV=1 6 287 2.0E-64
sp|Q9ZVF6|PAHX_ARATH Phytanoyl-CoA dioxygenase OS=Arabidopsis thaliana GN=PAHX PE=2 SV=2 6 297 4.0E-60
sp|Q65WW7|PAHX2_ORYSJ Phytanoyl-CoA dioxygenase 2 OS=Oryza sativa subsp. japonica GN=Os05g0473900 PE=2 SV=1 6 285 2.0E-55
sp|Q10E49|PAHX1_ORYSJ Phytanoyl-CoA dioxygenase 1 OS=Oryza sativa subsp. japonica GN=Os03g0708100 PE=2 SV=1 6 285 8.0E-55
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 70 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|040520
MTLEYLTQQQIVKFHKDGYLVIPSFLDKEDTDALLKRAKLLLDEFNIDSHPRTKFTTGDDNHVGDDYFLTSGDKI
RFFLEEDAVDPDGKLNRPKQKAVNKIGHGLHELDPLFRKVTLENDRLKSLARDLKFHHDPVALQSMVITKQQQIG
GEVPEHNDSTFLYTNPPSALGIWIALEKCTPINGALSFLPGSHLTTPITKRFIRLPSGGTGFESLVSPEEEKAVN
ERSKGEYILETCNPGDMVLIHGSVLHKSERNTSPNTRFAYTFHMIESAPYAEYDNKNWLQPTPDMPFPHILPPSK
LVPIGAD*
Coding >AgabiH97|040520
ATGACACTCGAATATTTGACCCAGCAGCAGATAGTCAAGTTTCACAAAGACGGGTACCTAGTCATTCCGAGCTTC
TTGGACAAGGAAGACACCGACGCTTTACTCAAACGGGCTAAGCTACTCCTCGACGAGTTTAATATCGATTCCCAT
CCTCGCACCAAATTCACTACAGGAGATGACAACCACGTGGGAGACGACTATTTTCTAACTTCAGGCGACAAGATT
CGTTTCTTCCTTGAAGAGGACGCCGTGGATCCAGATGGAAAGCTCAATCGACCCAAGCAAAAAGCAGTCAATAAG
ATTGGCCACGGTTTACACGAGCTCGACCCTCTCTTCCGTAAAGTCACTCTCGAGAACGACCGTCTTAAATCATTA
GCCCGCGACCTCAAGTTCCACCATGACCCCGTTGCACTCCAAAGCATGGTAATCACGAAGCAACAACAAATTGGA
GGAGAAGTTCCCGAGCACAACGACTCAACGTTCCTCTATACCAATCCTCCATCTGCACTTGGCATCTGGATAGCT
CTCGAAAAATGCACACCCATAAATGGCGCTCTTTCCTTCCTCCCCGGTTCTCACCTCACAACACCTATCACCAAG
CGCTTTATCCGACTTCCATCGGGTGGTACAGGCTTTGAATCGCTCGTTTCTCCGGAAGAAGAAAAGGCTGTCAAT
GAGCGATCCAAAGGAGAATATATCCTCGAGACCTGCAATCCCGGGGACATGGTCTTGATCCATGGCTCCGTATTG
CATAAATCCGAACGAAACACAAGCCCAAACACGCGCTTCGCTTACACATTCCATATGATCGAGTCAGCGCCCTAT
GCAGAGTACGATAACAAGAACTGGTTACAACCTACACCCGATATGCCTTTCCCTCATATTTTGCCACCCTCAAAG
CTCGTACCCATTGGTGCAGATTGA
Transcript >AgabiH97|040520
ATGACACTCGAATATTTGACCCAGCAGCAGATAGTCAAGTTTCACAAAGACGGGTACCTAGTCATTCCGAGCTTC
TTGGACAAGGAAGACACCGACGCTTTACTCAAACGGGCTAAGCTACTCCTCGACGAGTTTAATATCGATTCCCAT
CCTCGCACCAAATTCACTACAGGAGATGACAACCACGTGGGAGACGACTATTTTCTAACTTCAGGCGACAAGATT
CGTTTCTTCCTTGAAGAGGACGCCGTGGATCCAGATGGAAAGCTCAATCGACCCAAGCAAAAAGCAGTCAATAAG
ATTGGCCACGGTTTACACGAGCTCGACCCTCTCTTCCGTAAAGTCACTCTCGAGAACGACCGTCTTAAATCATTA
GCCCGCGACCTCAAGTTCCACCATGACCCCGTTGCACTCCAAAGCATGGTAATCACGAAGCAACAACAAATTGGA
GGAGAAGTTCCCGAGCACAACGACTCAACGTTCCTCTATACCAATCCTCCATCTGCACTTGGCATCTGGATAGCT
CTCGAAAAATGCACACCCATAAATGGCGCTCTTTCCTTCCTCCCCGGTTCTCACCTCACAACACCTATCACCAAG
CGCTTTATCCGACTTCCATCGGGTGGTACAGGCTTTGAATCGCTCGTTTCTCCGGAAGAAGAAAAGGCTGTCAAT
GAGCGATCCAAAGGAGAATATATCCTCGAGACCTGCAATCCCGGGGACATGGTCTTGATCCATGGCTCCGTATTG
CATAAATCCGAACGAAACACAAGCCCAAACACGCGCTTCGCTTACACATTCCATATGATCGAGTCAGCGCCCTAT
GCAGAGTACGATAACAAGAACTGGTTACAACCTACACCCGATATGCCTTTCCCTCATATTTTGCCACCCTCAAAG
CTCGTACCCATTGGTGCAGATTGA
Gene >AgabiH97|040520
ATGACACTCGAATATTTGACCCAGCAGCAGATAGTCAAGGTGCAGTCTCCTTTCTGTGCGCTTCCATAGACCTCA
GCCCATTCCTCGGACCCAGTTTCACAAAGACGGGTATGTAAATGCCTTATTACCCTGCAGCATCATCATCACTCT
CATCAAACGTACTACCCTGCCACATCGTGGACTGTCTTCTGACGGTCATCTATCACCAACAACAATTAACATCGC
TTCGCTCTTATGCAAACGATTAAACTTGACTTAGGTACCTAGTCATTCCGAGCTTCTTGGACAAGGAAGACACCG
ACGCTTTACTCAAACGGGCTAAGCTACTCCTCGACGAGTTTAATATCGATTCCCATCCTCGCGTGCGTGCCCGAG
CTTATTAGTTGCAGAATGTTATATCCTGCTAAGCTCAACGTCTTAGACCAAATTCACTACAGGAGATGACAACCA
CGTGGGAGACGACTATTTTCTAACTTCAGGCGACAAGATGTAACAAGTTCACCTACGAGCATTGAACACCCATCT
ATACTCACTTTCTTACCTCAGTCGTTTCTTCCTTGAAGAGGACGCCGTGGATCCAGATGGAAAGCTCAATCGACC
CAAGCAAAAAGCAGTCAATAAGATTGGCCACGGTAAGCCCTTTCTCCAAACTCTATCACCTCGTGGTCGCTCCTC
AAAAGCCTCCTCATCACTTCTACCTATCTCATCGGTACCATTCTCTCCTCAATCCAGGTTTACACGAGCTCGACC
CTCTCTTCCGTAAAGTCACTCTCGAGAACGACCGTCTTAAATCATTAGCCCGCGACCTCAAGTTCCACCATGACC
CCGTTGGTACGTACTTCTCTTTCTTTCAAGGTTTGGTTCCATTTATAACGTTGTCCAGCACTCCAAAGCATGGTA
ATCACGAAGCAACAACAAATTGGAGGAGAAGGTTCTGTTATTACATTCATCCCAGCCTACTGTCTTCGAAGCTGA
TCGAGTGGTCTCTATAGTTCCCGAGCACAACGACTCGTGCGTCGCCAAGATTCCTTTCCTGACTCCTCCACTCAT
GCATGCATATCCATATCTGAAACCAATACAGAACGTTCCTCGTAAGCCCTAATAAACCCTAGAAAAACAGTGTAC
CTCTCAACTCAATGTCCCAACACTTAGTATACCAATCCTCCATCTGCACTTGGCATCTGGATAGCTCTCGAAAAA
TGCACACCCATAAATGGCGCTCTTTCCTTCCTCCCCGGTTCTCACCTCACAACACCTATCACCAAGCGCTTTATC
CGACTTCCATCGGGTGGTACAGGCTTTGAATCGCTCGTTTCTCCGGAAGAAGAAAAGGCTGTCAATGAGCGATCC
AAAGGAGAATATATCCTCGAGACCTGCAATCCCGGTACGACCAATTCAACTACTGAGCCGCAAATTATCTGTTGA
CTCCAATCTCGTTTCTTGTTAAGGGGACATGGTCTTGATCCATGGCTCCGTATTGCATAAATCCGAACGAAACAC
AAGCCCAAACACGCGCTTCGCTTACACATTCCATATGATCGAGTCAGCGCCCTATGCAGAGTACGATAACAAGAA
CTGGTTACAACCTACACCCGATATGCCTTTCCCTCATATTTTGCCACCCTCAAAGCTCGTACCCATTGGTGCAGA
TTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail