Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|040430
Gene name
Locationscaffold_2:503691..505841
Strand+
Gene length (bp)2150
Transcript length (bp)1617
Coding sequence length (bp)1617
Protein length (aa) 539

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02110 HK Hydroxyethylthiazole kinase family 7.8E-75 258 524
PF02581 TMP-TENI Thiamine monophosphate synthase 3.6E-56 8 200

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P40386|THI6_SCHPO Probable thiamine biosynthetic bifunctional enzyme OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=thi4 PE=2 SV=1 4 533 2.0E-106
sp|P41835|THI6_YEAST Thiamine biosynthetic bifunctional enzyme OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=THI6 PE=3 SV=1 4 522 5.0E-81
sp|B0K3V0|THIM_THEPX Hydroxyethylthiazole kinase OS=Thermoanaerobacter sp. (strain X514) GN=thiM PE=3 SV=1 255 535 1.0E-54
sp|A6M1W7|THIM_CLOB8 Hydroxyethylthiazole kinase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=thiM PE=3 SV=1 246 533 4.0E-54
sp|A8FIR7|THIM_BACP2 Hydroxyethylthiazole kinase OS=Bacillus pumilus (strain SAFR-032) GN=thiM PE=3 SV=1 256 533 4.0E-54
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P40386|THI6_SCHPO Probable thiamine biosynthetic bifunctional enzyme OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=thi4 PE=2 SV=1 4 533 2.0E-106
sp|P41835|THI6_YEAST Thiamine biosynthetic bifunctional enzyme OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=THI6 PE=3 SV=1 4 522 5.0E-81
sp|B0K3V0|THIM_THEPX Hydroxyethylthiazole kinase OS=Thermoanaerobacter sp. (strain X514) GN=thiM PE=3 SV=1 255 535 1.0E-54
sp|A6M1W7|THIM_CLOB8 Hydroxyethylthiazole kinase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=thiM PE=3 SV=1 246 533 4.0E-54
sp|A8FIR7|THIM_BACP2 Hydroxyethylthiazole kinase OS=Bacillus pumilus (strain SAFR-032) GN=thiM PE=3 SV=1 256 533 4.0E-54
sp|A7ZA59|THIM_BACMF Hydroxyethylthiazole kinase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=thiM PE=3 SV=1 257 533 5.0E-53
sp|Q0W1L9|THIM_METAR Hydroxyethylthiazole kinase OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=thiM PE=3 SV=1 256 533 6.0E-53
sp|Q0I129|THIM_HAES1 Hydroxyethylthiazole kinase OS=Haemophilus somnus (strain 129Pt) GN=thiM PE=3 SV=1 255 536 1.0E-52
sp|Q893Q9|THIM_CLOTE Hydroxyethylthiazole kinase OS=Clostridium tetani (strain Massachusetts / E88) GN=thiM PE=3 SV=1 248 533 2.0E-52
sp|A2SU11|THIM_METLZ Hydroxyethylthiazole kinase OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=thiM PE=3 SV=1 250 534 6.0E-52
sp|A8MK93|THIM_ALKOO Hydroxyethylthiazole kinase OS=Alkaliphilus oremlandii (strain OhILAs) GN=thiM PE=3 SV=1 248 533 6.0E-52
sp|B2TQ14|THIM_CLOBB Hydroxyethylthiazole kinase OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=thiM PE=3 SV=1 247 534 2.0E-51
sp|A6UPE5|THIM_METVS Hydroxyethylthiazole kinase OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=thiM PE=3 SV=1 257 533 4.0E-51
sp|B0KBA7|THIM_THEP3 Hydroxyethylthiazole kinase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=thiM PE=3 SV=1 255 536 4.0E-51
sp|B2UY66|THIM_CLOBA Hydroxyethylthiazole kinase OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=thiM PE=3 SV=1 247 534 7.0E-51
sp|Q6LY53|THIM_METMP Hydroxyethylthiazole kinase OS=Methanococcus maripaludis (strain S2 / LL) GN=thiM PE=3 SV=2 250 533 9.0E-51
sp|Q2FNE1|THIM_METHJ Hydroxyethylthiazole kinase OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=thiM PE=3 SV=1 245 533 9.0E-51
sp|C5D2N0|THIM_GEOSW Hydroxyethylthiazole kinase OS=Geobacillus sp. (strain WCH70) GN=thiM PE=3 SV=1 254 533 1.0E-50
sp|B8G7I8|THIM_CHLAD Hydroxyethylthiazole kinase OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=thiM PE=3 SV=1 251 533 4.0E-50
sp|A4FX33|THIM_METM5 Hydroxyethylthiazole kinase OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=thiM PE=3 SV=1 250 533 4.0E-50
sp|A6VG82|THIM_METM7 Hydroxyethylthiazole kinase OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=thiM PE=3 SV=1 250 533 5.0E-50
sp|B8DET2|THIM_LISMH Hydroxyethylthiazole kinase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=thiM PE=3 SV=1 257 533 6.0E-50
sp|Q8U191|THIM_PYRFU Hydroxyethylthiazole kinase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=thiM PE=3 SV=1 257 535 7.0E-50
sp|Q92EW7|THIM_LISIN Hydroxyethylthiazole kinase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=thiM PE=3 SV=1 256 533 9.0E-50
sp|B8FJW2|THIM_DESAA Hydroxyethylthiazole kinase OS=Desulfatibacillum alkenivorans (strain AK-01) GN=thiM PE=3 SV=1 255 533 1.0E-49
sp|A9AAH0|THIM_METM6 Hydroxyethylthiazole kinase OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=thiM PE=3 SV=1 250 533 1.0E-49
sp|A8M9N5|THIM_CALMQ Hydroxyethylthiazole kinase OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=thiM PE=3 SV=1 251 535 1.0E-49
sp|C1KZ32|THIM_LISMC Hydroxyethylthiazole kinase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=thiM PE=3 SV=1 257 533 4.0E-49
sp|P39593|THIM_BACSU Hydroxyethylthiazole kinase OS=Bacillus subtilis (strain 168) GN=thiM PE=1 SV=1 255 533 5.0E-49
sp|Q2RGX6|THIM_MOOTA Hydroxyethylthiazole kinase OS=Moorella thermoacetica (strain ATCC 39073) GN=thiM PE=3 SV=1 251 533 7.0E-49
sp|A5UUL2|THIM_ROSS1 Hydroxyethylthiazole kinase OS=Roseiflexus sp. (strain RS-1) GN=thiM PE=3 SV=1 247 533 1.0E-48
sp|B8I3J5|THIM_CLOCE Hydroxyethylthiazole kinase OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=thiM PE=3 SV=1 248 533 2.0E-48
sp|Q8YA46|THIM_LISMO Hydroxyethylthiazole kinase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=thiM PE=3 SV=1 257 533 2.0E-48
sp|Q723Z1|THIM_LISMF Hydroxyethylthiazole kinase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=thiM PE=3 SV=2 257 533 2.0E-48
sp|A9VRN3|THIM_BACWK Hydroxyethylthiazole kinase OS=Bacillus weihenstephanensis (strain KBAB4) GN=thiM PE=3 SV=1 250 535 5.0E-48
sp|A0AFC3|THIM_LISW6 Hydroxyethylthiazole kinase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=thiM PE=3 SV=1 257 533 6.0E-48
sp|C0ZGJ5|THIM_BREBN Hydroxyethylthiazole kinase OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=thiM PE=3 SV=1 249 529 1.0E-47
sp|Q8R807|THIM_CALS4 Hydroxyethylthiazole kinase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=thiM PE=3 SV=1 252 533 3.0E-47
sp|A0LP26|THIM_SYNFM Hydroxyethylthiazole kinase OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=thiM PE=3 SV=1 249 535 3.0E-47
sp|A7GKR3|THIM_BACCN Hydroxyethylthiazole kinase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=thiM PE=3 SV=1 250 532 4.0E-47
sp|Q65DJ9|THIM_BACLD Hydroxyethylthiazole kinase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=thiM PE=3 SV=1 252 533 4.0E-47
sp|A7IA08|THIM_METB6 Hydroxyethylthiazole kinase OS=Methanoregula boonei (strain 6A8) GN=thiM PE=3 SV=1 256 533 8.0E-47
sp|C1EVE5|THIM_BACC3 Hydroxyethylthiazole kinase OS=Bacillus cereus (strain 03BB102) GN=thiM PE=3 SV=1 250 535 1.0E-46
sp|A0R980|THIM_BACAH Hydroxyethylthiazole kinase OS=Bacillus thuringiensis (strain Al Hakam) GN=thiM PE=3 SV=2 250 535 1.0E-46
sp|Q6HP18|THIM_BACHK Hydroxyethylthiazole kinase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=thiM PE=3 SV=1 252 535 1.0E-46
sp|B7H7H4|THIM_BACC4 Hydroxyethylthiazole kinase OS=Bacillus cereus (strain B4264) GN=thiM PE=3 SV=1 250 533 1.0E-46
sp|B7JN71|THIM_BACC0 Hydroxyethylthiazole kinase OS=Bacillus cereus (strain AH820) GN=thiM PE=3 SV=1 252 535 2.0E-46
sp|Q81Z96|THIM_BACAN Hydroxyethylthiazole kinase OS=Bacillus anthracis GN=thiM PE=3 SV=1 252 535 2.0E-46
sp|C3L626|THIM_BACAC Hydroxyethylthiazole kinase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=thiM PE=3 SV=1 252 535 2.0E-46
sp|C3PBW0|THIM_BACAA Hydroxyethylthiazole kinase OS=Bacillus anthracis (strain A0248) GN=thiM PE=3 SV=1 252 535 2.0E-46
sp|Q73E73|THIM_BACC1 Hydroxyethylthiazole kinase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=thiM PE=3 SV=1 250 535 3.0E-46
sp|Q63GK4|THIM_BACCZ Hydroxyethylthiazole kinase OS=Bacillus cereus (strain ZK / E33L) GN=thiM PE=3 SV=1 252 535 4.0E-46
sp|A8MK92|THIE_ALKOO Thiamine-phosphate synthase OS=Alkaliphilus oremlandii (strain OhILAs) GN=thiE PE=3 SV=1 4 218 5.0E-46
sp|Q6AQZ6|THIM_DESPS Hydroxyethylthiazole kinase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=thiM PE=3 SV=2 257 533 6.0E-46
sp|B7GKQ7|THIM_ANOFW Hydroxyethylthiazole kinase OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=thiM PE=3 SV=1 255 536 9.0E-46
sp|Q81IG9|THIM_BACCR Hydroxyethylthiazole kinase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=thiM PE=3 SV=1 250 533 1.0E-45
sp|B9J2L4|THIM_BACCQ Hydroxyethylthiazole kinase OS=Bacillus cereus (strain Q1) GN=thiM PE=3 SV=1 255 535 1.0E-45
sp|B7HT69|THIM_BACC7 Hydroxyethylthiazole kinase OS=Bacillus cereus (strain AH187) GN=thiM PE=3 SV=1 255 535 1.0E-45
sp|Q8ESZ2|THIM1_OCEIH Hydroxyethylthiazole kinase 1 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=thiM1 PE=3 SV=1 254 522 1.0E-45
sp|B7IVS8|THIM_BACC2 Hydroxyethylthiazole kinase OS=Bacillus cereus (strain G9842) GN=thiM PE=3 SV=1 250 533 2.0E-45
sp|A3CS46|THIM_METMJ Hydroxyethylthiazole kinase OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=thiM PE=3 SV=1 256 533 3.0E-45
sp|O58877|THIM_PYRHO Hydroxyethylthiazole kinase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=thiM PE=1 SV=1 253 533 3.0E-45
sp|O28204|THIM_ARCFU Hydroxyethylthiazole kinase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=thiM PE=3 SV=1 257 530 5.0E-45
sp|B8GJF9|THIM_METPE Hydroxyethylthiazole kinase OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=thiM PE=3 SV=1 265 457 8.0E-45
sp|Q8PS50|THIM_METMA Hydroxyethylthiazole kinase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=thiM PE=3 SV=1 260 533 1.0E-44
sp|Q57233|THIM_HAEIN Hydroxyethylthiazole kinase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=thiM PE=3 SV=1 257 533 1.0E-44
sp|P57931|THIM_PASMU Hydroxyethylthiazole kinase OS=Pasteurella multocida (strain Pm70) GN=thiM PE=3 SV=1 257 536 1.0E-44
sp|Q5HMC9|THIM_STAEQ Hydroxyethylthiazole kinase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=thiM PE=3 SV=1 257 533 1.0E-44
sp|A7NRF8|THIM_ROSCS Hydroxyethylthiazole kinase OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=thiM PE=3 SV=1 247 533 1.0E-44
sp|A0Q2A0|THIE_CLONN Thiamine-phosphate synthase OS=Clostridium novyi (strain NT) GN=thiE PE=3 SV=1 3 216 2.0E-44
sp|A5UA73|THIM_HAEIE Hydroxyethylthiazole kinase OS=Haemophilus influenzae (strain PittEE) GN=thiM PE=3 SV=1 257 533 2.0E-44
sp|A5UGS9|THIM_HAEIG Hydroxyethylthiazole kinase OS=Haemophilus influenzae (strain PittGG) GN=thiM PE=3 SV=1 257 533 3.0E-44
sp|Q5KZU2|THIM_GEOKA Hydroxyethylthiazole kinase OS=Geobacillus kaustophilus (strain HTA426) GN=thiM PE=3 SV=1 255 533 4.0E-44
sp|Q3AE32|THIM_CARHZ Hydroxyethylthiazole kinase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=thiM PE=3 SV=1 249 529 4.0E-44
sp|A4IN26|THIM_GEOTN Hydroxyethylthiazole kinase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=thiM PE=3 SV=1 255 533 5.0E-44
sp|Q890C2|THIM_LACPL Hydroxyethylthiazole kinase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=thiM PE=3 SV=1 254 533 6.0E-44
sp|Q186F4|THIM_PEPD6 Hydroxyethylthiazole kinase OS=Peptoclostridium difficile (strain 630) GN=thiM PE=3 SV=1 256 533 7.0E-44
sp|C3L061|THIE_CLOB6 Thiamine-phosphate synthase OS=Clostridium botulinum (strain 657 / Type Ba4) GN=thiE PE=3 SV=1 4 213 9.0E-44
sp|Q8CRN9|THIM_STAES Hydroxyethylthiazole kinase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=thiM PE=3 SV=1 257 533 1.0E-43
sp|B1IEG6|THIE_CLOBK Thiamine-phosphate synthase OS=Clostridium botulinum (strain Okra / Type B1) GN=thiE PE=3 SV=1 4 213 1.0E-43
sp|Q4QNC8|THIM_HAEI8 Hydroxyethylthiazole kinase OS=Haemophilus influenzae (strain 86-028NP) GN=thiM PE=3 SV=1 257 533 1.0E-43
sp|B1KV12|THIE_CLOBM Thiamine-phosphate synthase OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=thiE PE=3 SV=1 4 213 1.0E-43
sp|Q9RGS6|THIM_STACT Hydroxyethylthiazole kinase OS=Staphylococcus carnosus (strain TM300) GN=thiM PE=3 SV=1 255 533 1.0E-43
sp|A6TMN6|THIM_ALKMQ Hydroxyethylthiazole kinase OS=Alkaliphilus metalliredigens (strain QYMF) GN=thiM PE=3 SV=1 250 535 2.0E-43
sp|B5Y6I0|THIM_COPPD Hydroxyethylthiazole kinase OS=Coprothermobacter proteolyticus (strain ATCC 35245 / DSM 5265 / BT) GN=thiM PE=3 SV=1 248 525 2.0E-43
sp|A7GAL0|THIE_CLOBL Thiamine-phosphate synthase OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=thiE PE=3 SV=1 4 213 2.0E-43
sp|B9LIA5|THIM_CHLSY Hydroxyethylthiazole kinase OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=thiM PE=3 SV=1 251 534 2.0E-43
sp|A9WDL9|THIM_CHLAA Hydroxyethylthiazole kinase OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=thiM PE=3 SV=1 251 534 2.0E-43
sp|C1FSC1|THIE_CLOBJ Thiamine-phosphate synthase OS=Clostridium botulinum (strain Kyoto / Type A2) GN=thiE PE=3 SV=1 4 213 3.0E-43
sp|B3QT42|THIM_CHLT3 Hydroxyethylthiazole kinase OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=thiM PE=3 SV=1 260 533 4.0E-43
sp|Q466J4|THIM_METBF Hydroxyethylthiazole kinase OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=thiM PE=3 SV=1 260 529 4.0E-43
sp|B5Z7K9|THIM_HELPG Hydroxyethylthiazole kinase OS=Helicobacter pylori (strain G27) GN=thiM PE=3 SV=1 256 455 4.0E-43
sp|Q893R0|THIE_CLOTE Thiamine-phosphate synthase OS=Clostridium tetani (strain Massachusetts / E88) GN=thiE PE=3 SV=2 3 215 4.0E-43
sp|A5HYZ3|THIE_CLOBH Thiamine-phosphate synthase OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=thiE PE=3 SV=1 4 213 5.0E-43
sp|A7FPT0|THIE_CLOB1 Thiamine-phosphate synthase OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=thiE PE=3 SV=1 4 213 5.0E-43
sp|A8ZV98|THIM_DESOH Hydroxyethylthiazole kinase OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=thiM PE=3 SV=1 248 533 9.0E-43
sp|B2USY3|THIM_HELPS Hydroxyethylthiazole kinase OS=Helicobacter pylori (strain Shi470) GN=thiM PE=3 SV=1 256 455 1.0E-42
sp|Q312G9|THIM_DESAG Hydroxyethylthiazole kinase OS=Desulfovibrio alaskensis (strain G20) GN=thiM PE=3 SV=1 259 527 1.0E-42
sp|Q2NGH3|THIM1_METST Hydroxyethylthiazole kinase 1 OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=thiM1 PE=3 SV=1 250 533 2.0E-42
sp|Q8TMD5|THIM_METAC Hydroxyethylthiazole kinase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=thiM PE=3 SV=1 260 532 2.0E-42
sp|B0SMR8|THIM_LEPBP Hydroxyethylthiazole kinase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=thiM PE=3 SV=1 246 530 2.0E-42
sp|B0SE82|THIM_LEPBA Hydroxyethylthiazole kinase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=thiM PE=3 SV=1 246 530 2.0E-42
sp|Q97LQ9|THIE_CLOAB Thiamine-phosphate synthase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=thiE PE=3 SV=1 1 218 4.0E-42
sp|A4J233|THIM_DESRM Hydroxyethylthiazole kinase OS=Desulfotomaculum reducens (strain MI-1) GN=thiM PE=3 SV=1 250 529 4.0E-42
sp|C1CQI2|THIM1_STRZT Hydroxyethylthiazole kinase 1 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=thiM1 PE=3 SV=1 260 532 5.0E-42
sp|Q97RS6|THIM1_STRPN Hydroxyethylthiazole kinase 1 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=thiM1 PE=3 SV=1 260 532 8.0E-42
sp|C1CD69|THIM1_STRZJ Hydroxyethylthiazole kinase 1 OS=Streptococcus pneumoniae (strain JJA) GN=thiM1 PE=3 SV=1 260 532 9.0E-42
sp|B2IN99|THIM1_STRPS Hydroxyethylthiazole kinase 1 OS=Streptococcus pneumoniae (strain CGSP14) GN=thiM1 PE=3 SV=2 260 532 1.0E-41
sp|B8ZN14|THIM1_STRPJ Hydroxyethylthiazole kinase 1 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=thiM1 PE=3 SV=1 260 532 1.0E-41
sp|B1IAN9|THIM1_STRPI Hydroxyethylthiazole kinase 1 OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=thiM1 PE=3 SV=1 260 532 1.0E-41
sp|C1C666|THIM1_STRP7 Hydroxyethylthiazole kinase 1 OS=Streptococcus pneumoniae (strain 70585) GN=thiM1 PE=3 SV=1 260 532 1.0E-41
sp|Q5WDW4|THIM_BACSK Hydroxyethylthiazole kinase OS=Bacillus clausii (strain KSM-K16) GN=thiM PE=3 SV=1 257 523 1.0E-41
sp|C1CJG8|THIM1_STRZP Hydroxyethylthiazole kinase 1 OS=Streptococcus pneumoniae (strain P1031) GN=thiM1 PE=3 SV=1 260 533 2.0E-41
sp|B1HX32|THIM_LYSSC Hydroxyethylthiazole kinase OS=Lysinibacillus sphaericus (strain C3-41) GN=thiM PE=3 SV=1 256 473 2.0E-41
sp|Q49Z40|THIM_STAS1 Hydroxyethylthiazole kinase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=thiM PE=3 SV=1 264 533 3.0E-41
sp|Q8DQK5|THIM1_STRR6 Hydroxyethylthiazole kinase 1 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=thiM1 PE=3 SV=2 260 532 3.0E-41
sp|Q04LH9|THIM1_STRP2 Hydroxyethylthiazole kinase 1 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=thiM1 PE=3 SV=1 260 532 3.0E-41
sp|Q9ZKZ9|THIM_HELPJ Hydroxyethylthiazole kinase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=thiM PE=3 SV=1 256 455 5.0E-41
sp|B5YV51|THIM_ECO5E Hydroxyethylthiazole kinase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=thiM PE=3 SV=1 260 525 5.0E-41
sp|Q8X7G3|THIM_ECO57 Hydroxyethylthiazole kinase OS=Escherichia coli O157:H7 GN=thiM PE=3 SV=1 260 525 5.0E-41
sp|Q1CT25|THIM_HELPH Hydroxyethylthiazole kinase OS=Helicobacter pylori (strain HPAG1) GN=thiM PE=3 SV=1 256 455 5.0E-41
sp|Q9UZQ4|THIM_PYRAB Hydroxyethylthiazole kinase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=thiM PE=3 SV=2 250 533 5.0E-41
sp|O25516|THIM_HELPY Hydroxyethylthiazole kinase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=thiM PE=3 SV=2 256 455 6.0E-41
sp|C3L062|THIM1_CLOB6 Hydroxyethylthiazole kinase 1 OS=Clostridium botulinum (strain 657 / Type Ba4) GN=thiM1 PE=3 SV=1 256 533 6.0E-41
sp|Q8ESJ1|THIM2_OCEIH Hydroxyethylthiazole kinase 2 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=thiM2 PE=3 SV=1 253 533 6.0E-41
sp|B1KV13|THIM2_CLOBM Hydroxyethylthiazole kinase 2 OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=thiM2 PE=3 SV=1 256 533 7.0E-41
sp|B1IEG7|THIM1_CLOBK Hydroxyethylthiazole kinase 1 OS=Clostridium botulinum (strain Okra / Type B1) GN=thiM1 PE=3 SV=1 256 533 7.0E-41
sp|A5HYZ4|THIM1_CLOBH Hydroxyethylthiazole kinase 1 OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=thiM1 PE=3 SV=1 256 533 8.0E-41
sp|A7FPT1|THIM1_CLOB1 Hydroxyethylthiazole kinase 1 OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=thiM1 PE=3 SV=1 256 533 8.0E-41
sp|A7GAL1|THIM1_CLOBL Hydroxyethylthiazole kinase 1 OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=thiM1 PE=3 SV=1 256 533 1.0E-40
sp|Q2LWX9|THIM_SYNAS Hydroxyethylthiazole kinase OS=Syntrophus aciditrophicus (strain SB) GN=thiM PE=3 SV=1 260 533 1.0E-40
sp|C1FSC2|THIM1_CLOBJ Hydroxyethylthiazole kinase 1 OS=Clostridium botulinum (strain Kyoto / Type A2) GN=thiM1 PE=3 SV=1 256 533 2.0E-40
sp|Q0STA1|THIE_CLOPS Thiamine-phosphate synthase OS=Clostridium perfringens (strain SM101 / Type A) GN=thiE PE=3 SV=1 1 217 2.0E-40
sp|A6VPG7|THIM_ACTSZ Hydroxyethylthiazole kinase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=thiM PE=3 SV=1 255 477 2.0E-40
sp|Q6LPQ4|THIM_PHOPR Hydroxyethylthiazole kinase OS=Photobacterium profundum GN=thiM PE=3 SV=1 260 535 3.0E-40
sp|B2UP55|THIM_AKKM8 Hydroxyethylthiazole kinase OS=Akkermansia muciniphila (strain ATCC BAA-835 / Muc) GN=thiM PE=3 SV=1 245 533 3.0E-40
sp|B5E320|THIM1_STRP4 Hydroxyethylthiazole kinase 1 OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=thiM1 PE=3 SV=1 265 532 5.0E-40
sp|A5ULP4|THIE_METS3 Thiamine-phosphate synthase OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=thiE PE=3 SV=1 1 223 6.0E-40
sp|A1VBV4|THIM_DESVV Hydroxyethylthiazole kinase OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=thiM PE=3 SV=1 253 446 8.0E-40
sp|Q5E0Q5|THIM_VIBF1 Hydroxyethylthiazole kinase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=thiM PE=3 SV=1 250 535 1.0E-39
sp|B1I1S3|THIM_DESAP Hydroxyethylthiazole kinase OS=Desulforudis audaxviator (strain MP104C) GN=thiM PE=3 SV=1 247 447 1.0E-39
sp|B6ERB4|THIM_ALISL Hydroxyethylthiazole kinase OS=Aliivibrio salmonicida (strain LFI1238) GN=thiM PE=3 SV=1 251 535 1.0E-39
sp|B5ET96|THIM_VIBFM Hydroxyethylthiazole kinase OS=Vibrio fischeri (strain MJ11) GN=thiM PE=3 SV=1 250 535 2.0E-39
sp|B2TY84|THIM_SHIB3 Hydroxyethylthiazole kinase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=thiM PE=3 SV=1 260 525 2.0E-39
sp|Q729I7|THIM_DESVH Hydroxyethylthiazole kinase OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=thiM PE=3 SV=1 253 446 3.0E-39
sp|Q32EA0|THIM_SHIDS Hydroxyethylthiazole kinase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=thiM PE=3 SV=1 260 525 3.0E-39
sp|B3Q1Q5|THIM_RHIE6 Hydroxyethylthiazole kinase OS=Rhizobium etli (strain CIAT 652) GN=thiM PE=3 SV=1 256 535 3.0E-39
sp|Q87JW7|THIM_VIBPA Hydroxyethylthiazole kinase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=thiM PE=3 SV=1 249 535 3.0E-39
sp|B8DJ66|THIM_DESVM Hydroxyethylthiazole kinase OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=thiM PE=3 SV=1 244 533 3.0E-39
sp|C4KZE2|THIM_EXISA Hydroxyethylthiazole kinase OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=thiM PE=3 SV=1 259 523 5.0E-39
sp|Q03GM6|THIM_PEDPA Hydroxyethylthiazole kinase OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=thiM PE=3 SV=1 257 533 5.0E-39
sp|B6HYU5|THIM_ECOSE Hydroxyethylthiazole kinase OS=Escherichia coli (strain SE11) GN=thiM PE=3 SV=1 260 525 6.0E-39
sp|B7M485|THIM_ECO8A Hydroxyethylthiazole kinase OS=Escherichia coli O8 (strain IAI1) GN=thiM PE=3 SV=1 260 525 6.0E-39
sp|B7L9X5|THIM_ECO55 Hydroxyethylthiazole kinase OS=Escherichia coli (strain 55989 / EAEC) GN=thiM PE=3 SV=1 260 525 6.0E-39
sp|P76423|THIM_ECOLI Hydroxyethylthiazole kinase OS=Escherichia coli (strain K12) GN=thiM PE=1 SV=1 260 525 6.0E-39
sp|B1IYX7|THIM_ECOLC Hydroxyethylthiazole kinase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=thiM PE=3 SV=1 260 525 6.0E-39
sp|A8A1W9|THIM_ECOHS Hydroxyethylthiazole kinase OS=Escherichia coli O9:H4 (strain HS) GN=thiM PE=3 SV=1 260 525 6.0E-39
sp|B1X7J5|THIM_ECODH Hydroxyethylthiazole kinase OS=Escherichia coli (strain K12 / DH10B) GN=thiM PE=3 SV=1 260 525 6.0E-39
sp|C4ZSI8|THIM_ECOBW Hydroxyethylthiazole kinase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=thiM PE=3 SV=1 260 525 6.0E-39
sp|Q24XQ0|THIE_DESHY Thiamine-phosphate synthase OS=Desulfitobacterium hafniense (strain Y51) GN=thiE PE=3 SV=1 4 213 7.0E-39
sp|Q0AZ86|THIE_SYNWW Thiamine-phosphate synthase OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=thiE PE=3 SV=1 1 216 7.0E-39
sp|C0QWJ2|THIM_BRAHW Hydroxyethylthiazole kinase OS=Brachyspira hyodysenteriae (strain ATCC 49526 / WA1) GN=thiM PE=3 SV=1 247 532 8.0E-39
sp|B9E8D6|THIM_MACCJ Hydroxyethylthiazole kinase OS=Macrococcus caseolyticus (strain JCSC5402) GN=thiM PE=3 SV=1 257 533 8.0E-39
sp|Q5WH87|THIE_BACSK Thiamine-phosphate synthase OS=Bacillus clausii (strain KSM-K16) GN=thiE PE=3 SV=1 6 213 9.0E-39
sp|Q6D299|THIM_PECAS Hydroxyethylthiazole kinase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=thiM PE=3 SV=1 257 527 9.0E-39
sp|B8FUD4|THIE_DESHD Thiamine-phosphate synthase OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=thiE PE=3 SV=1 4 221 9.0E-39
sp|B7NCD4|THIM_ECOLU Hydroxyethylthiazole kinase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=thiM PE=3 SV=1 260 525 1.0E-38
sp|A0Q299|THIM_CLONN Hydroxyethylthiazole kinase OS=Clostridium novyi (strain NT) GN=thiM PE=3 SV=1 249 533 2.0E-38
sp|B8FUD3|THIM_DESHD Hydroxyethylthiazole kinase OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=thiM PE=3 SV=1 251 533 4.0E-38
sp|Q4L7X4|THIM_STAHJ Hydroxyethylthiazole kinase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=thiM PE=3 SV=1 257 533 4.0E-38
sp|Q03NR9|THIM_LACBA Hydroxyethylthiazole kinase OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=thiM PE=3 SV=1 254 523 5.0E-38
sp|B7VS66|THIM_VIBTL Hydroxyethylthiazole kinase OS=Vibrio tasmaniensis (strain LGP32) GN=thiM PE=3 SV=2 251 533 5.0E-38
sp|Q38ZL9|THIM_LACSS Hydroxyethylthiazole kinase OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=thiM PE=3 SV=1 256 534 8.0E-38
sp|Q24XQ1|THIM_DESHY Hydroxyethylthiazole kinase OS=Desulfitobacterium hafniense (strain Y51) GN=thiM PE=3 SV=1 251 533 9.0E-38
sp|A5ULP3|THIM_METS3 Hydroxyethylthiazole kinase OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=thiM PE=3 SV=1 247 535 1.0E-37
sp|Q2K0X8|THIM_RHIEC Hydroxyethylthiazole kinase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=thiM PE=3 SV=1 256 535 1.0E-37
sp|A7N7S2|THIM_VIBCB Hydroxyethylthiazole kinase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=thiM PE=3 SV=1 249 535 1.0E-37
sp|Q83KH2|THIM_SHIFL Hydroxyethylthiazole kinase OS=Shigella flexneri GN=thiM PE=3 SV=1 260 525 1.0E-37
sp|Q0T335|THIM_SHIF8 Hydroxyethylthiazole kinase OS=Shigella flexneri serotype 5b (strain 8401) GN=thiM PE=3 SV=1 260 525 1.0E-37
sp|Q2YUL1|THIM_STAAB Hydroxyethylthiazole kinase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=thiM PE=3 SV=1 257 530 1.0E-37
sp|Q21VL5|THIE_RHOFT Thiamine-phosphate synthase OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=thiE PE=3 SV=1 8 219 1.0E-37
sp|Q97EL4|THIM_CLOAB Hydroxyethylthiazole kinase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=thiM PE=3 SV=1 257 525 2.0E-37
sp|C6DBE0|THIM_PECCP Hydroxyethylthiazole kinase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=thiM PE=3 SV=1 257 527 2.0E-37
sp|B8I3J4|THIE_CLOCE Thiamine-phosphate synthase OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=thiE PE=3 SV=1 2 213 2.0E-37
sp|Q8XKQ8|THIE_CLOPE Thiamine-phosphate synthase OS=Clostridium perfringens (strain 13 / Type A) GN=thiE PE=3 SV=1 1 217 2.0E-37
sp|Q6GEY3|THIM_STAAR Hydroxyethylthiazole kinase OS=Staphylococcus aureus (strain MRSA252) GN=thiM PE=3 SV=1 265 533 2.0E-37
sp|B7LV66|THIM_ESCF3 Hydroxyethylthiazole kinase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=thiM PE=3 SV=1 257 525 2.0E-37
sp|Q3Z0A6|THIM_SHISS Hydroxyethylthiazole kinase OS=Shigella sonnei (strain Ss046) GN=thiM PE=3 SV=1 260 525 3.0E-37
sp|B1LN84|THIM_ECOSM Hydroxyethylthiazole kinase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=thiM PE=3 SV=1 265 525 3.0E-37
sp|Q8NVH4|THIM_STAAW Hydroxyethylthiazole kinase OS=Staphylococcus aureus (strain MW2) GN=thiM PE=3 SV=1 257 533 4.0E-37
sp|Q6G7L8|THIM_STAAS Hydroxyethylthiazole kinase OS=Staphylococcus aureus (strain MSSA476) GN=thiM PE=3 SV=1 257 533 4.0E-37
sp|Q2QWK9|TPS1_ORYSJ Probable thiamine biosynthetic bifunctional enzyme, chloroplastic OS=Oryza sativa subsp. japonica GN=Os12g0192500 PE=2 SV=2 20 201 9.0E-37
sp|Q0TFY8|THIM_ECOL5 Hydroxyethylthiazole kinase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=thiM PE=3 SV=1 260 525 1.0E-36
sp|B7NPM9|THIM_ECO7I Hydroxyethylthiazole kinase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=thiM PE=3 SV=1 265 525 1.0E-36
sp|P66923|THIM_STAAN Hydroxyethylthiazole kinase OS=Staphylococcus aureus (strain N315) GN=thiM PE=1 SV=1 257 533 1.0E-36
sp|P66922|THIM_STAAM Hydroxyethylthiazole kinase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=thiM PE=3 SV=1 257 533 1.0E-36
sp|A5IUN8|THIM_STAA9 Hydroxyethylthiazole kinase OS=Staphylococcus aureus (strain JH9) GN=thiM PE=3 SV=1 257 533 1.0E-36
sp|A6U3H8|THIM_STAA2 Hydroxyethylthiazole kinase OS=Staphylococcus aureus (strain JH1) GN=thiM PE=3 SV=1 257 533 1.0E-36
sp|A7X4S9|THIM_STAA1 Hydroxyethylthiazole kinase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=thiM PE=3 SV=1 257 533 1.0E-36
sp|B7MWQ4|THIM_ECO81 Hydroxyethylthiazole kinase OS=Escherichia coli O81 (strain ED1a) GN=thiM PE=3 SV=1 260 522 1.0E-36
sp|Q0TQV4|THIE_CLOP1 Thiamine-phosphate synthase OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=thiE PE=3 SV=1 1 217 1.0E-36
sp|C4L8H9|THIM_TOLAT Hydroxyethylthiazole kinase OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=thiM PE=3 SV=1 253 524 1.0E-36
sp|Q9KCY8|THIE_BACHD Thiamine-phosphate synthase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=thiE PE=3 SV=1 5 218 1.0E-36
sp|Q1R9W8|THIM_ECOUT Hydroxyethylthiazole kinase OS=Escherichia coli (strain UTI89 / UPEC) GN=thiM PE=3 SV=1 260 525 1.0E-36
sp|A1ACX0|THIM_ECOK1 Hydroxyethylthiazole kinase OS=Escherichia coli O1:K1 / APEC GN=thiM PE=3 SV=1 260 525 1.0E-36
sp|B7MEF9|THIM_ECO45 Hydroxyethylthiazole kinase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=thiM PE=3 SV=1 260 525 1.0E-36
sp|Q2NGG1|THIM2_METST Hydroxyethylthiazole kinase 2 OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=thiM2 PE=3 SV=1 249 533 2.0E-36
sp|A6QIT6|THIM_STAAE Hydroxyethylthiazole kinase OS=Staphylococcus aureus (strain Newman) GN=thiM PE=3 SV=1 257 533 2.0E-36
sp|Q5HEA7|THIM_STAAC Hydroxyethylthiazole kinase OS=Staphylococcus aureus (strain COL) GN=thiM PE=3 SV=1 257 533 2.0E-36
sp|Q2FWG2|THIM_STAA8 Hydroxyethylthiazole kinase OS=Staphylococcus aureus (strain NCTC 8325) GN=thiM PE=3 SV=1 257 533 2.0E-36
sp|Q2FF34|THIM_STAA3 Hydroxyethylthiazole kinase OS=Staphylococcus aureus (strain USA300) GN=thiM PE=3 SV=1 257 533 2.0E-36
sp|Q323B8|THIM_SHIBS Hydroxyethylthiazole kinase OS=Shigella boydii serotype 4 (strain Sb227) GN=thiM PE=3 SV=1 260 525 2.0E-36
sp|A1JQJ2|THIM_YERE8 Hydroxyethylthiazole kinase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=thiM PE=3 SV=1 257 522 2.0E-36
sp|B4TNK3|THIM_SALSV Hydroxyethylthiazole kinase OS=Salmonella schwarzengrund (strain CVM19633) GN=thiM PE=3 SV=1 257 522 2.0E-36
sp|B9KD06|THIM_CAMLR Hydroxyethylthiazole kinase OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=thiM PE=3 SV=1 259 535 3.0E-36
sp|A7ZNS3|THIM_ECO24 Hydroxyethylthiazole kinase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=thiM PE=3 SV=1 260 525 3.0E-36
sp|Q6FAS9|THIM_ACIAD Hydroxyethylthiazole kinase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=thiM PE=3 SV=1 246 459 3.0E-36
sp|A9MKV9|THIM_SALAR Hydroxyethylthiazole kinase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=thiM PE=3 SV=2 257 522 4.0E-36
sp|Q72U64|THIM_LEPIC Hydroxyethylthiazole kinase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=thiM PE=3 SV=1 252 464 5.0E-36
sp|Q8Z5C8|THIM_SALTI Hydroxyethylthiazole kinase OS=Salmonella typhi GN=thiM PE=3 SV=1 257 522 6.0E-36
sp|Q8FFY0|THIM_ECOL6 Hydroxyethylthiazole kinase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=thiM PE=3 SV=1 260 522 7.0E-36
sp|Q8F0X6|THIM_LEPIN Hydroxyethylthiazole kinase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=thiM PE=3 SV=1 252 455 1.0E-35
sp|A6TMN5|THIE_ALKMQ Thiamine-phosphate synthase OS=Alkaliphilus metalliredigens (strain QYMF) GN=thiE PE=3 SV=1 5 213 1.0E-35
sp|B8F7P4|THIM_HAEPS Hydroxyethylthiazole kinase OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=thiM PE=3 SV=1 260 524 1.0E-35
sp|A9AZE0|THIM_HERA2 Hydroxyethylthiazole kinase OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=thiM PE=3 SV=1 259 519 1.0E-35
sp|B6A3G5|THIM_RHILW Hydroxyethylthiazole kinase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=thiM PE=3 SV=1 256 534 1.0E-35
sp|B4SXX8|THIM_SALNS Hydroxyethylthiazole kinase OS=Salmonella newport (strain SL254) GN=thiM PE=3 SV=1 257 522 2.0E-35
sp|C1DCM4|THIM_LARHH Hydroxyethylthiazole kinase OS=Laribacter hongkongensis (strain HLHK9) GN=thiM PE=3 SV=1 254 530 2.0E-35
sp|P55883|THIM_SALTY Hydroxyethylthiazole kinase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=thiM PE=3 SV=1 257 522 2.0E-35
sp|B4T9W1|THIM_SALHS Hydroxyethylthiazole kinase OS=Salmonella heidelberg (strain SL476) GN=thiM PE=3 SV=1 257 522 2.0E-35
sp|B5RBY7|THIM_SALG2 Hydroxyethylthiazole kinase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=thiM PE=3 SV=1 257 522 2.0E-35
sp|B5R0D9|THIM_SALEP Hydroxyethylthiazole kinase OS=Salmonella enteritidis PT4 (strain P125109) GN=thiM PE=3 SV=1 257 522 2.0E-35
sp|B5FMW2|THIM_SALDC Hydroxyethylthiazole kinase OS=Salmonella dublin (strain CT_02021853) GN=thiM PE=3 SV=1 257 522 2.0E-35
sp|P72965|THIE_SYNY3 Thiamine-phosphate synthase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=thiE PE=3 SV=1 7 213 2.0E-35
sp|B5EXY6|THIM_SALA4 Hydroxyethylthiazole kinase OS=Salmonella agona (strain SL483) GN=thiM PE=3 SV=1 257 522 2.0E-35
sp|B2TQ13|THIE_CLOBB Thiamine-phosphate synthase OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=thiE PE=3 SV=1 4 213 3.0E-35
sp|Q6A9C5|THIM_PROAC Hydroxyethylthiazole kinase OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=thiM PE=3 SV=2 248 530 4.0E-35
sp|Q9K7L2|THIM_BACHD Hydroxyethylthiazole kinase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=thiM PE=3 SV=1 260 533 4.0E-35
sp|Q3K1L7|THIM_STRA1 Hydroxyethylthiazole kinase OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=thiM PE=3 SV=1 257 530 5.0E-35
sp|Q8R806|THIE_CALS4 Thiamine-phosphate synthase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=thiE PE=3 SV=2 1 221 6.0E-35
sp|B7UFC1|THIM_ECO27 Hydroxyethylthiazole kinase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=thiM PE=3 SV=1 260 522 6.0E-35
sp|Q57MJ3|THIM_SALCH Hydroxyethylthiazole kinase OS=Salmonella choleraesuis (strain SC-B67) GN=thiM PE=3 SV=1 257 522 7.0E-35
sp|A4WCE6|THIM_ENT38 Hydroxyethylthiazole kinase OS=Enterobacter sp. (strain 638) GN=thiM PE=3 SV=1 251 524 7.0E-35
sp|Q8E5X0|THIM_STRA3 Hydroxyethylthiazole kinase OS=Streptococcus agalactiae serotype III (strain NEM316) GN=thiM PE=3 SV=1 257 530 7.0E-35
sp|A8AEC1|THIM_CITK8 Hydroxyethylthiazole kinase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=thiM PE=3 SV=1 257 528 8.0E-35
sp|Q1ASC4|THIM_RUBXD Hydroxyethylthiazole kinase OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=thiM PE=3 SV=1 252 465 9.0E-35
sp|A9N7J2|THIM_SALPB Hydroxyethylthiazole kinase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=thiM PE=3 SV=1 257 522 1.0E-34
sp|A5N1D3|THIM_CLOK5 Hydroxyethylthiazole kinase OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=thiM PE=3 SV=1 250 533 2.0E-34
sp|B9E564|THIM_CLOK1 Hydroxyethylthiazole kinase OS=Clostridium kluyveri (strain NBRC 12016) GN=thiM PE=3 SV=1 250 533 2.0E-34
sp|A5WDP1|THIM_PSYWF Hydroxyethylthiazole kinase OS=Psychrobacter sp. (strain PRwf-1) GN=thiM PE=3 SV=1 260 535 2.0E-34
sp|Q8E093|THIM_STRA5 Hydroxyethylthiazole kinase OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=thiM PE=3 SV=1 257 530 2.0E-34
sp|B5BF36|THIM_SALPK Hydroxyethylthiazole kinase OS=Salmonella paratyphi A (strain AKU_12601) GN=thiM PE=3 SV=1 257 522 2.0E-34
sp|Q5PMV9|THIM_SALPA Hydroxyethylthiazole kinase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=thiM PE=3 SV=1 257 522 2.0E-34
sp|A4W0K4|THIE_STRS2 Thiamine-phosphate synthase OS=Streptococcus suis (strain 98HAH33) GN=thiE PE=3 SV=1 7 228 2.0E-34
sp|C0QR82|THIE_PERMH Thiamine-phosphate synthase OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=thiE PE=3 SV=1 1 220 3.0E-34
sp|Q04YC8|THIM_LEPBL Hydroxyethylthiazole kinase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=thiM PE=3 SV=1 252 455 4.0E-34
sp|Q04V49|THIM_LEPBJ Hydroxyethylthiazole kinase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=thiM PE=3 SV=1 252 455 4.0E-34
sp|B8J4C1|THIM_DESDA Hydroxyethylthiazole kinase OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=thiM PE=3 SV=1 256 450 4.0E-34
sp|Q5M731|TPS1L_ARATH Thiamine biosynthetic bifunctional enzyme TH1, chloroplastic OS=Arabidopsis thaliana GN=TH1 PE=1 SV=1 21 201 4.0E-34
sp|A1SX95|THIM_PSYIN Hydroxyethylthiazole kinase OS=Psychromonas ingrahamii (strain 37) GN=thiM PE=3 SV=1 247 534 5.0E-34
sp|B0SMR9|THIE_LEPBP Thiamine-phosphate synthase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=thiE PE=3 SV=1 1 209 5.0E-34
sp|B0SE83|THIE_LEPBA Thiamine-phosphate synthase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=thiE PE=3 SV=1 1 209 5.0E-34
sp|C0Q0Y8|THIM_SALPC Hydroxyethylthiazole kinase OS=Salmonella paratyphi C (strain RKS4594) GN=thiM PE=3 SV=1 257 522 6.0E-34
sp|Q3IP35|THIM_NATPD Hydroxyethylthiazole kinase OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=thiM PE=3 SV=1 265 530 9.0E-34
sp|Q0W1L8|THIE_METAR Thiamine-phosphate synthase OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=thiE PE=3 SV=1 4 221 1.0E-33
sp|A4VUB1|THIM_STRSY Hydroxyethylthiazole kinase OS=Streptococcus suis (strain 05ZYH33) GN=thiM PE=3 SV=1 257 533 1.0E-33
sp|B2UY65|THIE_CLOBA Thiamine-phosphate synthase OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=thiE PE=3 SV=1 1 213 1.0E-33
sp|B2A1A8|THIM_NATTJ Hydroxyethylthiazole kinase OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=thiM PE=3 SV=1 257 534 1.0E-33
sp|Q8U192|THIE_PYRFU Thiamine-phosphate synthase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=thiE PE=1 SV=1 7 218 2.0E-33
sp|A6M1W6|THIE_CLOB8 Thiamine-phosphate synthase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=thiE PE=3 SV=1 4 213 3.0E-33
sp|B1Y3E4|THIM_LEPCP Hydroxyethylthiazole kinase OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=thiM PE=3 SV=2 242 472 3.0E-33
sp|Q21VL4|THIM_RHOFT Hydroxyethylthiazole kinase OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=thiM PE=3 SV=1 260 509 3.0E-33
sp|Q0BVF4|THIM_GRABC Hydroxyethylthiazole kinase OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=thiM PE=3 SV=2 239 522 3.0E-33
sp|K7VCB9|THIM_MAIZE Hydroxyethylthiazole kinase OS=Zea mays GN=THIM PE=1 SV=1 252 536 5.0E-33
sp|B1YJJ2|THIM_EXIS2 Hydroxyethylthiazole kinase OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=thiM PE=3 SV=1 256 527 1.0E-32
sp|A7N7S3|THIE_VIBCB Thiamine-phosphate synthase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=thiE PE=3 SV=1 6 218 1.0E-32
sp|P61411|THIE_GEOSL Putative thiamine-phosphate synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=thiE PE=3 SV=1 1 217 1.0E-32
sp|Q9UZQ5|THIE_PYRAB Thiamine-phosphate synthase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=thiE PE=3 SV=1 7 218 2.0E-32
sp|Q87JW8|THIE_VIBPA Thiamine-phosphate synthase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=thiE PE=3 SV=1 6 217 2.0E-32
sp|Q1M5U3|THIM_RHIL3 Hydroxyethylthiazole kinase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=thiM PE=3 SV=1 256 534 2.0E-32
sp|Q2FM63|THIE_METHJ Thiamine-phosphate synthase OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=thiE PE=3 SV=1 4 217 8.0E-32
sp|A9WDL8|THIE_CHLAA Thiamine-phosphate synthase OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=thiE PE=3 SV=1 4 175 8.0E-32
sp|B4U6B2|THIE_HYDS0 Thiamine-phosphate synthase OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=thiE PE=3 SV=1 1 211 1.0E-31
sp|Q63GK3|THIE_BACCZ Thiamine-phosphate synthase OS=Bacillus cereus (strain ZK / E33L) GN=thiE PE=3 SV=1 7 213 1.0E-31
sp|B7JN72|THIE_BACC0 Thiamine-phosphate synthase OS=Bacillus cereus (strain AH820) GN=thiE PE=3 SV=1 7 213 1.0E-31
sp|A0R981|THIE_BACAH Thiamine-phosphate synthase OS=Bacillus thuringiensis (strain Al Hakam) GN=thiE PE=3 SV=1 7 213 1.0E-31
sp|B9J2L5|THIE_BACCQ Thiamine-phosphate synthase OS=Bacillus cereus (strain Q1) GN=thiE PE=3 SV=1 7 213 1.0E-31
sp|B7HT70|THIE_BACC7 Thiamine-phosphate synthase OS=Bacillus cereus (strain AH187) GN=thiE PE=3 SV=1 7 213 1.0E-31
sp|A4W0K2|THIM_STRS2 Hydroxyethylthiazole kinase OS=Streptococcus suis (strain 98HAH33) GN=thiM PE=3 SV=1 257 468 2.0E-31
sp|C1EVE6|THIE_BACC3 Thiamine-phosphate synthase OS=Bacillus cereus (strain 03BB102) GN=thiE PE=3 SV=1 7 213 2.0E-31
sp|A7MHJ8|THIM_CROS8 Hydroxyethylthiazole kinase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=thiM PE=3 SV=1 256 519 2.0E-31
sp|A8GHT4|THIM_SERP5 Hydroxyethylthiazole kinase OS=Serratia proteamaculans (strain 568) GN=thiM PE=3 SV=1 252 527 2.0E-31
sp|B9JK65|THIM_AGRRK Hydroxyethylthiazole kinase OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=thiM PE=3 SV=1 255 446 3.0E-31
sp|P61410|THIE_BACC1 Thiamine-phosphate synthase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=thiE PE=3 SV=1 7 213 4.0E-31
sp|Q830K5|THIE_ENTFA Thiamine-phosphate synthase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=thiE PE=3 SV=1 8 208 5.0E-31
sp|Q6HP17|THIE_BACHK Thiamine-phosphate synthase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=thiE PE=3 SV=1 7 213 8.0E-31
sp|Q8RI59|THIE_FUSNN Thiamine-phosphate synthase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=thiE PE=3 SV=1 7 213 1.0E-30
sp|O28205|THIE_ARCFU Thiamine-phosphate synthase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=thiE PE=3 SV=1 7 222 1.0E-30
sp|O58878|THIE_PYRHO Thiamine-phosphate synthase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=thiE PE=3 SV=2 7 218 1.0E-30
sp|Q9LIQ4|THIM_ARATH Hydroxyethylthiazole kinase OS=Arabidopsis thaliana GN=THIM PE=1 SV=1 257 534 1.0E-30
sp|Q3IP34|THIE_NATPD Thiamine-phosphate synthase OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=thiE PE=3 SV=1 5 218 1.0E-30
sp|Q8YX72|THIE_NOSS1 Thiamine-phosphate synthase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=thiE PE=3 SV=2 8 176 2.0E-30
sp|O48881|TPS1_BRANA Thiamine biosynthetic bifunctional enzyme BTH1, chloroplastic OS=Brassica napus GN=BTH1 PE=1 SV=1 21 201 2.0E-30
sp|Q186F8|THIE_PEPD6 Thiamine-phosphate synthase OS=Peptoclostridium difficile (strain 630) GN=thiE PE=3 SV=1 8 205 2.0E-30
sp|Q81IG8|THIE_BACCR Thiamine-phosphate synthase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=thiE PE=3 SV=2 21 214 2.0E-30
sp|A5GMH7|THIE_SYNPW Thiamine-phosphate synthase OS=Synechococcus sp. (strain WH7803) GN=thiE PE=3 SV=1 19 217 2.0E-30
sp|A2BSJ5|THIE_PROMS Thiamine-phosphate synthase OS=Prochlorococcus marinus (strain AS9601) GN=thiE PE=3 SV=1 33 210 2.0E-30
sp|A9VRN4|THIE_BACWK Thiamine-phosphate synthase OS=Bacillus weihenstephanensis (strain KBAB4) GN=thiE PE=3 SV=1 21 214 2.0E-30
sp|Q8DQK4|THIE1_STRR6 Thiamine-phosphate synthase 1 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=thiE1 PE=3 SV=1 7 214 2.0E-30
sp|A3M6H8|THIM_ACIBT Hydroxyethylthiazole kinase OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=thiM PE=3 SV=2 245 533 3.0E-30
sp|B2HTR5|THIM_ACIBC Hydroxyethylthiazole kinase OS=Acinetobacter baumannii (strain ACICU) GN=thiM PE=3 SV=1 245 462 3.0E-30
sp|B7H7H5|THIE_BACC4 Thiamine-phosphate synthase OS=Bacillus cereus (strain B4264) GN=thiE PE=3 SV=1 21 214 4.0E-30
sp|B0V782|THIM_ACIBY Hydroxyethylthiazole kinase OS=Acinetobacter baumannii (strain AYE) GN=thiM PE=3 SV=1 245 462 4.0E-30
sp|B7IAM8|THIM_ACIB5 Hydroxyethylthiazole kinase OS=Acinetobacter baumannii (strain AB0057) GN=thiM PE=3 SV=1 245 462 4.0E-30
sp|B7H160|THIM_ACIB3 Hydroxyethylthiazole kinase OS=Acinetobacter baumannii (strain AB307-0294) GN=thiM PE=3 SV=1 245 462 4.0E-30
sp|Q18GX8|THIM_HALWD Hydroxyethylthiazole kinase OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=thiM PE=3 SV=1 259 518 4.0E-30
sp|Q65DK0|THIE_BACLD Thiamine-phosphate synthase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=thiE PE=3 SV=1 7 221 6.0E-30
sp|Q8DHK2|THIE_THEEB Thiamine-phosphate synthase OS=Thermosynechococcus elongatus (strain BP-1) GN=thiE PE=3 SV=2 7 212 6.0E-30
sp|Q7V0I3|THIE_PROMP Thiamine-phosphate synthase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=thiE PE=3 SV=1 19 210 9.0E-30
sp|Q81Z95|THIE_BACAN Thiamine-phosphate synthase OS=Bacillus anthracis GN=thiE PE=3 SV=1 7 213 9.0E-30
sp|C3L627|THIE_BACAC Thiamine-phosphate synthase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=thiE PE=3 SV=1 7 213 9.0E-30
sp|C3PBW1|THIE_BACAA Thiamine-phosphate synthase OS=Bacillus anthracis (strain A0248) GN=thiE PE=3 SV=1 7 213 9.0E-30
sp|A8FIR6|THIE_BACP2 Thiamine-phosphate synthase OS=Bacillus pumilus (strain SAFR-032) GN=thiE PE=3 SV=1 7 222 1.0E-29
sp|Q0IC17|THIE_SYNS3 Thiamine-phosphate synthase OS=Synechococcus sp. (strain CC9311) GN=thiE PE=3 SV=2 24 213 1.0E-29
sp|B0S0L6|THIM_FINM2 Hydroxyethylthiazole kinase OS=Finegoldia magna (strain ATCC 29328) GN=thiM PE=3 SV=1 247 453 1.0E-29
sp|B5YA97|THIE_DICT6 Thiamine-phosphate synthase OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=thiE PE=3 SV=1 5 221 2.0E-29
sp|B5XP99|THIM_KLEP3 Hydroxyethylthiazole kinase OS=Klebsiella pneumoniae (strain 342) GN=thiM PE=3 SV=1 253 520 2.0E-29
sp|P61413|THIE_METMP Thiamine-phosphate synthase OS=Methanococcus maripaludis (strain S2 / LL) GN=thiE PE=3 SV=1 22 220 2.0E-29
sp|B0VM84|THIM_ACIBS Hydroxyethylthiazole kinase OS=Acinetobacter baumannii (strain SDF) GN=thiM PE=3 SV=1 245 462 2.0E-29
sp|Q8TMD6|THIE_METAC Thiamine-phosphate synthase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=thiE PE=3 SV=1 7 221 2.0E-29
sp|A7GKR4|THIE_BACCN Thiamine-phosphate synthase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=thiE PE=3 SV=1 7 200 2.0E-29
sp|C3KZ28|THIM2_CLOB6 Hydroxyethylthiazole kinase 2 OS=Clostridium botulinum (strain 657 / Type Ba4) GN=thiM2 PE=3 SV=1 254 517 3.0E-29
sp|Q97RS5|THIE1_STRPN Thiamine-phosphate synthase 1 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=thiE1 PE=3 SV=1 7 214 3.0E-29
sp|A6VG83|THIE_METM7 Thiamine-phosphate synthase OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=thiE PE=3 SV=1 26 220 3.0E-29
sp|B0RGG4|THIM_CLAMS Hydroxyethylthiazole kinase OS=Clavibacter michiganensis subsp. sepedonicus (strain ATCC 33113 / DSM 20744 / JCM 9667 / LMG 2889 / C-1) GN=thiM PE=3 SV=1 256 534 5.0E-29
sp|Q18GX9|THIE_HALWD Thiamine-phosphate synthase OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=thiE PE=3 SV=1 3 223 5.0E-29
sp|A4FX32|THIE_METM5 Thiamine-phosphate synthase OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=thiE PE=3 SV=1 22 220 5.0E-29
sp|Q466J5|THIE_METBF Thiamine-phosphate synthase OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=thiE PE=3 SV=1 7 221 5.0E-29
sp|B1IHH3|THIM2_CLOBK Hydroxyethylthiazole kinase 2 OS=Clostridium botulinum (strain Okra / Type B1) GN=thiM2 PE=3 SV=1 254 517 6.0E-29
sp|A7GFJ3|THIM2_CLOBL Hydroxyethylthiazole kinase 2 OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=thiM2 PE=3 SV=1 254 517 9.0E-29
sp|A6TBJ8|THIM_KLEP7 Hydroxyethylthiazole kinase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=thiM PE=3 SV=1 253 520 1.0E-28
sp|Q8FTH8|THIED_COREF Thiamine biosynthesis multifunctional protein ThiED OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=thiED PE=3 SV=1 5 221 1.0E-28
sp|A8IGE6|THIE_AZOC5 Thiamine-phosphate synthase OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=thiE PE=3 SV=2 4 221 2.0E-28
sp|Q0TQV3|THIM_CLOP1 Hydroxyethylthiazole kinase OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=thiM PE=3 SV=1 257 450 2.0E-28
sp|Q0AZ87|THIM_SYNWW Hydroxyethylthiazole kinase OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=thiM PE=3 SV=1 249 533 2.0E-28
sp|A5CSW0|THIM_CLAM3 Hydroxyethylthiazole kinase OS=Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382) GN=thiM PE=3 SV=1 256 533 2.0E-28
sp|A5I421|THIM2_CLOBH Hydroxyethylthiazole kinase 2 OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=thiM2 PE=3 SV=2 254 520 3.0E-28
sp|A7FVR9|THIM2_CLOB1 Hydroxyethylthiazole kinase 2 OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=thiM2 PE=3 SV=1 254 520 3.0E-28
sp|C1FR28|THIM2_CLOBJ Hydroxyethylthiazole kinase 2 OS=Clostridium botulinum (strain Kyoto / Type A2) GN=thiM2 PE=3 SV=1 254 517 3.0E-28
sp|A4WQ25|THIM_RHOS5 Hydroxyethylthiazole kinase OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=thiM PE=3 SV=1 250 533 3.0E-28
sp|B5Y6I1|THIE_COPPD Thiamine-phosphate synthase OS=Coprothermobacter proteolyticus (strain ATCC 35245 / DSM 5265 / BT) GN=thiE PE=3 SV=1 7 217 4.0E-28
sp|P66921|THIE2_STRR6 Thiamine-phosphate synthase 2 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=thiE2 PE=3 SV=1 8 205 4.0E-28
sp|P66920|THIE2_STRPN Thiamine-phosphate synthase 2 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=thiE2 PE=3 SV=1 8 205 4.0E-28
sp|B2J6F7|THIE_NOSP7 Thiamine-phosphate synthase OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=thiE PE=3 SV=1 8 176 7.0E-28
sp|B3W783|THIE_LACCB Thiamine-phosphate synthase OS=Lactobacillus casei (strain BL23) GN=thiE PE=3 SV=1 1 227 7.0E-28
sp|A4XG66|THIE_CALS8 Thiamine-phosphate synthase OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=thiE PE=3 SV=2 5 221 7.0E-28
sp|B2GBV7|THIM_LACF3 Hydroxyethylthiazole kinase OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=thiM PE=3 SV=1 257 457 8.0E-28
sp|A1W068|THIE_CAMJJ Thiamine-phosphate synthase OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=thiE PE=3 SV=1 23 213 9.0E-28
sp|A8FMD4|THIE_CAMJ8 Thiamine-phosphate synthase OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=thiE PE=3 SV=1 23 213 9.0E-28
sp|B8E358|THIE_DICTD Thiamine-phosphate synthase OS=Dictyoglomus turgidum (strain Z-1310 / DSM 6724) GN=thiE PE=3 SV=1 5 221 1.0E-27
sp|A6UPE6|THIE_METVS Thiamine-phosphate synthase OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=thiE PE=3 SV=1 8 220 2.0E-27
sp|B1KW01|THIM1_CLOBM Hydroxyethylthiazole kinase 1 OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=thiM1 PE=3 SV=1 254 520 2.0E-27
sp|A7NRF7|THIE_ROSCS Thiamine-phosphate synthase OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=thiE PE=3 SV=1 8 212 2.0E-27
sp|Q3B4B1|THIE_CHLL7 Thiamine-phosphate synthase OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=thiE PE=3 SV=1 24 222 4.0E-27
sp|Q9PNL3|THIE_CAMJE Thiamine-phosphate synthase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=thiE PE=3 SV=1 3 213 5.0E-27
sp|C0QAT7|THIM_DESAH Hydroxyethylthiazole kinase OS=Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2) GN=thiM PE=3 SV=1 253 533 5.0E-27
sp|Q5V0G6|THIE_HALMA Thiamine-phosphate synthase OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=thiE PE=3 SV=1 4 200 6.0E-27
sp|Q5HU23|THIE_CAMJR Thiamine-phosphate synthase OS=Campylobacter jejuni (strain RM1221) GN=thiE PE=3 SV=1 23 213 6.0E-27
sp|P39594|THIE_BACSU Thiamine-phosphate synthase OS=Bacillus subtilis (strain 168) GN=thiE PE=1 SV=1 7 221 6.0E-27
sp|Q03GM4|THIE_PEDPA Thiamine-phosphate synthase OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=thiE PE=3 SV=1 8 180 1.0E-26
sp|Q03CB2|THIE_LACC3 Thiamine-phosphate synthase OS=Lactobacillus casei (strain ATCC 334) GN=thiE PE=3 SV=1 1 227 2.0E-26
sp|A4IN28|THIE_GEOTN Thiamine-phosphate synthase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=thiE PE=3 SV=1 7 200 2.0E-26
sp|C1DCM3|THIE_LARHH Thiamine-phosphate synthase OS=Laribacter hongkongensis (strain HLHK9) GN=thiE PE=3 SV=1 4 213 2.0E-26
sp|Q9RGS5|THIE_STACT Thiamine-phosphate synthase OS=Staphylococcus carnosus (strain TM300) GN=thiE PE=3 SV=1 5 221 2.0E-26
sp|C4XIJ3|THIM_DESMR Hydroxyethylthiazole kinase OS=Desulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1) GN=thiM PE=3 SV=1 257 457 3.0E-26
sp|Q7VAV5|THIE_PROMA Thiamine-phosphate synthase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=thiE PE=3 SV=1 30 215 3.0E-26
sp|A6GWR9|THIE_FLAPJ Thiamine-phosphate synthase OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=thiE PE=3 SV=1 21 213 4.0E-26
sp|A9AAG9|THIE_METM6 Thiamine-phosphate synthase OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=thiE PE=3 SV=1 22 220 5.0E-26
sp|B7GQ20|THIM_BIFLS Hydroxyethylthiazole kinase OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) GN=thiM PE=3 SV=1 244 527 6.0E-26
sp|A5UUL3|THIE_ROSS1 Thiamine-phosphate synthase OS=Roseiflexus sp. (strain RS-1) GN=thiE PE=3 SV=1 8 225 6.0E-26
sp|Q3J061|THIM_RHOS4 Hydroxyethylthiazole kinase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=thiM PE=3 SV=1 250 533 8.0E-26
sp|Q8PS49|THIE_METMA Thiamine-phosphate synthase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=thiE PE=3 SV=1 1 221 1.0E-25
sp|Q8UAS9|THIM_AGRFC Probable hydroxyethylthiazole kinase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=thiM PE=3 SV=1 252 536 1.0E-25
sp|B9KL69|THIM_RHOSK Hydroxyethylthiazole kinase OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=thiM PE=3 SV=1 250 446 2.0E-25
sp|A3PM38|THIM_RHOS1 Hydroxyethylthiazole kinase OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=thiM PE=3 SV=1 250 446 2.0E-25
sp|C4XIJ2|THIE_DESMR Thiamine-phosphate synthase OS=Desulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1) GN=thiE PE=3 SV=1 3 155 2.0E-25
sp|Q162K5|THIM_ROSDO Hydroxyethylthiazole kinase OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=thiM PE=3 SV=1 256 461 2.0E-25
sp|Q8KD79|THIE_CHLTE Thiamine-phosphate synthase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=thiE PE=3 SV=1 30 213 2.0E-25
sp|Q7NNK8|THIE_GLOVI Thiamine-phosphate synthase OS=Gloeobacter violaceus (strain PCC 7421) GN=thiE PE=3 SV=2 8 206 2.0E-25
sp|B8GLE3|THIE_THISH Thiamine-phosphate synthase OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=thiE PE=3 SV=1 21 218 2.0E-25
sp|A5FJJ1|THIE_FLAJ1 Thiamine-phosphate synthase OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=thiE PE=3 SV=1 21 171 3.0E-25
sp|A5EY60|THIM_DICNV Hydroxyethylthiazole kinase OS=Dichelobacter nodosus (strain VCS1703A) GN=thiM PE=3 SV=1 264 519 3.0E-25
sp|A1BGM7|THIE_CHLPD Thiamine-phosphate synthase OS=Chlorobium phaeobacteroides (strain DSM 266) GN=thiE PE=3 SV=1 30 212 3.0E-25
sp|Q1MRJ6|THIE_LAWIP Thiamine-phosphate synthase OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=thiE PE=3 SV=1 2 205 4.0E-25
sp|Q2Y5Q6|THIE_NITMU Thiamine-phosphate synthase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=thiE PE=3 SV=1 29 218 4.0E-25
sp|O67378|THIE2_AQUAE Putative thiamine-phosphate synthase 2 OS=Aquifex aeolicus (strain VF5) GN=thiE2 PE=3 SV=1 8 171 4.0E-25
sp|Q7U5U1|THIE_SYNPX Thiamine-phosphate synthase OS=Synechococcus sp. (strain WH8102) GN=thiE PE=3 SV=1 19 213 4.0E-25
sp|B3QNM2|THIE_CHLP8 Thiamine-phosphate synthase OS=Chlorobaculum parvum (strain NCIB 8327) GN=thiE PE=3 SV=1 30 213 4.0E-25
sp|A7ZA58|THIE_BACMF Thiamine-phosphate synthase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=thiE PE=3 SV=1 7 222 5.0E-25
sp|Q253G3|THIM_CHLFF Hydroxyethylthiazole kinase OS=Chlamydophila felis (strain Fe/C-56) GN=thiM PE=3 SV=1 249 529 6.0E-25
sp|Q5LCA7|THIE_BACFN Thiamine-phosphate synthase OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=thiE PE=3 SV=1 23 216 7.0E-25
sp|A6L645|THIE_BACV8 Thiamine-phosphate synthase OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=thiE PE=3 SV=1 23 216 1.0E-24
sp|Q8AA13|THIE_BACTN Thiamine-phosphate synthase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=thiE PE=3 SV=1 23 206 1.0E-24
sp|Q5SKG9|THIE_THET8 Thiamine-phosphate synthase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=thiE PE=3 SV=1 24 216 2.0E-24
sp|Q72KL8|THIE_THET2 Thiamine-phosphate synthase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=thiE PE=3 SV=1 24 216 2.0E-24
sp|Q8XKQ7|THIM_CLOPE Hydroxyethylthiazole kinase OS=Clostridium perfringens (strain 13 / Type A) GN=thiM PE=3 SV=1 257 536 2.0E-24
sp|Q64TA1|THIE_BACFR Thiamine-phosphate synthase OS=Bacteroides fragilis (strain YCH46) GN=thiE PE=3 SV=1 23 216 2.0E-24
sp|Q8E092|THIE_STRA5 Thiamine-phosphate synthase OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=thiE PE=3 SV=1 21 213 3.0E-24
sp|Q3K1L6|THIE_STRA1 Thiamine-phosphate synthase OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=thiE PE=3 SV=1 21 213 3.0E-24
sp|Q8G7X0|THIM_BIFLO Hydroxyethylthiazole kinase OS=Bifidobacterium longum (strain NCC 2705) GN=thiM PE=3 SV=1 244 527 3.0E-24
sp|Q824E8|THIM_CHLCV Hydroxyethylthiazole kinase OS=Chlamydophila caviae (strain GPIC) GN=thiM PE=3 SV=1 249 529 3.0E-24
sp|B3GX82|THIE_ACTP7 Thiamine-phosphate synthase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=thiE PE=3 SV=1 7 213 4.0E-24
sp|A6VPG9|THIE_ACTSZ Thiamine-phosphate synthase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=thiE PE=3 SV=1 7 214 4.0E-24
sp|B3DQ80|THIM_BIFLD Hydroxyethylthiazole kinase OS=Bifidobacterium longum (strain DJO10A) GN=thiM PE=3 SV=1 244 527 4.0E-24
sp|Q3AL68|THIE_SYNSC Thiamine-phosphate synthase OS=Synechococcus sp. (strain CC9605) GN=thiE PE=3 SV=1 19 176 5.0E-24
sp|C1AE25|THIM_GEMAT Hydroxyethylthiazole kinase OS=Gemmatimonas aurantiaca (strain T-27 / DSM 14586 / JCM 11422 / NBRC 100505) GN=thiM PE=3 SV=1 257 534 5.0E-24
sp|Q8CNK2|THIE_STAES Thiamine-phosphate synthase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=thiE PE=3 SV=1 7 205 5.0E-24
sp|Q5HMD0|THIE_STAEQ Thiamine-phosphate synthase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=thiE PE=3 SV=2 7 205 5.0E-24
sp|Q8E5W9|THIE_STRA3 Thiamine-phosphate synthase OS=Streptococcus agalactiae serotype III (strain NEM316) GN=thiE PE=3 SV=1 21 213 7.0E-24
sp|Q21MI9|THIE_SACD2 Thiamine-phosphate synthase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=thiE PE=3 SV=1 1 216 7.0E-24
sp|B9MN52|THIE_CALBD Thiamine-phosphate synthase OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=thiE PE=3 SV=1 6 220 8.0E-24
sp|Q2S2A8|THIE_SALRD Thiamine-phosphate synthase OS=Salinibacter ruber (strain DSM 13855 / M31) GN=thiE PE=3 SV=1 21 217 1.0E-23
sp|Q4L7X3|THIE_STAHJ Thiamine-phosphate synthase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=thiE PE=3 SV=1 7 218 1.0E-23
sp|P57930|THIE_PASMU Thiamine-phosphate synthase OS=Pasteurella multocida (strain Pm70) GN=thiE PE=3 SV=1 19 215 1.0E-23
sp|Q2RGI8|THIE_MOOTA Thiamine-phosphate synthase OS=Moorella thermoacetica (strain ATCC 39073) GN=thiE PE=3 SV=1 5 198 1.0E-23
sp|A5WDP0|THIE_PSYWF Thiamine-phosphate synthase OS=Psychrobacter sp. (strain PRwf-1) GN=thiE PE=3 SV=1 7 213 1.0E-23
sp|Q0STA0|THIM_CLOPS Hydroxyethylthiazole kinase OS=Clostridium perfringens (strain SM101 / Type A) GN=thiM PE=3 SV=1 257 450 1.0E-23
sp|O66833|THIE1_AQUAE Thiamine-phosphate synthase 1 OS=Aquifex aeolicus (strain VF5) GN=thiE1 PE=3 SV=1 4 218 1.0E-23
sp|B2G7Q2|THIM_LACRJ Hydroxyethylthiazole kinase OS=Lactobacillus reuteri (strain JCM 1112) GN=thiM PE=3 SV=1 255 490 2.0E-23
sp|A5VK99|THIM_LACRD Hydroxyethylthiazole kinase OS=Lactobacillus reuteri (strain DSM 20016) GN=thiM PE=3 SV=1 255 490 2.0E-23
sp|A4SEP8|THIE_CHLPM Thiamine-phosphate synthase OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=thiE PE=3 SV=1 15 213 2.0E-23
sp|Q8YA44|THIE_LISMO Thiamine-phosphate synthase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=thiE PE=3 SV=1 7 205 2.0E-23
sp|Q9HIQ4|THIE_THEAC Thiamine-phosphate synthase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=thiE PE=3 SV=1 21 213 2.0E-23
sp|B7GKQ8|THIE_ANOFW Thiamine-phosphate synthase OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=thiE PE=3 SV=1 1 217 2.0E-23
sp|B1HX34|THIE_LYSSC Thiamine-phosphate synthase OS=Lysinibacillus sphaericus (strain C3-41) GN=thiE PE=3 SV=1 1 211 3.0E-23
sp|Q3JDH3|THIE_NITOC Thiamine-phosphate synthase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=thiE PE=3 SV=1 8 224 4.0E-23
sp|Q6GEY4|THIE_STAAR Thiamine-phosphate synthase OS=Staphylococcus aureus (strain MRSA252) GN=thiE PE=3 SV=1 1 213 4.0E-23
sp|Q0I131|THIE_HAES1 Thiamine-phosphate synthase OS=Haemophilus somnus (strain 129Pt) GN=thiE PE=3 SV=1 19 213 4.0E-23
sp|Q5KZU0|THIE_GEOKA Thiamine-phosphate synthase OS=Geobacillus kaustophilus (strain HTA426) GN=thiE PE=3 SV=1 27 200 4.0E-23
sp|Q2YUL2|THIE_STAAB Thiamine-phosphate synthase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=thiE PE=3 SV=1 1 213 5.0E-23
sp|Q03NS1|THIE_LACBA Thiamine-phosphate synthase OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=thiE PE=3 SV=1 9 176 5.0E-23
sp|Q8NQH1|THIED_CORGL Thiamine biosynthesis multifunctional protein ThiED OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=theD PE=3 SV=2 5 201 7.0E-23
sp|A5UGT0|THIE_HAEIG Thiamine-phosphate synthase OS=Haemophilus influenzae (strain PittGG) GN=thiE PE=3 SV=1 21 213 1.0E-22
sp|Q65US7|THIE_MANSM Thiamine-phosphate synthase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=thiE PE=3 SV=1 7 214 1.0E-22
sp|P66919|THIE_STAAN Thiamine-phosphate synthase OS=Staphylococcus aureus (strain N315) GN=thiE PE=1 SV=1 1 213 2.0E-22
sp|P66918|THIE_STAAM Thiamine-phosphate synthase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=thiE PE=3 SV=1 1 213 2.0E-22
sp|A6QIT5|THIE_STAAE Thiamine-phosphate synthase OS=Staphylococcus aureus (strain Newman) GN=thiE PE=3 SV=1 1 213 2.0E-22
sp|Q5HEA8|THIE_STAAC Thiamine-phosphate synthase OS=Staphylococcus aureus (strain COL) GN=thiE PE=3 SV=1 1 213 2.0E-22
sp|A5IUN7|THIE_STAA9 Thiamine-phosphate synthase OS=Staphylococcus aureus (strain JH9) GN=thiE PE=3 SV=1 1 213 2.0E-22
sp|Q2FWG3|THIE_STAA8 Thiamine-phosphate synthase OS=Staphylococcus aureus (strain NCTC 8325) GN=thiE PE=3 SV=1 1 213 2.0E-22
sp|Q2FF35|THIE_STAA3 Thiamine-phosphate synthase OS=Staphylococcus aureus (strain USA300) GN=thiE PE=3 SV=1 1 213 2.0E-22
sp|A6U3H7|THIE_STAA2 Thiamine-phosphate synthase OS=Staphylococcus aureus (strain JH1) GN=thiE PE=3 SV=1 1 213 2.0E-22
sp|A7X4S8|THIE_STAA1 Thiamine-phosphate synthase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=thiE PE=3 SV=1 1 213 2.0E-22
sp|Q1CT27|THIE_HELPH Thiamine-phosphate synthase OS=Helicobacter pylori (strain HPAG1) GN=thiE PE=3 SV=1 24 213 2.0E-22
sp|Q9ZL01|THIE_HELPJ Thiamine-phosphate synthase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=thiE PE=3 SV=1 24 213 2.0E-22
sp|Q7V8I3|THIE_PROMM Thiamine-phosphate synthase OS=Prochlorococcus marinus (strain MIT 9313) GN=thiE PE=3 SV=1 22 221 3.0E-22
sp|Q8NVH5|THIE_STAAW Thiamine-phosphate synthase OS=Staphylococcus aureus (strain MW2) GN=thiE PE=3 SV=1 1 213 4.0E-22
sp|Q6G7L9|THIE_STAAS Thiamine-phosphate synthase OS=Staphylococcus aureus (strain MSSA476) GN=thiE PE=3 SV=1 1 213 4.0E-22
sp|Q47R33|THIE_THEFY Thiamine-phosphate synthase OS=Thermobifida fusca (strain YX) GN=thiE PE=3 SV=1 22 213 4.0E-22
sp|B2G7Q4|THIE_LACRJ Thiamine-phosphate synthase OS=Lactobacillus reuteri (strain JCM 1112) GN=thiE PE=3 SV=1 7 205 5.0E-22
sp|A5VKA1|THIE_LACRD Thiamine-phosphate synthase OS=Lactobacillus reuteri (strain DSM 20016) GN=thiE PE=3 SV=1 7 205 5.0E-22
sp|P71350|THIE_HAEIN Thiamine-phosphate synthase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=thiE PE=1 SV=1 21 213 5.0E-22
sp|A2RKJ7|THIE_LACLM Thiamine-phosphate synthase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=thiE PE=3 SV=1 4 213 5.0E-22
sp|Q38ZM1|THIE_LACSS Thiamine-phosphate synthase OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=thiE PE=3 SV=1 1 213 6.0E-22
sp|A5UA71|THIE_HAEIE Thiamine-phosphate synthase OS=Haemophilus influenzae (strain PittEE) GN=thiE PE=3 SV=1 21 213 7.0E-22
sp|Q4QNC6|THIE_HAEI8 Thiamine-phosphate synthase OS=Haemophilus influenzae (strain 86-028NP) GN=thiE PE=3 SV=1 21 213 7.0E-22
sp|Q3K6C1|THIE_PSEPF Thiamine-phosphate synthase OS=Pseudomonas fluorescens (strain Pf0-1) GN=thiE PE=3 SV=1 8 212 7.0E-22
sp|P61422|THIED_GEOSL Thiamine biosynthesis bifunctional protein ThiED OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=thiDE PE=3 SV=1 8 224 7.0E-22
sp|A2CB21|THIE_PROM3 Thiamine-phosphate synthase OS=Prochlorococcus marinus (strain MIT 9303) GN=thiE PE=3 SV=1 22 221 8.0E-22
sp|C1A163|THIM_RHOE4 Hydroxyethylthiazole kinase OS=Rhodococcus erythropolis (strain PR4 / NBRC 100887) GN=thiM PE=3 SV=1 250 533 9.0E-22
sp|Q4K5I7|THIE_PSEF5 Thiamine-phosphate synthase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=thiE PE=3 SV=1 8 224 1.0E-21
sp|O25514|THIE_HELPY Thiamine-phosphate synthase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=thiE PE=3 SV=1 24 213 2.0E-21
sp|Q7M9N9|THIE_WOLSU Thiamine-phosphate synthase OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=thiE PE=3 SV=1 24 221 2.0E-21
sp|A0AFC5|THIE_LISW6 Thiamine-phosphate synthase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=thiE PE=3 SV=1 7 200 2.0E-21
sp|Q8ESZ3|THIE_OCEIH Thiamine-phosphate synthase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=thiE PE=3 SV=1 9 213 2.0E-21
sp|Q49Z39|THIE_STAS1 Thiamine-phosphate synthase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=thiE PE=3 SV=1 5 213 2.0E-21
sp|A8M9N4|THIE_CALMQ Thiamine-phosphate synthase OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=thiE PE=3 SV=1 21 213 3.0E-21
sp|Q9PGC4|THIE_XYLFA Thiamine-phosphate synthase OS=Xylella fastidiosa (strain 9a5c) GN=thiE PE=3 SV=1 8 226 3.0E-21
sp|Q824E9|THIE_CHLCV Thiamine-phosphate synthase OS=Chlamydophila caviae (strain GPIC) GN=thiE PE=3 SV=1 6 175 3.0E-21
sp|A7IGG9|THIE_XANP2 Thiamine-phosphate synthase OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=thiE PE=3 SV=1 4 221 4.0E-21
sp|C1KZ34|THIE_LISMC Thiamine-phosphate synthase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=thiE PE=3 SV=1 27 205 5.0E-21
sp|B1MX63|THIE_LEUCK Thiamine-phosphate synthase OS=Leuconostoc citreum (strain KM20) GN=thiE PE=3 SV=1 9 203 5.0E-21
sp|Q87AX6|THIE_XYLFT Thiamine-phosphate synthase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=thiE PE=3 SV=1 8 226 5.0E-21
sp|Q92EW5|THIE_LISIN Thiamine-phosphate synthase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=thiE PE=3 SV=1 27 213 7.0E-21
sp|B2GBV5|THIE_LACF3 Thiamine-phosphate synthase OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=thiE PE=3 SV=1 9 180 8.0E-21
sp|Q67T51|THIME_SYMTH Thiamine biosynthesis bifunctional protein ThiM/ThiE OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=thiM/thiE PE=3 SV=1 256 519 9.0E-21
sp|A1TYG6|THIE_MARHV Thiamine-phosphate synthase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=thiE PE=3 SV=1 2 225 1.0E-20
sp|A5W9G9|THIE_PSEP1 Thiamine-phosphate synthase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=thiE PE=3 SV=1 8 225 2.0E-20
sp|B1J1Y7|THIE_PSEPW Thiamine-phosphate synthase OS=Pseudomonas putida (strain W619) GN=thiE PE=3 SV=1 8 225 2.0E-20
sp|Q2T5T2|THIM_BURTA Hydroxyethylthiazole kinase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=thiM PE=3 SV=1 257 446 2.0E-20
sp|A7IA09|THIE_METB6 Thiamine-phosphate synthase OS=Methanoregula boonei (strain 6A8) GN=thiE PE=3 SV=1 20 213 2.0E-20
sp|Q0AFV0|THIE_NITEC Thiamine-phosphate synthase OS=Nitrosomonas eutropha (strain C91) GN=thiE PE=3 SV=1 11 217 2.0E-20
sp|Q9CG48|THIE_LACLA Thiamine-phosphate synthase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=thiE PE=3 SV=1 9 213 2.0E-20
sp|Q890C0|THIE_LACPL Thiamine-phosphate synthase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=thiE PE=3 SV=1 9 176 2.0E-20
sp|Q88DP1|THIE_PSEPK Thiamine-phosphate synthase OS=Pseudomonas putida (strain KT2440) GN=thiE PE=3 SV=1 8 225 2.0E-20
sp|B8DET0|THIE_LISMH Thiamine-phosphate synthase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=thiE PE=3 SV=1 27 205 2.0E-20
sp|B8ZN21|THIM2_STRPJ Hydroxyethylthiazole kinase 2 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=thiM2 PE=3 SV=1 266 455 3.0E-20
sp|B8DSX7|THIM_BIFA0 Hydroxyethylthiazole kinase OS=Bifidobacterium animalis subsp. lactis (strain AD011) GN=thiM PE=3 SV=1 247 527 3.0E-20
sp|C3K2K2|THIE_PSEFS Thiamine-phosphate synthase OS=Pseudomonas fluorescens (strain SBW25) GN=thiE PE=3 SV=1 8 212 3.0E-20
sp|Q87VY6|THIE_PSESM Thiamine-phosphate synthase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=thiE PE=3 SV=1 8 212 3.0E-20
sp|Q67T51|THIME_SYMTH Thiamine biosynthesis bifunctional protein ThiM/ThiE OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=thiM/thiE PE=3 SV=1 5 139 2.0E-17
[Show less]

GO

GO Term Description Terminal node
GO:0004417 hydroxyethylthiazole kinase activity Yes
GO:0009228 thiamine biosynthetic process Yes
GO:0042723 thiamine-containing compound metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0044281 small molecule metabolic process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0016301 kinase activity No
GO:0008150 biological_process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:1901617 organic hydroxy compound biosynthetic process No
GO:0034308 primary alcohol metabolic process No
GO:0072527 pyrimidine-containing compound metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0042724 thiamine-containing compound biosynthetic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0006790 sulfur compound metabolic process No
GO:0009058 biosynthetic process No
GO:0006772 thiamine metabolic process No
GO:0072528 pyrimidine-containing compound biosynthetic process No
GO:0034309 primary alcohol biosynthetic process No
GO:0042364 water-soluble vitamin biosynthetic process No
GO:0044283 small molecule biosynthetic process No
GO:0009110 vitamin biosynthetic process No
GO:1901615 organic hydroxy compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0046165 alcohol biosynthetic process No
GO:0044237 cellular metabolic process No
GO:0003824 catalytic activity No
GO:0006767 water-soluble vitamin metabolic process No
GO:0009987 cellular process No
GO:0006766 vitamin metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0019438 aromatic compound biosynthetic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0018130 heterocycle biosynthetic process No
GO:0006807 nitrogen compound metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0006066 alcohol metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0008152 metabolic process No
GO:0044272 sulfur compound biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 14 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|040430
MANINYSIYLVTGRELLPPGKDYLESLEEALQGGVTVVQIREKNTETEEFIQIAKASKALCDRYNVPILVNDRVD
VALAINAHGVHLGQTDMTVAQAKILLPKGSIIGVSCNNIEHVKEAIKDGANYIGIGPVWDTKTKALTNPIIGVRG
VGQMLEALDGTNVKAVAIGGIKSSNLLRTLYGSVSSTRHALDGVAVVSEIIASRNPKEAASRLAGIIQAFRAEFA
IVQGWTFESKLYGQNDAPPTTDEILDRVVKLMAKIKELGPLVHQITNNVVATQSANITLALGASPIMATAPEEME
DLERIVGALLVNIGTLTAATLEGMRKAGFHANSFRKPLIFDPVGFGASQFRKGSANELLNIYQASVIKGNAGELA
ALAGSGEVESKGVDSIGTGFKDPVTFVKQLSRRERCIVVMTGPTDYISDGKTVVSLRNGHDILGKITGSGCIAGS
SIASYCAAASATASEDGYQSNTEGSLVKGDMLLGAIAGVLVLTIAAEIAVELDYVRGPGTFLSGLIDALWTLTAD
DVVRRAKITVETS*
Coding >AgabiH97|040430
ATGGCGAACATTAACTACTCCATCTATCTAGTGACAGGAAGGGAGCTACTTCCTCCAGGAAAGGACTATTTGGAA
TCTTTGGAAGAAGCGCTCCAAGGCGGGGTTACCGTTGTTCAGATTCGCGAAAAAAACACTGAAACGGAGGAGTTC
ATCCAAATTGCCAAAGCCTCAAAGGCATTATGTGACCGATACAATGTGCCCATTCTGGTTAACGATAGGGTTGAC
GTTGCCCTTGCAATCAACGCCCATGGAGTACACCTTGGACAAACGGACATGACGGTCGCTCAAGCAAAGATTTTG
TTGCCGAAGGGCAGTATAATTGGAGTGAGCTGCAACAATATTGAGCATGTCAAGGAGGCGATAAAAGACGGCGCA
AATTATATTGGCATCGGTCCTGTCTGGGATACAAAAACGAAAGCTTTGACGAACCCTATCATTGGCGTGCGAGGA
GTAGGTCAAATGCTTGAAGCATTGGATGGAACAAACGTCAAAGCAGTAGCTATTGGTGGCATCAAGAGCAGCAAT
TTGCTTAGAACTCTATATGGAAGTGTCTCTTCCACAAGGCACGCTCTTGATGGTGTTGCGGTCGTCTCTGAGATC
ATAGCATCCCGGAATCCGAAAGAAGCAGCCTCAAGGTTGGCAGGTATAATCCAAGCCTTCAGAGCCGAGTTTGCG
ATTGTCCAAGGGTGGACATTTGAGTCAAAATTATATGGGCAGAATGATGCCCCACCTACCACCGATGAGATTCTC
GATCGTGTTGTTAAGCTAATGGCGAAGATTAAAGAACTTGGGCCTCTGGTACACCAGATCACCAACAACGTTGTT
GCCACTCAATCCGCTAATATCACCCTCGCGCTGGGAGCAAGTCCCATCATGGCCACCGCACCGGAAGAAATGGAA
GATCTTGAACGTATTGTTGGAGCTCTTCTTGTCAATATCGGCACCTTGACAGCTGCAACGTTGGAAGGCATGCGC
AAAGCAGGCTTCCATGCAAATTCCTTCAGGAAACCTTTAATTTTTGATCCCGTTGGCTTCGGTGCGAGTCAGTTT
AGAAAGGGGTCTGCCAATGAACTCTTGAATATCTATCAAGCAAGTGTAATCAAAGGAAACGCGGGAGAACTTGCT
GCTCTGGCCGGTTCTGGCGAGGTCGAATCTAAAGGTGTTGATAGTATTGGAACCGGTTTCAAAGACCCAGTCACC
TTTGTCAAGCAGCTATCGCGTAGAGAACGGTGCATCGTGGTCATGACAGGTCCTACGGATTACATATCCGACGGG
AAGACTGTTGTGTCTTTGCGGAATGGCCATGACATTTTGGGCAAGATTACTGGTTCCGGTTGTATTGCTGGCAGC
TCCATAGCATCTTATTGTGCTGCAGCCTCTGCCACGGCTTCGGAGGATGGGTATCAGTCGAACACAGAGGGCAGT
CTCGTGAAGGGAGACATGCTTTTGGGTGCTATTGCTGGTGTTCTAGTTTTAACCATTGCTGCGGAAATTGCAGTC
GAGCTAGATTACGTCCGGGGTCCTGGGACCTTTTTGAGTGGACTGATCGATGCCTTATGGACACTGACTGCAGAT
GACGTTGTCAGGAGGGCGAAAATTACAGTGGAAACCTCTTGA
Transcript >AgabiH97|040430
ATGGCGAACATTAACTACTCCATCTATCTAGTGACAGGAAGGGAGCTACTTCCTCCAGGAAAGGACTATTTGGAA
TCTTTGGAAGAAGCGCTCCAAGGCGGGGTTACCGTTGTTCAGATTCGCGAAAAAAACACTGAAACGGAGGAGTTC
ATCCAAATTGCCAAAGCCTCAAAGGCATTATGTGACCGATACAATGTGCCCATTCTGGTTAACGATAGGGTTGAC
GTTGCCCTTGCAATCAACGCCCATGGAGTACACCTTGGACAAACGGACATGACGGTCGCTCAAGCAAAGATTTTG
TTGCCGAAGGGCAGTATAATTGGAGTGAGCTGCAACAATATTGAGCATGTCAAGGAGGCGATAAAAGACGGCGCA
AATTATATTGGCATCGGTCCTGTCTGGGATACAAAAACGAAAGCTTTGACGAACCCTATCATTGGCGTGCGAGGA
GTAGGTCAAATGCTTGAAGCATTGGATGGAACAAACGTCAAAGCAGTAGCTATTGGTGGCATCAAGAGCAGCAAT
TTGCTTAGAACTCTATATGGAAGTGTCTCTTCCACAAGGCACGCTCTTGATGGTGTTGCGGTCGTCTCTGAGATC
ATAGCATCCCGGAATCCGAAAGAAGCAGCCTCAAGGTTGGCAGGTATAATCCAAGCCTTCAGAGCCGAGTTTGCG
ATTGTCCAAGGGTGGACATTTGAGTCAAAATTATATGGGCAGAATGATGCCCCACCTACCACCGATGAGATTCTC
GATCGTGTTGTTAAGCTAATGGCGAAGATTAAAGAACTTGGGCCTCTGGTACACCAGATCACCAACAACGTTGTT
GCCACTCAATCCGCTAATATCACCCTCGCGCTGGGAGCAAGTCCCATCATGGCCACCGCACCGGAAGAAATGGAA
GATCTTGAACGTATTGTTGGAGCTCTTCTTGTCAATATCGGCACCTTGACAGCTGCAACGTTGGAAGGCATGCGC
AAAGCAGGCTTCCATGCAAATTCCTTCAGGAAACCTTTAATTTTTGATCCCGTTGGCTTCGGTGCGAGTCAGTTT
AGAAAGGGGTCTGCCAATGAACTCTTGAATATCTATCAAGCAAGTGTAATCAAAGGAAACGCGGGAGAACTTGCT
GCTCTGGCCGGTTCTGGCGAGGTCGAATCTAAAGGTGTTGATAGTATTGGAACCGGTTTCAAAGACCCAGTCACC
TTTGTCAAGCAGCTATCGCGTAGAGAACGGTGCATCGTGGTCATGACAGGTCCTACGGATTACATATCCGACGGG
AAGACTGTTGTGTCTTTGCGGAATGGCCATGACATTTTGGGCAAGATTACTGGTTCCGGTTGTATTGCTGGCAGC
TCCATAGCATCTTATTGTGCTGCAGCCTCTGCCACGGCTTCGGAGGATGGGTATCAGTCGAACACAGAGGGCAGT
CTCGTGAAGGGAGACATGCTTTTGGGTGCTATTGCTGGTGTTCTAGTTTTAACCATTGCTGCGGAAATTGCAGTC
GAGCTAGATTACGTCCGGGGTCCTGGGACCTTTTTGAGTGGACTGATCGATGCCTTATGGACACTGACTGCAGAT
GACGTTGTCAGGAGGGCGAAAATTACAGTGGAAACCTCTTGA
Gene >AgabiH97|040430
ATGGCGAACATTAACTACTCCATCTATCTAGTGACAGGAAGGGAGCTACTTCCTCCAGGAAAGGTGACTTCCCTC
TAGTTACCAGAAAATGGAATTGCTGATCCGCCAATAGGACTATTTGGAATCTTTGGAAGAAGTACGCGATCGACC
TTTGTCCTGAAGTAGTCACATCAATTCCCGTAGGCGCTCCAAGGCGGGGTTACCGTTGTTCAGATTCGCGAAAAA
AACACTGAAACGGAGGAGGTAGAAAATTTCTCTCCCTCCCATGCCCCAGAGATCTGACCATTCGTAGTTCATCCA
AATTGCCAAAGCCTCAAAGGCATTATGTGACCGATACAATGTGCCCATTCTGGTTAACGATAGGGTTGACGTTGC
CCTTGCAATCAACGCCCATGGAGTACACCTTGGACAAACGGACATGACGGTCGCTCAAGCAAAGATTTTGTTGCC
GAAGGGCAGTATAATTGGAGTGAGCTGCAACAATATTGAGCATGTCAAGGAGGCGATAAAAGACGGCGCAAATTA
TATTGGCATCGGTCCTGTCTGGGATACAAAAACGAAAGCTTTGACGAACCCTATCATTGGCGTGCGAGGAGTAGG
TCAAATGCTTGAAGCATTGGATGGAACAAACGTCAAAGCAGTAGCTATTGGTACGGTCCAACTCTATCTTTCACA
CGAATGGACAGCTTAGCGTCGCTTAGGTGGCATCAAGAGCAGCAATTTGCTTAGAACTCTATATGGAAGTGTCTC
TTCCACAAGGCACGCTCTTGATGGTGTTGCGGTCGTCTCTGAGATCATAGCATCCCGGAATCCGAAAGAAGCAGC
CTCAAGGTTGGCAGGTATAATCCAAGCCTTCAGAGCCGAGTTTGCGATTGTCCAAGGGTGGACATTTGAGTCAAA
ATTATATGGGCAGAATGATGCCCCACCTACCACCGATGAGATTCTCGATCGTGTTGTTAAGCTAATGGCGAAGAT
TAAAGAACTTGGGCCTCTGGTACACCAGGTGTGGATGCAGCCACTAGTTGACATCAAGTGCTCAGATATCTCTTG
GTCAGATCACCAACAACGTTGTTGCCACTCAATCCGCTAATATCACCCTCGCGCTGGGAGCAAGTCCCATCATGG
CCACCGCACCGGAAGAAATGGAAGATCTTGAACGTATTGTTGGAGCTCTTCTTGTCAATATCGGCACCTTGACAG
CTGCAACGTTGGAAGGCATGCGCAAAGCAGGTTTGTCACAGTCATCTGTCTTTTGTTCTCCGTCATTCATTGGGG
ATCCACCTTCGTTCGCGTGTAGGCTTCCATGCAAATTCCTTCAGGAAACCTTTAATTTTTGATCCCGTTGGCTTC
GGTGCGAGTCAGTTTAGAAAGGGGTCTGCCAATGGTGAGGCTTATATTCTCTTGACGAAAGGTTTTATTCACTTA
AATTTCGTTGGGCTGCAGAACTCTTGAATATCTATCAAGCAAGTGTAATCAAAGGAAACGCGGGAGAACTTGCTG
CTCTGGCCGGTTCTGGCGAGGTCAGATTTCCAGACTGAAGGTCCTGCAACTTAACCCCGACGATTTACTCCAGGT
CGAATCTAAAGGTGTTGATAGTATTGGAACCGGTTTCAAAGACCCAGTCACCTTTGTCAAGCAGCTATCGCGTAG
AGAACGTACGTCAATCAGCCCTTCTACGCTAAAATATGCCAAACTTAGAGGCTCCAGGGTGCATCGTGGTCATGA
CAGGTCCTACGGATTACATATCCGACGGGAAGACTGTTGTGTCTTTGCGGAATGGCCATGACATTTTGGGCAAGA
TTACTGGTTCCGGTTGTATTGCTGGCAGCTCCATAGCATCTTATTGTGCTGCAGCCTCTGCCACGGCTTCGGAGG
ATGGGTATCAGTCGAACACAGAGGGCAGTCTCGTGAAGGGAGACATGCTTTTGGGTGCTATTGCTGGGTCAGTCA
TGCCGCATTTCTAGATTTATAAAGTATGCTGAATCGTCGGACGCAGTGTTCTAGTTTTAACCATTGCTGCGGAAA
TTGCAGTCGAGCTAGATTACGTCCGGGGTCCTGGGACCTTTTTGAGTGGACTGATCGATGCCTTATGGACACTGA
CTGCAGATGACGTTGTCAGGAGGGCGAAAATTACAGTGGAAACCTCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail