Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|040370
Gene name
Locationscaffold_2:492901..495249
Strand+
Gene length (bp)2348
Transcript length (bp)2190
Coding sequence length (bp)2190
Protein length (aa) 730

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03372 Exo_endo_phos Endonuclease/Exonuclease/phosphatase family 1.1E-20 374 707
PF12799 LRR_4 Leucine Rich repeats (2 copies) 1.5E-06 236 273
PF13855 LRR_8 Leucine rich repeat 7.0E-10 236 292

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4P9T3|CCR4_USTMA Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CCR4 PE=3 SV=1 111 718 0.0E+00
sp|O74874|CCR4_SCHPO Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ccr4 PE=3 SV=1 83 726 2.0E-178
sp|P0CP22|CCR4_CRYNJ Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CCR4 PE=3 SV=1 99 724 2.0E-177
sp|P0CP23|CCR4_CRYNB Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CCR4 PE=3 SV=1 99 724 5.0E-177
sp|A1CW67|CCR4_NEOFI Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ccr4 PE=3 SV=1 110 720 1.0E-173
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4P9T3|CCR4_USTMA Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CCR4 PE=3 SV=1 111 718 0.0E+00
sp|O74874|CCR4_SCHPO Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ccr4 PE=3 SV=1 83 726 2.0E-178
sp|P0CP22|CCR4_CRYNJ Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CCR4 PE=3 SV=1 99 724 2.0E-177
sp|P0CP23|CCR4_CRYNB Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CCR4 PE=3 SV=1 99 724 5.0E-177
sp|A1CW67|CCR4_NEOFI Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ccr4 PE=3 SV=1 110 720 1.0E-173
sp|Q0CT27|CCR4_ASPTN Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=ccr4 PE=3 SV=1 110 720 5.0E-172
sp|Q4WQG5|CCR4_ASPFU Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ccr4 PE=3 SV=1 110 720 4.0E-170
sp|A1CIJ6|CCR4_ASPCL Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccr4 PE=3 SV=1 110 720 7.0E-168
sp|Q1EA11|CCR4_COCIM Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Coccidioides immitis (strain RS) GN=CCR4 PE=3 SV=2 110 722 1.0E-166
sp|Q5B778|CCR4_EMENI Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ccr4 PE=3 SV=1 110 723 9.0E-166
sp|Q2UUI3|CCR4_ASPOR Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=ccr4 PE=3 SV=1 110 714 4.0E-165
sp|A2Q9L0|CCR4_ASPNC Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=ccr4 PE=3 SV=1 69 723 2.0E-164
sp|Q0U7W4|CCR4_PHANO Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=CCR4 PE=3 SV=2 214 722 1.0E-159
sp|Q6CEJ6|CCR4_YARLI Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CCR4 PE=3 SV=1 98 720 2.0E-150
sp|Q9C2R2|CCR4_NEUCR Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ccr4 PE=3 SV=2 58 722 1.0E-146
sp|Q5A761|CCR4_CANAL Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CCR4 PE=3 SV=1 111 720 2.0E-128
sp|Q6BMM5|CCR4_DEBHA Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=CCR4 PE=3 SV=2 111 717 3.0E-128
sp|Q75BI3|CCR4_ASHGO Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CCR4 PE=3 SV=1 201 715 3.0E-122
sp|Q6CJU4|CCR4_KLULA Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CCR4 PE=3 SV=1 211 716 2.0E-117
sp|P31384|CCR4_YEAST Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CCR4 PE=1 SV=2 211 715 5.0E-115
sp|Q6FRT2|CCR4_CANGA Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CCR4 PE=3 SV=1 211 708 9.0E-114
sp|Q8VEG6|CNO6L_MOUSE CCR4-NOT transcription complex subunit 6-like OS=Mus musculus GN=Cnot6l PE=1 SV=2 208 713 3.0E-111
sp|A2BHJ4|CNO6L_DANRE CCR4-NOT transcription complex subunit 6-like OS=Danio rerio GN=cnot6l PE=2 SV=1 208 715 5.0E-109
sp|Q9ULM6|CNOT6_HUMAN CCR4-NOT transcription complex subunit 6 OS=Homo sapiens GN=CNOT6 PE=1 SV=2 208 719 6.0E-106
sp|Q96LI5|CNO6L_HUMAN CCR4-NOT transcription complex subunit 6-like OS=Homo sapiens GN=CNOT6L PE=1 SV=2 208 713 3.0E-104
sp|Q5BJ41|CNOT6_XENLA CCR4-NOT transcription complex subunit 6 OS=Xenopus laevis GN=cnot6 PE=1 SV=1 208 719 9.0E-103
sp|Q6AXU9|CNOT6_RAT CCR4-NOT transcription complex subunit 6 OS=Rattus norvegicus GN=Cnot6 PE=2 SV=1 208 719 1.0E-101
sp|Q8K3P5|CNOT6_MOUSE CCR4-NOT transcription complex subunit 6 OS=Mus musculus GN=Cnot6 PE=1 SV=2 208 719 1.0E-101
sp|Q5XH73|CN6LB_XENLA CCR4-NOT transcription complex subunit 6-like-B OS=Xenopus laevis GN=cnot6l-b PE=2 SV=1 208 719 6.0E-99
sp|Q6IR85|CN6LA_XENLA CCR4-NOT transcription complex subunit 6-like-A OS=Xenopus laevis GN=cnot6l-a PE=2 SV=1 208 719 2.0E-97
sp|C4V7I7|CCR4_NOSCE Probable glucose-repressible alcohol dehydrogenase transcriptional effector homolog OS=Nosema ceranae (strain BRL01) GN=CCR4 PE=3 SV=1 210 717 1.0E-82
sp|Q8SU52|CCR4_ENCCU Probable glucose-repressible alcohol dehydrogenase transcriptional effector homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=CCR4 PE=3 SV=1 211 714 6.0E-77
sp|B7XK66|CCR4_ENTBH Probable glucose-repressible alcohol dehydrogenase transcriptional effector homolog OS=Enterocytozoon bieneusi (strain H348) GN=CCR4 PE=3 SV=1 214 720 4.0E-67
sp|Q8W0Z9|CCR4A_ARATH Carbon catabolite repressor protein 4 homolog 1 OS=Arabidopsis thaliana GN=CCR4-1 PE=2 SV=1 340 716 2.0E-41
sp|Q9M2F8|CCR4B_ARATH Carbon catabolite repressor protein 4 homolog 2 OS=Arabidopsis thaliana GN=CCR4-2 PE=2 SV=2 294 716 5.0E-38
sp|Q08DF7|PDE12_BOVIN 2',5'-phosphodiesterase 12 OS=Bos taurus GN=PDE12 PE=1 SV=1 371 717 1.0E-28
sp|Q9ET55|NOCT_RAT Nocturnin OS=Rattus norvegicus GN=Noct PE=2 SV=2 371 722 2.0E-28
sp|Q6L8Q7|PDE12_HUMAN 2',5'-phosphodiesterase 12 OS=Homo sapiens GN=PDE12 PE=1 SV=2 371 717 1.0E-27
sp|Q9LS39|CCR4C_ARATH Carbon catabolite repressor protein 4 homolog 3 OS=Arabidopsis thaliana GN=CCR4-3 PE=2 SV=2 355 714 1.0E-27
sp|Q9UK39|NOCT_HUMAN Nocturnin OS=Homo sapiens GN=NOCT PE=2 SV=2 371 721 2.0E-27
sp|O35710|NOCT_MOUSE Nocturnin OS=Mus musculus GN=Noct PE=1 SV=3 371 714 2.0E-27
sp|Q3TIU4|PDE12_MOUSE 2',5'-phosphodiesterase 12 OS=Mus musculus GN=Pde12 PE=1 SV=2 371 717 2.0E-27
sp|Q6AXQ5|PDE12_RAT 2',5'-phosphodiesterase 12 OS=Rattus norvegicus GN=Pde12 PE=2 SV=1 371 717 5.0E-27
sp|A8MS41|CCR4D_ARATH Carbon catabolite repressor protein 4 homolog 4 OS=Arabidopsis thaliana GN=CCR4-4 PE=1 SV=1 373 718 2.0E-25
sp|Q0WKY2|CCR4E_ARATH Carbon catabolite repressor protein 4 homolog 5 OS=Arabidopsis thaliana GN=CCR4-5 PE=2 SV=2 355 714 1.0E-23
sp|P79942|NOCT_XENLA Nocturnin OS=Xenopus laevis GN=noct PE=1 SV=1 373 714 2.0E-23
sp|Q8VYU4|CCR4F_ARATH Carbon catabolite repressor protein 4 homolog 6 OS=Arabidopsis thaliana GN=CCR4-6 PE=2 SV=2 366 618 5.0E-21
sp|Q08213|NGL1_YEAST RNA exonuclease NGL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NGL1 PE=1 SV=1 371 716 9.0E-21
sp|Q8K1C0|ANGE2_MOUSE Protein angel homolog 2 OS=Mus musculus GN=Angel2 PE=1 SV=1 347 618 2.0E-20
sp|A6H7I3|ANGE2_BOVIN Protein angel homolog 2 OS=Bos taurus GN=ANGEL2 PE=2 SV=1 347 618 5.0E-20
sp|Q5VTE6|ANGE2_HUMAN Protein angel homolog 2 OS=Homo sapiens GN=ANGEL2 PE=2 SV=1 347 618 7.0E-20
sp|Q5RGT6|ANGE2_DANRE Protein angel homolog 2 OS=Danio rerio GN=angel2 PE=2 SV=1 370 720 8.0E-20
sp|B2RYM0|ANGE1_RAT Protein angel homolog 1 OS=Rattus norvegicus GN=Angel1 PE=1 SV=2 348 618 1.0E-19
sp|Q8VCU0|ANGE1_MOUSE Protein angel homolog 1 OS=Mus musculus GN=Angel1 PE=1 SV=2 348 618 1.0E-19
sp|Q9UNK9|ANGE1_HUMAN Protein angel homolog 1 OS=Homo sapiens GN=ANGEL1 PE=2 SV=1 348 618 1.0E-19
sp|Q24239|ANGEL_DROME Protein angel OS=Drosophila melanogaster GN=angel PE=1 SV=2 348 613 2.0E-17
sp|Q15404|RSU1_HUMAN Ras suppressor protein 1 OS=Homo sapiens GN=RSU1 PE=1 SV=3 199 314 2.0E-14
sp|Q5E9C0|RSU1_BOVIN Ras suppressor protein 1 OS=Bos taurus GN=RSU1 PE=2 SV=1 199 314 2.0E-14
sp|Q01730|RSU1_MOUSE Ras suppressor protein 1 OS=Mus musculus GN=Rsu1 PE=1 SV=3 229 353 2.0E-14
sp|Q8N9N7|LRC57_HUMAN Leucine-rich repeat-containing protein 57 OS=Homo sapiens GN=LRRC57 PE=1 SV=1 197 315 6.0E-14
sp|Q5FVI3|LRC57_RAT Leucine-rich repeat-containing protein 57 OS=Rattus norvegicus GN=Lrrc57 PE=2 SV=1 197 315 2.0E-13
sp|Q24K06|LRC10_BOVIN Leucine-rich repeat-containing protein 10 OS=Bos taurus GN=LRRC10 PE=2 SV=1 214 315 7.0E-13
sp|Q9D1G5|LRC57_MOUSE Leucine-rich repeat-containing protein 57 OS=Mus musculus GN=Lrrc57 PE=1 SV=1 197 315 8.0E-13
sp|Q80U72|SCRIB_MOUSE Protein scribble homolog OS=Mus musculus GN=Scrib PE=1 SV=2 214 316 9.0E-13
sp|Q5E9C0|RSU1_BOVIN Ras suppressor protein 1 OS=Bos taurus GN=RSU1 PE=2 SV=1 208 316 1.0E-12
sp|Q14160|SCRIB_HUMAN Protein scribble homolog OS=Homo sapiens GN=SCRIB PE=1 SV=4 214 316 1.0E-12
sp|Q8K3W2|LRC10_MOUSE Leucine-rich repeat-containing protein 10 OS=Mus musculus GN=Lrrc10 PE=1 SV=1 214 315 2.0E-12
sp|Q5BKY1|LRC10_HUMAN Leucine-rich repeat-containing protein 10 OS=Homo sapiens GN=LRRC10 PE=2 SV=1 214 315 2.0E-12
sp|Q15404|RSU1_HUMAN Ras suppressor protein 1 OS=Homo sapiens GN=RSU1 PE=1 SV=3 208 315 3.0E-12
sp|Q80VQ1|LRRC1_MOUSE Leucine-rich repeat-containing protein 1 OS=Mus musculus GN=Lrrc1 PE=1 SV=2 194 316 9.0E-12
sp|Q6UWE0|LRSM1_HUMAN E3 ubiquitin-protein ligase LRSAM1 OS=Homo sapiens GN=LRSAM1 PE=1 SV=1 224 315 1.0E-11
sp|Q9BTT6|LRRC1_HUMAN Leucine-rich repeat-containing protein 1 OS=Homo sapiens GN=LRRC1 PE=1 SV=1 194 316 1.0E-11
sp|Q96CX6|LRC58_HUMAN Leucine-rich repeat-containing protein 58 OS=Homo sapiens GN=LRRC58 PE=1 SV=2 196 337 1.0E-11
sp|Q3UGP9|LRC58_MOUSE Leucine-rich repeat-containing protein 58 OS=Mus musculus GN=Lrrc58 PE=2 SV=1 199 337 1.0E-11
sp|Q01730|RSU1_MOUSE Ras suppressor protein 1 OS=Mus musculus GN=Rsu1 PE=1 SV=3 208 316 2.0E-11
sp|Q6NSJ5|LRC8E_HUMAN Volume-regulated anion channel subunit LRRC8E OS=Homo sapiens GN=LRRC8E PE=1 SV=2 130 317 2.0E-11
sp|Q32NT4|LRC58_XENLA Leucine-rich repeat-containing protein 58 OS=Xenopus laevis GN=lrrc58 PE=2 SV=1 213 315 2.0E-11
sp|Q6INV3|LRC57_XENLA Leucine-rich repeat-containing protein 57 OS=Xenopus laevis GN=lrrc57 PE=2 SV=1 197 317 2.0E-11
sp|Q9BTT6|LRRC1_HUMAN Leucine-rich repeat-containing protein 1 OS=Homo sapiens GN=LRRC1 PE=1 SV=1 214 315 4.0E-11
sp|Q4H4B6|SCRIB_DANRE Protein scribble homolog OS=Danio rerio GN=scrib PE=1 SV=1 214 315 4.0E-11
sp|Q8VDB8|LRRC2_MOUSE Leucine-rich repeat-containing protein 2 OS=Mus musculus GN=Lrrc2 PE=2 SV=1 214 313 7.0E-11
sp|Q6Z8P4|PIRL4_ORYSJ Plant intracellular Ras-group-related LRR protein 4 OS=Oryza sativa subsp. japonica GN=IRL4 PE=2 SV=1 212 316 8.0E-11
sp|Q6DHL5|LRC57_DANRE Leucine-rich repeat-containing protein 57 OS=Danio rerio GN=lrrc57 PE=2 SV=1 197 315 1.0E-10
sp|Q6NSJ5|LRC8E_HUMAN Volume-regulated anion channel subunit LRRC8E OS=Homo sapiens GN=LRRC8E PE=1 SV=2 220 317 2.0E-10
sp|Q1ZXD6|ROCO5_DICDI Probable serine/threonine-protein kinase roco5 OS=Dictyostelium discoideum GN=roco5 PE=3 SV=1 236 317 2.0E-10
sp|O61967|LAP1_CAEEL Protein lap1 OS=Caenorhabditis elegans GN=let-413 PE=1 SV=3 192 315 2.0E-10
sp|Q6K7R2|PIRL6_ORYSJ Plant intracellular Ras-group-related LRR protein 6 OS=Oryza sativa subsp. japonica GN=IRL6 PE=2 SV=1 214 340 3.0E-10
sp|Q8BGR2|LRC8D_MOUSE Volume-regulated anion channel subunit LRRC8D OS=Mus musculus GN=Lrrc8d PE=1 SV=1 209 324 5.0E-10
sp|Q7KRY7|LAP4_DROME Protein lap4 OS=Drosophila melanogaster GN=scrib PE=1 SV=1 210 316 7.0E-10
sp|Q7XDQ7|PIRL8_ORYSJ Plant intracellular Ras-group-related LRR protein 8 OS=Oryza sativa subsp. japonica GN=IRL8 PE=2 SV=1 212 315 1.0E-09
sp|B9F655|PIRL7_ORYSJ Plant intracellular Ras-group-related LRR protein 7 OS=Oryza sativa subsp. japonica GN=IRL7 PE=2 SV=1 209 317 1.0E-09
sp|Q3TX51|LRC28_MOUSE Leucine-rich repeat-containing protein 28 OS=Mus musculus GN=Lrrc28 PE=2 SV=1 236 317 1.0E-09
sp|B0M0P8|GEFL_DICDI Ras guanine nucleotide exchange factor L OS=Dictyostelium discoideum GN=gefL PE=2 SV=1 212 317 2.0E-09
sp|Q8IWT6|LRC8A_HUMAN Volume-regulated anion channel subunit LRRC8A OS=Homo sapiens GN=LRRC8A PE=1 SV=1 212 317 2.0E-09
sp|Q5U308|LRC8D_RAT Volume-regulated anion channel subunit LRRC8D OS=Rattus norvegicus GN=Lrrc8d PE=2 SV=1 209 324 2.0E-09
sp|Q7L1W4|LRC8D_HUMAN Volume-regulated anion channel subunit LRRC8D OS=Homo sapiens GN=LRRC8D PE=1 SV=1 209 324 3.0E-09
sp|Q5RJR8|LRC59_RAT Leucine-rich repeat-containing protein 59 OS=Rattus norvegicus GN=Lrrc59 PE=1 SV=1 213 319 3.0E-09
sp|Q922Q8|LRC59_MOUSE Leucine-rich repeat-containing protein 59 OS=Mus musculus GN=Lrrc59 PE=1 SV=1 213 319 3.0E-09
sp|A4IHG1|LRC58_XENTR Leucine-rich repeat-containing protein 58 OS=Xenopus tropicalis GN=lrrc58 PE=2 SV=1 215 342 4.0E-09
sp|P0C895|Y2010_ARATH LRR repeats and ubiquitin-like domain-containing protein At2g30105 OS=Arabidopsis thaliana GN=At2g30105 PE=1 SV=1 229 315 5.0E-09
sp|Q8N9N7|LRC57_HUMAN Leucine-rich repeat-containing protein 57 OS=Homo sapiens GN=LRRC57 PE=1 SV=1 195 319 6.0E-09
sp|Q4V8I7|LRC8A_RAT Volume-regulated anion channel subunit LRRC8A OS=Rattus norvegicus GN=Lrrc8a PE=1 SV=1 212 317 6.0E-09
sp|Q80WG5|LRC8A_MOUSE Volume-regulated anion channel subunit LRRC8A OS=Mus musculus GN=Lrrc8a PE=1 SV=1 212 317 6.0E-09
sp|A8JAM0|DRC7_CHLRE Dynein regulatory complex subunit 7 (Fragment) OS=Chlamydomonas reinhardtii GN=DRC7 PE=1 SV=1 212 322 7.0E-09
sp|Q54AX5|LRRA_DICDI Leucine-rich repeat protein lrrA OS=Dictyostelium discoideum GN=lrrA PE=1 SV=1 214 316 7.0E-09
sp|Q6GLE8|LRC28_XENTR Leucine-rich repeat-containing protein 28 OS=Xenopus tropicalis GN=lrrc28 PE=2 SV=1 196 324 7.0E-09
sp|P70587|LRRC7_RAT Leucine-rich repeat-containing protein 7 OS=Rattus norvegicus GN=Lrrc7 PE=1 SV=2 221 316 7.0E-09
sp|Q80TE7|LRRC7_MOUSE Leucine-rich repeat-containing protein 7 OS=Mus musculus GN=Lrrc7 PE=1 SV=2 221 316 7.0E-09
sp|Q9BTT6|LRRC1_HUMAN Leucine-rich repeat-containing protein 1 OS=Homo sapiens GN=LRRC1 PE=1 SV=1 210 315 8.0E-09
sp|Q5E9X4|LRC59_BOVIN Leucine-rich repeat-containing protein 59 OS=Bos taurus GN=LRRC59 PE=2 SV=1 214 319 8.0E-09
sp|Q9V780|LAP1_DROME Protein lap1 OS=Drosophila melanogaster GN=Lap1 PE=2 SV=1 210 317 8.0E-09
sp|Q66JT1|LRC8E_MOUSE Volume-regulated anion channel subunit LRRC8E OS=Mus musculus GN=Lrrc8e PE=2 SV=2 152 317 8.0E-09
sp|P0C895|Y2010_ARATH LRR repeats and ubiquitin-like domain-containing protein At2g30105 OS=Arabidopsis thaliana GN=At2g30105 PE=1 SV=1 207 315 9.0E-09
sp|Q96AG4|LRC59_HUMAN Leucine-rich repeat-containing protein 59 OS=Homo sapiens GN=LRRC59 PE=1 SV=1 213 319 9.0E-09
sp|Q5M8G4|LRC40_XENTR Leucine-rich repeat-containing protein 40 OS=Xenopus tropicalis GN=lrrc40 PE=2 SV=1 233 342 9.0E-09
sp|Q5FVI3|LRC57_RAT Leucine-rich repeat-containing protein 57 OS=Rattus norvegicus GN=Lrrc57 PE=2 SV=1 195 319 1.0E-08
sp|Q32NT4|LRC58_XENLA Leucine-rich repeat-containing protein 58 OS=Xenopus laevis GN=lrrc58 PE=2 SV=1 215 342 1.0E-08
sp|Q6Z8P4|PIRL4_ORYSJ Plant intracellular Ras-group-related LRR protein 4 OS=Oryza sativa subsp. japonica GN=IRL4 PE=2 SV=1 214 306 1.0E-08
sp|Q66JT1|LRC8E_MOUSE Volume-regulated anion channel subunit LRRC8E OS=Mus musculus GN=Lrrc8e PE=2 SV=2 236 315 1.0E-08
sp|Q68F79|LRC8E_XENTR Volume-regulated anion channel subunit LRRC8E OS=Xenopus tropicalis GN=lrrc8e PE=2 SV=1 148 316 1.0E-08
sp|Q9HB75|PIDD1_HUMAN p53-induced death domain-containing protein 1 OS=Homo sapiens GN=PIDD1 PE=1 SV=2 214 343 1.0E-08
sp|Q3KRC6|LRC8E_RAT Volume-regulated anion channel subunit LRRC8E OS=Rattus norvegicus GN=Lrrc8e PE=2 SV=1 152 317 1.0E-08
sp|Q3UMG5|LRCH2_MOUSE Leucine-rich repeat and calponin homology domain-containing protein 2 OS=Mus musculus GN=Lrch2 PE=2 SV=2 222 315 1.0E-08
sp|Q01513|CYAA_PODAS Adenylate cyclase OS=Podospora anserina PE=3 SV=1 214 315 1.0E-08
sp|Q9D1G5|LRC57_MOUSE Leucine-rich repeat-containing protein 57 OS=Mus musculus GN=Lrrc57 PE=1 SV=1 195 319 2.0E-08
sp|Q80U72|SCRIB_MOUSE Protein scribble homolog OS=Mus musculus GN=Scrib PE=1 SV=2 214 315 2.0E-08
sp|Q4H4B6|SCRIB_DANRE Protein scribble homolog OS=Danio rerio GN=scrib PE=1 SV=1 214 315 2.0E-08
sp|O61967|LAP1_CAEEL Protein lap1 OS=Caenorhabditis elegans GN=let-413 PE=1 SV=3 213 315 2.0E-08
sp|Q3KRC6|LRC8E_RAT Volume-regulated anion channel subunit LRRC8E OS=Rattus norvegicus GN=Lrrc8e PE=2 SV=1 236 315 2.0E-08
sp|Q5VUJ6|LRCH2_HUMAN Leucine-rich repeat and calponin homology domain-containing protein 2 OS=Homo sapiens GN=LRCH2 PE=2 SV=2 222 315 2.0E-08
sp|Q9CRC8|LRC40_MOUSE Leucine-rich repeat-containing protein 40 OS=Mus musculus GN=Lrrc40 PE=1 SV=2 236 336 2.0E-08
sp|Q96RT1|LAP2_HUMAN Protein LAP2 OS=Homo sapiens GN=ERBB2IP PE=1 SV=2 188 316 2.0E-08
sp|Q8MVR1|GBPC_DICDI Cyclic GMP-binding protein C OS=Dictyostelium discoideum GN=gbpC PE=1 SV=1 230 343 2.0E-08
sp|B3LWU3|SUR8_DROAN Leucine-rich repeat protein soc-2 homolog OS=Drosophila ananassae GN=Sur-8 PE=3 SV=1 201 315 2.0E-08
sp|Q6NU09|LRC8E_XENLA Volume-regulated anion channel subunit LRRC8E OS=Xenopus laevis GN=lrrc8e PE=2 SV=1 222 316 2.0E-08
sp|P49606|CYAA_USTMA Adenylate cyclase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UAC1 PE=3 SV=1 210 317 2.0E-08
sp|Q8RWE5|PIRL8_ARATH Plant intracellular Ras-group-related LRR protein 8 OS=Arabidopsis thaliana GN=PIRL8 PE=2 SV=1 197 350 2.0E-08
sp|Q80TH2|LAP2_MOUSE Protein LAP2 OS=Mus musculus GN=Erbb2ip PE=1 SV=3 188 316 2.0E-08
sp|Q54XZ5|Y0138_DICDI Probable serine/threonine-protein kinase DDB_G0278509 OS=Dictyostelium discoideum GN=DDB_G0278509 PE=3 SV=1 211 315 2.0E-08
sp|Q5ZLN0|LRC40_CHICK Leucine-rich repeat-containing protein 40 OS=Gallus gallus GN=LRRC40 PE=2 SV=1 228 336 2.0E-08
sp|Q7SXW3|LRC40_DANRE Leucine-rich repeat-containing protein 40 OS=Danio rerio GN=lrrc40 PE=2 SV=1 236 345 2.0E-08
sp|Q14160|SCRIB_HUMAN Protein scribble homolog OS=Homo sapiens GN=SCRIB PE=1 SV=4 214 315 3.0E-08
sp|A8XWW4|SHOC2_CAEBR Leucine-rich repeat protein soc-2 OS=Caenorhabditis briggsae GN=soc-2 PE=3 SV=1 179 315 3.0E-08
sp|Q9SVW8|PIRL4_ARATH Plant intracellular Ras-group-related LRR protein 4 OS=Arabidopsis thaliana GN=PIRL4 PE=1 SV=1 209 317 3.0E-08
sp|Q01631|CYAA_NEUCR Adenylate cyclase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cr-1 PE=1 SV=2 236 315 3.0E-08
sp|Q5FVI3|LRC57_RAT Leucine-rich repeat-containing protein 57 OS=Rattus norvegicus GN=Lrrc57 PE=2 SV=1 236 317 4.0E-08
sp|Q9D1G5|LRC57_MOUSE Leucine-rich repeat-containing protein 57 OS=Mus musculus GN=Lrrc57 PE=1 SV=1 236 317 4.0E-08
sp|A8JAM0|DRC7_CHLRE Dynein regulatory complex subunit 7 (Fragment) OS=Chlamydomonas reinhardtii GN=DRC7 PE=1 SV=1 213 334 4.0E-08
sp|Q3KQF4|LRC69_XENLA Leucine-rich repeat-containing protein 69 OS=Xenopus laevis GN=lrrc69 PE=2 SV=1 230 313 4.0E-08
sp|Q6NWG1|LRC59_DANRE Leucine-rich repeat-containing protein 59 OS=Danio rerio GN=lrrc59 PE=2 SV=1 214 319 4.0E-08
sp|Q68F79|LRC8E_XENTR Volume-regulated anion channel subunit LRRC8E OS=Xenopus tropicalis GN=lrrc8e PE=2 SV=1 222 317 5.0E-08
sp|B0W6M9|SUR8_CULQU Leucine-rich repeat protein soc-2 homolog OS=Culex quinquefasciatus GN=Sur-8 PE=3 SV=1 211 317 5.0E-08
sp|O75427|LRCH4_HUMAN Leucine-rich repeat and calponin homology domain-containing protein 4 OS=Homo sapiens GN=LRCH4 PE=1 SV=2 236 317 5.0E-08
sp|P08678|CYAA_YEAST Adenylate cyclase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CYR1 PE=1 SV=2 236 315 5.0E-08
sp|Q9JJ28|FLII_MOUSE Protein flightless-1 homolog OS=Mus musculus GN=Flii PE=1 SV=1 220 315 5.0E-08
sp|B4IBI9|SUR8_DROSE Leucine-rich repeat protein soc-2 homolog OS=Drosophila sechellia GN=Sur-8 PE=3 SV=1 201 315 5.0E-08
sp|Q9D9Q0|LRC69_MOUSE Leucine-rich repeat-containing protein 69 OS=Mus musculus GN=Lrrc69 PE=2 SV=1 236 316 5.0E-08
sp|B4QVR7|SUR8_DROSI Leucine-rich repeat protein soc-2 homolog OS=Drosophila simulans GN=Sur-8 PE=3 SV=2 201 315 5.0E-08
sp|A6NM36|LRC30_HUMAN Leucine-rich repeat-containing protein 30 OS=Homo sapiens GN=LRRC30 PE=4 SV=1 239 315 5.0E-08
sp|Q55E58|PATS1_DICDI Probable serine/threonine-protein kinase pats1 OS=Dictyostelium discoideum GN=pats1 PE=3 SV=1 214 317 6.0E-08
sp|B4N9T4|SUR8_DROWI Leucine-rich repeat protein soc-2 homolog OS=Drosophila willistoni GN=Sur-8 PE=3 SV=1 201 315 6.0E-08
sp|B4LXW1|SUR8_DROVI Leucine-rich repeat protein soc-2 homolog OS=Drosophila virilis GN=Sur-8 PE=3 SV=1 201 315 6.0E-08
sp|Q1L8Y7|SHOC2_DANRE Leucine-rich repeat protein SHOC-2 OS=Danio rerio GN=shoc2 PE=2 SV=1 201 315 6.0E-08
sp|Q96NW7|LRRC7_HUMAN Leucine-rich repeat-containing protein 7 OS=Homo sapiens GN=LRRC7 PE=1 SV=1 221 316 6.0E-08
sp|Q9VEK6|SUR8_DROME Leucine-rich repeat protein soc-2 homolog OS=Drosophila melanogaster GN=Sur-8 PE=2 SV=3 201 315 7.0E-08
sp|B4JTV9|SUR8_DROGR Leucine-rich repeat protein soc-2 homolog OS=Drosophila grimshawi GN=Sur-8 PE=3 SV=1 201 315 7.0E-08
sp|A6QLV3|SHOC2_BOVIN Leucine-rich repeat protein SHOC-2 OS=Bos taurus GN=SHOC2 PE=2 SV=1 221 314 7.0E-08
sp|B4PU77|SUR8_DROYA Leucine-rich repeat protein soc-2 homolog OS=Drosophila yakuba GN=Sur-8 PE=3 SV=1 201 315 7.0E-08
sp|F1MCA7|LRRC7_BOVIN Leucine-rich repeat-containing protein 7 OS=Bos taurus GN=LRRC7 PE=3 SV=3 221 316 7.0E-08
sp|B3P3E8|SUR8_DROER Leucine-rich repeat protein soc-2 homolog OS=Drosophila erecta GN=Sur-8 PE=3 SV=1 201 315 7.0E-08
sp|Q6P9F7|LRC8B_HUMAN Volume-regulated anion channel subunit LRRC8B OS=Homo sapiens GN=LRRC8B PE=1 SV=2 209 332 7.0E-08
sp|Q6AYI5|SHOC2_RAT Leucine-rich repeat protein SHOC-2 OS=Rattus norvegicus GN=Shoc2 PE=2 SV=1 221 314 8.0E-08
sp|Q5RAV5|SHOC2_PONAB Leucine-rich repeat protein SHOC-2 OS=Pongo abelii GN=SHOC2 PE=2 SV=2 221 314 8.0E-08
sp|Q9UQ13|SHOC2_HUMAN Leucine-rich repeat protein SHOC-2 OS=Homo sapiens GN=SHOC2 PE=1 SV=2 221 314 8.0E-08
sp|Q5F4C4|SHOC2_CHICK Leucine-rich repeat protein SHOC-2 OS=Gallus gallus GN=SHOC2 PE=2 SV=1 211 315 8.0E-08
sp|Q66JT1|LRC8E_MOUSE Volume-regulated anion channel subunit LRRC8E OS=Mus musculus GN=Lrrc8e PE=2 SV=2 236 316 9.0E-08
sp|Q6NU09|LRC8E_XENLA Volume-regulated anion channel subunit LRRC8E OS=Xenopus laevis GN=lrrc8e PE=2 SV=1 148 316 9.0E-08
sp|A6QLV3|SHOC2_BOVIN Leucine-rich repeat protein SHOC-2 OS=Bos taurus GN=SHOC2 PE=2 SV=1 201 315 9.0E-08
sp|Q8VYG9|PIRL9_ARATH Plant intracellular Ras-group-related LRR protein 9 OS=Arabidopsis thaliana GN=PIRL9 PE=2 SV=1 214 315 9.0E-08
sp|Q8AVS8|LRC59_XENLA Leucine-rich repeat-containing protein 59 OS=Xenopus laevis GN=lrrc59 PE=2 SV=1 214 315 9.0E-08
sp|Q3V1N1|MFHA1_MOUSE Malignant fibrous histiocytoma-amplified sequence 1 homolog OS=Mus musculus GN=Mfhas1 PE=2 SV=2 203 332 9.0E-08
sp|P23466|CYAA_LACKL Adenylate cyclase OS=Lachancea kluyveri GN=CYR1 PE=3 SV=1 200 322 9.0E-08
sp|Q6GPJ5|LRC40_XENLA Leucine-rich repeat-containing protein 40 OS=Xenopus laevis GN=lrrc40 PE=2 SV=1 233 344 9.0E-08
sp|Q8N9N7|LRC57_HUMAN Leucine-rich repeat-containing protein 57 OS=Homo sapiens GN=LRRC57 PE=1 SV=1 236 317 1.0E-07
sp|Q6Z8P4|PIRL4_ORYSJ Plant intracellular Ras-group-related LRR protein 4 OS=Oryza sativa subsp. japonica GN=IRL4 PE=2 SV=1 221 361 1.0E-07
sp|O61967|LAP1_CAEEL Protein lap1 OS=Caenorhabditis elegans GN=let-413 PE=1 SV=3 214 315 1.0E-07
sp|Q9HB75|PIDD1_HUMAN p53-induced death domain-containing protein 1 OS=Homo sapiens GN=PIDD1 PE=1 SV=2 221 316 1.0E-07
sp|Q9D9Q0|LRC69_MOUSE Leucine-rich repeat-containing protein 69 OS=Mus musculus GN=Lrrc69 PE=2 SV=1 214 313 1.0E-07
sp|A6NM36|LRC30_HUMAN Leucine-rich repeat-containing protein 30 OS=Homo sapiens GN=LRRC30 PE=4 SV=1 190 322 1.0E-07
sp|F1MCA7|LRRC7_BOVIN Leucine-rich repeat-containing protein 7 OS=Bos taurus GN=LRRC7 PE=3 SV=3 210 335 1.0E-07
sp|Q6AYI5|SHOC2_RAT Leucine-rich repeat protein SHOC-2 OS=Rattus norvegicus GN=Shoc2 PE=2 SV=1 201 315 1.0E-07
sp|Q5RAV5|SHOC2_PONAB Leucine-rich repeat protein SHOC-2 OS=Pongo abelii GN=SHOC2 PE=2 SV=2 201 315 1.0E-07
sp|Q9UQ13|SHOC2_HUMAN Leucine-rich repeat protein SHOC-2 OS=Homo sapiens GN=SHOC2 PE=1 SV=2 201 315 1.0E-07
sp|Q8S7M7|PIRL5_ORYSJ Plant intracellular Ras-group-related LRR protein 5 OS=Oryza sativa subsp. japonica GN=IRL5 PE=2 SV=1 212 316 1.0E-07
sp|Q921G6|LRCH4_MOUSE Leucine-rich repeat and calponin homology domain-containing protein 4 OS=Mus musculus GN=Lrch4 PE=1 SV=1 236 317 1.0E-07
sp|Q8AVI4|SHOC2_XENLA Leucine-rich repeat protein SHOC-2 OS=Xenopus laevis GN=shoc2 PE=2 SV=1 211 315 1.0E-07
sp|Q8AVI4|SHOC2_XENLA Leucine-rich repeat protein SHOC-2 OS=Xenopus laevis GN=shoc2 PE=2 SV=1 221 314 1.0E-07
sp|B5DX45|SUR8_DROPS Leucine-rich repeat protein soc-2 homolog OS=Drosophila pseudoobscura pseudoobscura GN=Sur-8 PE=3 SV=1 201 315 1.0E-07
sp|A7SFP1|SHOC2_NEMVE Leucine-rich repeat protein soc-2 homolog OS=Nematostella vectensis GN=v1g189306 PE=3 SV=1 221 348 1.0E-07
sp|O88520|SHOC2_MOUSE Leucine-rich repeat protein SHOC-2 OS=Mus musculus GN=Shoc2 PE=1 SV=2 201 315 1.0E-07
sp|O88520|SHOC2_MOUSE Leucine-rich repeat protein SHOC-2 OS=Mus musculus GN=Shoc2 PE=1 SV=2 211 315 1.0E-07
sp|Q5DU41|LRC8B_MOUSE Volume-regulated anion channel subunit LRRC8B OS=Mus musculus GN=Lrrc8b PE=1 SV=3 209 341 1.0E-07
sp|Q3UV48|LRC30_MOUSE Leucine-rich repeat-containing protein 30 OS=Mus musculus GN=Lrrc30 PE=2 SV=1 191 322 1.0E-07
sp|Q54TM7|DRKD_DICDI Probable serine/threonine-protein kinase drkD OS=Dictyostelium discoideum GN=drkD PE=2 SV=1 214 340 1.0E-07
sp|Q4R3P6|LRC40_MACFA Leucine-rich repeat-containing protein 40 OS=Macaca fascicularis GN=LRRC40 PE=2 SV=1 232 340 1.0E-07
sp|P62046|LRCH1_MOUSE Leucine-rich repeat and calponin homology domain-containing protein 1 OS=Mus musculus GN=Lrch1 PE=1 SV=2 236 302 1.0E-07
sp|Q96II8|LRCH3_HUMAN Leucine-rich repeat and calponin homology domain-containing protein 3 OS=Homo sapiens GN=LRCH3 PE=1 SV=2 236 317 1.0E-07
sp|Q4H4B6|SCRIB_DANRE Protein scribble homolog OS=Danio rerio GN=scrib PE=1 SV=1 236 315 2.0E-07
sp|Q3TX51|LRC28_MOUSE Leucine-rich repeat-containing protein 28 OS=Mus musculus GN=Lrrc28 PE=2 SV=1 196 324 2.0E-07
sp|B0M0P8|GEFL_DICDI Ras guanine nucleotide exchange factor L OS=Dictyostelium discoideum GN=gefL PE=2 SV=1 236 316 2.0E-07
sp|P70587|LRRC7_RAT Leucine-rich repeat-containing protein 7 OS=Rattus norvegicus GN=Lrrc7 PE=1 SV=2 188 318 2.0E-07
sp|P70587|LRRC7_RAT Leucine-rich repeat-containing protein 7 OS=Rattus norvegicus GN=Lrrc7 PE=1 SV=2 210 317 2.0E-07
sp|Q80TE7|LRRC7_MOUSE Leucine-rich repeat-containing protein 7 OS=Mus musculus GN=Lrrc7 PE=1 SV=2 188 318 2.0E-07
sp|Q80TE7|LRRC7_MOUSE Leucine-rich repeat-containing protein 7 OS=Mus musculus GN=Lrrc7 PE=1 SV=2 210 317 2.0E-07
sp|B3LWU3|SUR8_DROAN Leucine-rich repeat protein soc-2 homolog OS=Drosophila ananassae GN=Sur-8 PE=3 SV=1 210 315 2.0E-07
sp|Q96NW7|LRRC7_HUMAN Leucine-rich repeat-containing protein 7 OS=Homo sapiens GN=LRRC7 PE=1 SV=1 210 335 2.0E-07
sp|A6QLV3|SHOC2_BOVIN Leucine-rich repeat protein SHOC-2 OS=Bos taurus GN=SHOC2 PE=2 SV=1 211 315 2.0E-07
sp|Q6AYI5|SHOC2_RAT Leucine-rich repeat protein SHOC-2 OS=Rattus norvegicus GN=Shoc2 PE=2 SV=1 211 315 2.0E-07
sp|Q5RAV5|SHOC2_PONAB Leucine-rich repeat protein SHOC-2 OS=Pongo abelii GN=SHOC2 PE=2 SV=2 211 315 2.0E-07
sp|Q9UQ13|SHOC2_HUMAN Leucine-rich repeat protein SHOC-2 OS=Homo sapiens GN=SHOC2 PE=1 SV=2 211 315 2.0E-07
sp|Q5F4C4|SHOC2_CHICK Leucine-rich repeat protein SHOC-2 OS=Gallus gallus GN=SHOC2 PE=2 SV=1 201 315 2.0E-07
sp|Q921G6|LRCH4_MOUSE Leucine-rich repeat and calponin homology domain-containing protein 4 OS=Mus musculus GN=Lrch4 PE=1 SV=1 229 315 2.0E-07
sp|A7SFP1|SHOC2_NEMVE Leucine-rich repeat protein soc-2 homolog OS=Nematostella vectensis GN=v1g189306 PE=3 SV=1 221 340 2.0E-07
sp|O88520|SHOC2_MOUSE Leucine-rich repeat protein SHOC-2 OS=Mus musculus GN=Shoc2 PE=1 SV=2 221 314 2.0E-07
sp|Q5RFE9|LRC40_PONAB Leucine-rich repeat-containing protein 40 OS=Pongo abelii GN=LRRC40 PE=2 SV=1 232 340 2.0E-07
sp|Q6ZH85|PIRL2_ORYSJ Plant intracellular Ras-group-related LRR protein 2 OS=Oryza sativa subsp. japonica GN=IRL2 PE=2 SV=1 239 335 2.0E-07
sp|Q9H9A6|LRC40_HUMAN Leucine-rich repeat-containing protein 40 OS=Homo sapiens GN=LRRC40 PE=1 SV=1 232 340 2.0E-07
sp|Q8TDW0|LRC8C_HUMAN Volume-regulated anion channel subunit LRRC8C OS=Homo sapiens GN=LRRC8C PE=1 SV=2 152 317 2.0E-07
sp|A5PK13|LRC8C_BOVIN Volume-regulated anion channel subunit LRRC8C OS=Bos taurus GN=LRRC8C PE=2 SV=1 152 317 2.0E-07
sp|Q9LHP4|RCH2_ARATH Receptor-like protein kinase 2 OS=Arabidopsis thaliana GN=RCH2 PE=1 SV=1 178 313 2.0E-07
sp|Q01730|RSU1_MOUSE Ras suppressor protein 1 OS=Mus musculus GN=Rsu1 PE=1 SV=3 214 315 3.0E-07
sp|Q7KRY7|LAP4_DROME Protein lap4 OS=Drosophila melanogaster GN=scrib PE=1 SV=1 214 315 3.0E-07
sp|Q7L1W4|LRC8D_HUMAN Volume-regulated anion channel subunit LRRC8D OS=Homo sapiens GN=LRRC8D PE=1 SV=1 210 316 3.0E-07
sp|Q96RT1|LAP2_HUMAN Protein LAP2 OS=Homo sapiens GN=ERBB2IP PE=1 SV=2 214 325 3.0E-07
sp|Q80TH2|LAP2_MOUSE Protein LAP2 OS=Mus musculus GN=Erbb2ip PE=1 SV=3 221 317 3.0E-07
sp|A8XWW4|SHOC2_CAEBR Leucine-rich repeat protein soc-2 OS=Caenorhabditis briggsae GN=soc-2 PE=3 SV=1 214 315 3.0E-07
sp|B0W6M9|SUR8_CULQU Leucine-rich repeat protein soc-2 homolog OS=Culex quinquefasciatus GN=Sur-8 PE=3 SV=1 221 347 3.0E-07
sp|B4IBI9|SUR8_DROSE Leucine-rich repeat protein soc-2 homolog OS=Drosophila sechellia GN=Sur-8 PE=3 SV=1 210 315 3.0E-07
sp|B4QVR7|SUR8_DROSI Leucine-rich repeat protein soc-2 homolog OS=Drosophila simulans GN=Sur-8 PE=3 SV=2 210 315 3.0E-07
sp|B4JTV9|SUR8_DROGR Leucine-rich repeat protein soc-2 homolog OS=Drosophila grimshawi GN=Sur-8 PE=3 SV=1 210 315 3.0E-07
sp|Q8AVI4|SHOC2_XENLA Leucine-rich repeat protein SHOC-2 OS=Xenopus laevis GN=shoc2 PE=2 SV=1 201 315 3.0E-07
sp|Q8AVI4|SHOC2_XENLA Leucine-rich repeat protein SHOC-2 OS=Xenopus laevis GN=shoc2 PE=2 SV=1 208 322 3.0E-07
sp|Q22875|SHOC2_CAEEL Leucine-rich repeat protein soc-2 OS=Caenorhabditis elegans GN=soc-2 PE=1 SV=3 179 315 3.0E-07
sp|Q42371|ERECT_ARATH LRR receptor-like serine/threonine-protein kinase ERECTA OS=Arabidopsis thaliana GN=ERECTA PE=1 SV=1 191 325 3.0E-07
sp|Q9BYS8|LRRC2_HUMAN Leucine-rich repeat-containing protein 2 OS=Homo sapiens GN=LRRC2 PE=2 SV=2 214 313 3.0E-07
sp|Q9LP24|Y1571_ARATH Probable leucine-rich repeat receptor-like protein kinase At1g35710 OS=Arabidopsis thaliana GN=At1g35710 PE=2 SV=1 224 342 3.0E-07
sp|Q9FFJ3|PIRL1_ARATH Plant intracellular Ras-group-related LRR protein 1 OS=Arabidopsis thaliana GN=PIRL1 PE=2 SV=1 208 302 3.0E-07
sp|Q8IWT6|LRC8A_HUMAN Volume-regulated anion channel subunit LRRC8A OS=Homo sapiens GN=LRRC8A PE=1 SV=1 210 317 4.0E-07
sp|P70587|LRRC7_RAT Leucine-rich repeat-containing protein 7 OS=Rattus norvegicus GN=Lrrc7 PE=1 SV=2 236 315 4.0E-07
sp|Q80TE7|LRRC7_MOUSE Leucine-rich repeat-containing protein 7 OS=Mus musculus GN=Lrrc7 PE=1 SV=2 236 315 4.0E-07
sp|Q9V780|LAP1_DROME Protein lap1 OS=Drosophila melanogaster GN=Lap1 PE=2 SV=1 224 317 4.0E-07
sp|Q3KRC6|LRC8E_RAT Volume-regulated anion channel subunit LRRC8E OS=Rattus norvegicus GN=Lrrc8e PE=2 SV=1 236 317 4.0E-07
sp|Q96RT1|LAP2_HUMAN Protein LAP2 OS=Homo sapiens GN=ERBB2IP PE=1 SV=2 210 317 4.0E-07
sp|Q80TH2|LAP2_MOUSE Protein LAP2 OS=Mus musculus GN=Erbb2ip PE=1 SV=3 214 313 4.0E-07
sp|B0W6M9|SUR8_CULQU Leucine-rich repeat protein soc-2 homolog OS=Culex quinquefasciatus GN=Sur-8 PE=3 SV=1 211 368 4.0E-07
sp|O75427|LRCH4_HUMAN Leucine-rich repeat and calponin homology domain-containing protein 4 OS=Homo sapiens GN=LRCH4 PE=1 SV=2 230 315 4.0E-07
sp|B4N9T4|SUR8_DROWI Leucine-rich repeat protein soc-2 homolog OS=Drosophila willistoni GN=Sur-8 PE=3 SV=1 210 315 4.0E-07
sp|B4LXW1|SUR8_DROVI Leucine-rich repeat protein soc-2 homolog OS=Drosophila virilis GN=Sur-8 PE=3 SV=1 210 315 4.0E-07
sp|Q1L8Y7|SHOC2_DANRE Leucine-rich repeat protein SHOC-2 OS=Danio rerio GN=shoc2 PE=2 SV=1 211 315 4.0E-07
sp|Q1L8Y7|SHOC2_DANRE Leucine-rich repeat protein SHOC-2 OS=Danio rerio GN=shoc2 PE=2 SV=1 221 314 4.0E-07
sp|Q96NW7|LRRC7_HUMAN Leucine-rich repeat-containing protein 7 OS=Homo sapiens GN=LRRC7 PE=1 SV=1 188 318 4.0E-07
sp|Q9VEK6|SUR8_DROME Leucine-rich repeat protein soc-2 homolog OS=Drosophila melanogaster GN=Sur-8 PE=2 SV=3 210 315 4.0E-07
sp|B4PU77|SUR8_DROYA Leucine-rich repeat protein soc-2 homolog OS=Drosophila yakuba GN=Sur-8 PE=3 SV=1 210 315 4.0E-07
sp|B3P3E8|SUR8_DROER Leucine-rich repeat protein soc-2 homolog OS=Drosophila erecta GN=Sur-8 PE=3 SV=1 210 315 4.0E-07
sp|Q8S7M7|PIRL5_ORYSJ Plant intracellular Ras-group-related LRR protein 5 OS=Oryza sativa subsp. japonica GN=IRL5 PE=2 SV=1 212 317 4.0E-07
sp|Q9LRV8|PIRL2_ARATH Plant intracellular Ras-group-related LRR protein 2 OS=Arabidopsis thaliana GN=PIRL2 PE=2 SV=1 214 315 4.0E-07
sp|Q86X40|LRC28_HUMAN Leucine-rich repeat-containing protein 28 OS=Homo sapiens GN=LRRC28 PE=2 SV=1 236 315 4.0E-07
sp|Q32KX5|LRC28_BOVIN Leucine-rich repeat-containing protein 28 OS=Bos taurus GN=LRRC28 PE=2 SV=1 236 315 4.0E-07
sp|Q6K7R2|PIRL6_ORYSJ Plant intracellular Ras-group-related LRR protein 6 OS=Oryza sativa subsp. japonica GN=IRL6 PE=2 SV=1 211 336 5.0E-07
sp|Q8BGR2|LRC8D_MOUSE Volume-regulated anion channel subunit LRRC8D OS=Mus musculus GN=Lrrc8d PE=1 SV=1 210 316 5.0E-07
sp|Q4V8I7|LRC8A_RAT Volume-regulated anion channel subunit LRRC8A OS=Rattus norvegicus GN=Lrrc8a PE=1 SV=1 210 317 5.0E-07
sp|Q80WG5|LRC8A_MOUSE Volume-regulated anion channel subunit LRRC8A OS=Mus musculus GN=Lrrc8a PE=1 SV=1 210 317 5.0E-07
sp|B4N9T4|SUR8_DROWI Leucine-rich repeat protein soc-2 homolog OS=Drosophila willistoni GN=Sur-8 PE=3 SV=1 221 347 5.0E-07
sp|C0LGV1|RCH1_ARATH LRR receptor-like serine/threonine-protein kinase RCH1 OS=Arabidopsis thaliana GN=RCH1 PE=2 SV=1 155 313 5.0E-07
sp|Q6Z8P4|PIRL4_ORYSJ Plant intracellular Ras-group-related LRR protein 4 OS=Oryza sativa subsp. japonica GN=IRL4 PE=2 SV=1 220 350 6.0E-07
sp|Q9V780|LAP1_DROME Protein lap1 OS=Drosophila melanogaster GN=Lap1 PE=2 SV=1 210 315 6.0E-07
sp|B0W6M9|SUR8_CULQU Leucine-rich repeat protein soc-2 homolog OS=Culex quinquefasciatus GN=Sur-8 PE=3 SV=1 205 318 6.0E-07
sp|B5DX45|SUR8_DROPS Leucine-rich repeat protein soc-2 homolog OS=Drosophila pseudoobscura pseudoobscura GN=Sur-8 PE=3 SV=1 210 315 6.0E-07
sp|Q6ZH85|PIRL2_ORYSJ Plant intracellular Ras-group-related LRR protein 2 OS=Oryza sativa subsp. japonica GN=IRL2 PE=2 SV=1 220 315 6.0E-07
sp|Q8VZG8|Y4885_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g08850 OS=Arabidopsis thaliana GN=At4g08850 PE=2 SV=3 224 332 6.0E-07
sp|Q5U308|LRC8D_RAT Volume-regulated anion channel subunit LRRC8D OS=Rattus norvegicus GN=Lrrc8d PE=2 SV=1 210 316 7.0E-07
sp|Q7SXW3|LRC40_DANRE Leucine-rich repeat-containing protein 40 OS=Danio rerio GN=lrrc40 PE=2 SV=1 228 353 7.0E-07
sp|Q24020|FLII_DROME Protein flightless-1 OS=Drosophila melanogaster GN=fliI PE=2 SV=1 213 316 7.0E-07
sp|Q9Y7M8|YNTB_SCHPO Probable RNA exonuclease C9B6.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC9B6.11c PE=3 SV=1 364 605 7.0E-07
sp|Q4H4B6|SCRIB_DANRE Protein scribble homolog OS=Danio rerio GN=scrib PE=1 SV=1 210 313 8.0E-07
sp|Q9V780|LAP1_DROME Protein lap1 OS=Drosophila melanogaster GN=Lap1 PE=2 SV=1 214 324 8.0E-07
sp|Q4R3P6|LRC40_MACFA Leucine-rich repeat-containing protein 40 OS=Macaca fascicularis GN=LRRC40 PE=2 SV=1 211 340 8.0E-07
sp|Q8TDW0|LRC8C_HUMAN Volume-regulated anion channel subunit LRRC8C OS=Homo sapiens GN=LRRC8C PE=1 SV=2 221 313 8.0E-07
sp|A5PK13|LRC8C_BOVIN Volume-regulated anion channel subunit LRRC8C OS=Bos taurus GN=LRRC8C PE=2 SV=1 221 313 8.0E-07
sp|Q22875|SHOC2_CAEEL Leucine-rich repeat protein soc-2 OS=Caenorhabditis elegans GN=soc-2 PE=1 SV=3 214 315 8.0E-07
sp|Q8BVU0|LRCH3_MOUSE Leucine-rich repeat and calponin homology domain-containing protein 3 OS=Mus musculus GN=Lrch3 PE=1 SV=3 236 317 8.0E-07
sp|Q5ZLN0|LRC40_CHICK Leucine-rich repeat-containing protein 40 OS=Gallus gallus GN=LRRC40 PE=2 SV=1 197 376 9.0E-07
sp|Q14160|SCRIB_HUMAN Protein scribble homolog OS=Homo sapiens GN=SCRIB PE=1 SV=4 236 317 1.0E-06
sp|Q5BKY1|LRC10_HUMAN Leucine-rich repeat-containing protein 10 OS=Homo sapiens GN=LRRC10 PE=2 SV=1 206 315 1.0E-06
sp|B0M0P8|GEFL_DICDI Ras guanine nucleotide exchange factor L OS=Dictyostelium discoideum GN=gefL PE=2 SV=1 214 317 1.0E-06
sp|B0M0P8|GEFL_DICDI Ras guanine nucleotide exchange factor L OS=Dictyostelium discoideum GN=gefL PE=2 SV=1 243 332 1.0E-06
sp|Q01513|CYAA_PODAS Adenylate cyclase OS=Podospora anserina PE=3 SV=1 202 316 1.0E-06
sp|A8XWW4|SHOC2_CAEBR Leucine-rich repeat protein soc-2 OS=Caenorhabditis briggsae GN=soc-2 PE=3 SV=1 230 315 1.0E-06
sp|Q8S7M7|PIRL5_ORYSJ Plant intracellular Ras-group-related LRR protein 5 OS=Oryza sativa subsp. japonica GN=IRL5 PE=2 SV=1 209 308 1.0E-06
sp|Q6ZH85|PIRL2_ORYSJ Plant intracellular Ras-group-related LRR protein 2 OS=Oryza sativa subsp. japonica GN=IRL2 PE=2 SV=1 214 315 1.0E-06
sp|Q22875|SHOC2_CAEEL Leucine-rich repeat protein soc-2 OS=Caenorhabditis elegans GN=soc-2 PE=1 SV=3 196 315 1.0E-06
sp|Q5G5D8|PIRL7_ARATH Plant intracellular Ras-group-related LRR protein 7 OS=Arabidopsis thaliana GN=PIRL7 PE=2 SV=1 182 315 1.0E-06
sp|Q8R502|LRC8C_MOUSE Volume-regulated anion channel subunit LRRC8C OS=Mus musculus GN=Lrrc8c PE=1 SV=1 228 313 1.0E-06
sp|Q8R502|LRC8C_MOUSE Volume-regulated anion channel subunit LRRC8C OS=Mus musculus GN=Lrrc8c PE=1 SV=1 152 317 1.0E-06
sp|O64566|PIRL6_ARATH Plant intracellular Ras-group-related LRR protein 6 OS=Arabidopsis thaliana GN=PIRL6 PE=2 SV=1 233 315 1.0E-06
sp|Q6ZVD8|PHLP2_HUMAN PH domain leucine-rich repeat-containing protein phosphatase 2 OS=Homo sapiens GN=PHLPP2 PE=1 SV=3 230 313 1.0E-06
sp|Q498T9|LRC8C_RAT Volume-regulated anion channel subunit LRRC8C OS=Rattus norvegicus GN=Lrrc8c PE=1 SV=1 228 317 1.0E-06
sp|Q9Y2L9|LRCH1_HUMAN Leucine-rich repeat and calponin homology domain-containing protein 1 OS=Homo sapiens GN=LRCH1 PE=1 SV=3 236 302 1.0E-06
sp|Q9CQ07|LRC18_MOUSE Leucine-rich repeat-containing protein 18 OS=Mus musculus GN=Lrrc18 PE=2 SV=1 210 314 1.0E-06
sp|O94294|SOG2_SCHPO Leucine-rich repeat-containing protein sog2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sog2 PE=1 SV=1 207 313 1.0E-06
sp|Q6XHA5|ROC11_DICDI Probable serine/threonine-protein kinase roco11 OS=Dictyostelium discoideum GN=roco11 PE=3 SV=1 212 296 1.0E-06
sp|F4HX15|LPAI_ARATH Phospholipase A I OS=Arabidopsis thaliana GN=PLA1 PE=2 SV=1 212 316 1.0E-06
sp|Q24K06|LRC10_BOVIN Leucine-rich repeat-containing protein 10 OS=Bos taurus GN=LRRC10 PE=2 SV=1 206 315 2.0E-06
sp|Q80U72|SCRIB_MOUSE Protein scribble homolog OS=Mus musculus GN=Scrib PE=1 SV=2 236 315 2.0E-06
sp|Q80U72|SCRIB_MOUSE Protein scribble homolog OS=Mus musculus GN=Scrib PE=1 SV=2 221 315 2.0E-06
sp|Q8K3W2|LRC10_MOUSE Leucine-rich repeat-containing protein 10 OS=Mus musculus GN=Lrrc10 PE=1 SV=1 210 315 2.0E-06
sp|Q1ZXD6|ROCO5_DICDI Probable serine/threonine-protein kinase roco5 OS=Dictyostelium discoideum GN=roco5 PE=3 SV=1 236 310 2.0E-06
sp|Q7XDQ7|PIRL8_ORYSJ Plant intracellular Ras-group-related LRR protein 8 OS=Oryza sativa subsp. japonica GN=IRL8 PE=2 SV=1 238 315 2.0E-06
sp|Q54AX5|LRRA_DICDI Leucine-rich repeat protein lrrA OS=Dictyostelium discoideum GN=lrrA PE=1 SV=1 232 317 2.0E-06
sp|Q1L8Y7|SHOC2_DANRE Leucine-rich repeat protein SHOC-2 OS=Danio rerio GN=shoc2 PE=2 SV=1 208 326 2.0E-06
sp|Q5RFE9|LRC40_PONAB Leucine-rich repeat-containing protein 40 OS=Pongo abelii GN=LRRC40 PE=2 SV=1 211 340 2.0E-06
sp|Q9H9A6|LRC40_HUMAN Leucine-rich repeat-containing protein 40 OS=Homo sapiens GN=LRRC40 PE=1 SV=1 197 317 2.0E-06
sp|Q498T9|LRC8C_RAT Volume-regulated anion channel subunit LRRC8C OS=Rattus norvegicus GN=Lrrc8c PE=1 SV=1 152 317 2.0E-06
sp|Q9CQ07|LRC18_MOUSE Leucine-rich repeat-containing protein 18 OS=Mus musculus GN=Lrrc18 PE=2 SV=1 214 318 2.0E-06
sp|Q9Y4C4|MFHA1_HUMAN Malignant fibrous histiocytoma-amplified sequence 1 OS=Homo sapiens GN=MFHAS1 PE=1 SV=2 236 324 2.0E-06
sp|Q9Y4C4|MFHA1_HUMAN Malignant fibrous histiocytoma-amplified sequence 1 OS=Homo sapiens GN=MFHAS1 PE=1 SV=2 214 317 2.0E-06
sp|Q80ZI6|LRSM1_MOUSE E3 ubiquitin-protein ligase LRSAM1 OS=Mus musculus GN=Lrsam1 PE=1 SV=1 214 315 2.0E-06
sp|Q1ZXD6|ROCO5_DICDI Probable serine/threonine-protein kinase roco5 OS=Dictyostelium discoideum GN=roco5 PE=3 SV=1 239 315 3.0E-06
sp|B9F655|PIRL7_ORYSJ Plant intracellular Ras-group-related LRR protein 7 OS=Oryza sativa subsp. japonica GN=IRL7 PE=2 SV=1 210 316 3.0E-06
sp|B9F655|PIRL7_ORYSJ Plant intracellular Ras-group-related LRR protein 7 OS=Oryza sativa subsp. japonica GN=IRL7 PE=2 SV=1 230 315 3.0E-06
sp|Q6GLE8|LRC28_XENTR Leucine-rich repeat-containing protein 28 OS=Xenopus tropicalis GN=lrrc28 PE=2 SV=1 239 315 3.0E-06
sp|Q5M8G4|LRC40_XENTR Leucine-rich repeat-containing protein 40 OS=Xenopus tropicalis GN=lrrc40 PE=2 SV=1 210 316 3.0E-06
sp|Q96NW7|LRRC7_HUMAN Leucine-rich repeat-containing protein 7 OS=Homo sapiens GN=LRRC7 PE=1 SV=1 236 315 3.0E-06
sp|A6QLV3|SHOC2_BOVIN Leucine-rich repeat protein SHOC-2 OS=Bos taurus GN=SHOC2 PE=2 SV=1 208 326 3.0E-06
sp|Q5RAV5|SHOC2_PONAB Leucine-rich repeat protein SHOC-2 OS=Pongo abelii GN=SHOC2 PE=2 SV=2 208 326 3.0E-06
sp|Q9UQ13|SHOC2_HUMAN Leucine-rich repeat protein SHOC-2 OS=Homo sapiens GN=SHOC2 PE=1 SV=2 208 326 3.0E-06
sp|Q3V1N1|MFHA1_MOUSE Malignant fibrous histiocytoma-amplified sequence 1 homolog OS=Mus musculus GN=Mfhas1 PE=2 SV=2 236 317 3.0E-06
sp|B5DX45|SUR8_DROPS Leucine-rich repeat protein soc-2 homolog OS=Drosophila pseudoobscura pseudoobscura GN=Sur-8 PE=3 SV=1 210 347 3.0E-06
sp|Q4R3P6|LRC40_MACFA Leucine-rich repeat-containing protein 40 OS=Macaca fascicularis GN=LRRC40 PE=2 SV=1 197 317 3.0E-06
sp|Q9FFJ3|PIRL1_ARATH Plant intracellular Ras-group-related LRR protein 1 OS=Arabidopsis thaliana GN=PIRL1 PE=2 SV=1 214 365 3.0E-06
sp|Q9Y2L9|LRCH1_HUMAN Leucine-rich repeat and calponin homology domain-containing protein 1 OS=Homo sapiens GN=LRCH1 PE=1 SV=3 229 323 3.0E-06
sp|Q9V780|LAP1_DROME Protein lap1 OS=Drosophila melanogaster GN=Lap1 PE=2 SV=1 236 317 4.0E-06
sp|Q3UMG5|LRCH2_MOUSE Leucine-rich repeat and calponin homology domain-containing protein 2 OS=Mus musculus GN=Lrch2 PE=2 SV=2 212 315 4.0E-06
sp|Q9SVW8|PIRL4_ARATH Plant intracellular Ras-group-related LRR protein 4 OS=Arabidopsis thaliana GN=PIRL4 PE=1 SV=1 224 345 4.0E-06
sp|B4LXW1|SUR8_DROVI Leucine-rich repeat protein soc-2 homolog OS=Drosophila virilis GN=Sur-8 PE=3 SV=1 221 347 4.0E-06
sp|F1MCA7|LRRC7_BOVIN Leucine-rich repeat-containing protein 7 OS=Bos taurus GN=LRRC7 PE=3 SV=3 236 315 4.0E-06
sp|A7SFP1|SHOC2_NEMVE Leucine-rich repeat protein soc-2 homolog OS=Nematostella vectensis GN=v1g189306 PE=3 SV=1 249 324 4.0E-06
sp|Q14160|SCRIB_HUMAN Protein scribble homolog OS=Homo sapiens GN=SCRIB PE=1 SV=4 221 315 5.0E-06
sp|Q7XDQ7|PIRL8_ORYSJ Plant intracellular Ras-group-related LRR protein 8 OS=Oryza sativa subsp. japonica GN=IRL8 PE=2 SV=1 229 315 5.0E-06
sp|Q01631|CYAA_NEUCR Adenylate cyclase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cr-1 PE=1 SV=2 202 315 5.0E-06
sp|B4QVR7|SUR8_DROSI Leucine-rich repeat protein soc-2 homolog OS=Drosophila simulans GN=Sur-8 PE=3 SV=2 214 324 5.0E-06
sp|Q54TM7|DRKD_DICDI Probable serine/threonine-protein kinase drkD OS=Dictyostelium discoideum GN=drkD PE=2 SV=1 209 315 5.0E-06
sp|Q5RFE9|LRC40_PONAB Leucine-rich repeat-containing protein 40 OS=Pongo abelii GN=LRRC40 PE=2 SV=1 227 315 5.0E-06
sp|Q9BYS8|LRRC2_HUMAN Leucine-rich repeat-containing protein 2 OS=Homo sapiens GN=LRRC2 PE=2 SV=2 206 315 5.0E-06
sp|Q9SHI3|RLP2_ARATH Receptor-like protein 2 OS=Arabidopsis thaliana GN=RLP2 PE=2 SV=1 238 329 5.0E-06
sp|Q6NX28|LRC59_XENTR Leucine-rich repeat-containing protein 59 OS=Xenopus tropicalis GN=lrrc59 PE=2 SV=1 214 315 5.0E-06
sp|Q8BXA7|PHLP2_MOUSE PH domain leucine-rich repeat-containing protein phosphatase 2 OS=Mus musculus GN=Phlpp2 PE=1 SV=3 230 317 5.0E-06
sp|Q8BGI7|LRC39_MOUSE Leucine-rich repeat-containing protein 39 OS=Mus musculus GN=Lrrc39 PE=1 SV=1 222 313 5.0E-06
sp|Q96DD0|LRC39_HUMAN Leucine-rich repeat-containing protein 39 OS=Homo sapiens GN=LRRC39 PE=2 SV=1 222 313 5.0E-06
sp|Q03264|NGL2_YEAST RNA exonuclease NGL2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NGL2 PE=1 SV=1 371 605 5.0E-06
sp|Q80U72|SCRIB_MOUSE Protein scribble homolog OS=Mus musculus GN=Scrib PE=1 SV=2 210 335 6.0E-06
sp|Q14160|SCRIB_HUMAN Protein scribble homolog OS=Homo sapiens GN=SCRIB PE=1 SV=4 210 335 6.0E-06
sp|Q6INV3|LRC57_XENLA Leucine-rich repeat-containing protein 57 OS=Xenopus laevis GN=lrrc57 PE=2 SV=1 213 306 6.0E-06
sp|Q5VUJ6|LRCH2_HUMAN Leucine-rich repeat and calponin homology domain-containing protein 2 OS=Homo sapiens GN=LRCH2 PE=2 SV=2 212 315 6.0E-06
sp|Q9VEK6|SUR8_DROME Leucine-rich repeat protein soc-2 homolog OS=Drosophila melanogaster GN=Sur-8 PE=2 SV=3 205 324 6.0E-06
sp|B4PU77|SUR8_DROYA Leucine-rich repeat protein soc-2 homolog OS=Drosophila yakuba GN=Sur-8 PE=3 SV=1 205 324 6.0E-06
sp|B3P3E8|SUR8_DROER Leucine-rich repeat protein soc-2 homolog OS=Drosophila erecta GN=Sur-8 PE=3 SV=1 205 324 6.0E-06
sp|Q5F4C4|SHOC2_CHICK Leucine-rich repeat protein SHOC-2 OS=Gallus gallus GN=SHOC2 PE=2 SV=1 188 324 6.0E-06
sp|Q8AVI4|SHOC2_XENLA Leucine-rich repeat protein SHOC-2 OS=Xenopus laevis GN=shoc2 PE=2 SV=1 210 316 6.0E-06
sp|A7SFP1|SHOC2_NEMVE Leucine-rich repeat protein soc-2 homolog OS=Nematostella vectensis GN=v1g189306 PE=3 SV=1 208 296 6.0E-06
sp|Q9LP24|Y1571_ARATH Probable leucine-rich repeat receptor-like protein kinase At1g35710 OS=Arabidopsis thaliana GN=At1g35710 PE=2 SV=1 236 347 6.0E-06
sp|P22792|CPN2_HUMAN Carboxypeptidase N subunit 2 OS=Homo sapiens GN=CPN2 PE=1 SV=3 157 350 6.0E-06
sp|C0LGX3|HSL2_ARATH LRR receptor-like serine/threonine-protein kinase HSL2 OS=Arabidopsis thaliana GN=HSL2 PE=2 SV=1 212 342 6.0E-06
sp|Q9FRS6|PXL1_ARATH Leucine-rich repeat receptor-like protein kinase PXL1 OS=Arabidopsis thaliana GN=PXL1 PE=1 SV=1 236 347 6.0E-06
sp|A4D1F6|LRRD1_HUMAN Leucine-rich repeat and death domain-containing protein 1 OS=Homo sapiens GN=LRRD1 PE=2 SV=2 246 382 6.0E-06
sp|Q6DHL5|LRC57_DANRE Leucine-rich repeat-containing protein 57 OS=Danio rerio GN=lrrc57 PE=2 SV=1 213 316 7.0E-06
sp|Q5M8G4|LRC40_XENTR Leucine-rich repeat-containing protein 40 OS=Xenopus tropicalis GN=lrrc40 PE=2 SV=1 214 332 7.0E-06
sp|Q96RT1|LAP2_HUMAN Protein LAP2 OS=Homo sapiens GN=ERBB2IP PE=1 SV=2 212 315 7.0E-06
sp|Q6AYI5|SHOC2_RAT Leucine-rich repeat protein SHOC-2 OS=Rattus norvegicus GN=Shoc2 PE=2 SV=1 220 324 7.0E-06
sp|P62046|LRCH1_MOUSE Leucine-rich repeat and calponin homology domain-containing protein 1 OS=Mus musculus GN=Lrch1 PE=1 SV=2 229 315 7.0E-06
sp|Q7XNY1|PIRL1_ORYSJ Plant intracellular Ras-group-related LRR protein 1 OS=Oryza sativa subsp. japonica GN=IRL1 PE=2 SV=2 212 315 7.0E-06
sp|A6NIV6|LRIQ4_HUMAN Leucine-rich repeat and IQ domain-containing protein 4 OS=Homo sapiens GN=LRRIQ4 PE=3 SV=2 227 318 7.0E-06
sp|Q38SD2|LRRK1_HUMAN Leucine-rich repeat serine/threonine-protein kinase 1 OS=Homo sapiens GN=LRRK1 PE=1 SV=3 259 336 7.0E-06
sp|Q7XA39|RGA4_SOLBU Putative disease resistance protein RGA4 OS=Solanum bulbocastanum GN=RGA4 PE=2 SV=1 226 318 7.0E-06
sp|Q4V8I7|LRC8A_RAT Volume-regulated anion channel subunit LRRC8A OS=Rattus norvegicus GN=Lrrc8a PE=1 SV=1 210 331 8.0E-06
sp|Q6AYI5|SHOC2_RAT Leucine-rich repeat protein SHOC-2 OS=Rattus norvegicus GN=Shoc2 PE=2 SV=1 208 326 8.0E-06
sp|Q9C7S5|PSYR1_ARATH Tyrosine-sulfated glycopeptide receptor 1 OS=Arabidopsis thaliana GN=PSYR1 PE=2 SV=1 238 329 8.0E-06
sp|Q66HD6|LRC18_RAT Leucine-rich repeat-containing protein 18 OS=Rattus norvegicus GN=Lrrc18 PE=2 SV=1 210 314 8.0E-06
sp|Q8N456|LRC18_HUMAN Leucine-rich repeat-containing protein 18 OS=Homo sapiens GN=LRRC18 PE=2 SV=2 210 314 8.0E-06
sp|A6H6A4|LRIQ4_MOUSE Leucine-rich repeat and IQ domain-containing protein 4 OS=Mus musculus GN=Lrriq4 PE=2 SV=1 210 316 8.0E-06
sp|Q7KRY7|LAP4_DROME Protein lap4 OS=Drosophila melanogaster GN=scrib PE=1 SV=1 239 315 9.0E-06
sp|B4IBI9|SUR8_DROSE Leucine-rich repeat protein soc-2 homolog OS=Drosophila sechellia GN=Sur-8 PE=3 SV=1 210 322 9.0E-06
sp|B4QVR7|SUR8_DROSI Leucine-rich repeat protein soc-2 homolog OS=Drosophila simulans GN=Sur-8 PE=3 SV=2 210 322 9.0E-06
sp|Q22875|SHOC2_CAEEL Leucine-rich repeat protein soc-2 OS=Caenorhabditis elegans GN=soc-2 PE=1 SV=3 214 318 9.0E-06
sp|B0W6M9|SUR8_CULQU Leucine-rich repeat protein soc-2 homolog OS=Culex quinquefasciatus GN=Sur-8 PE=3 SV=1 211 326 1.0E-05
sp|P08678|CYAA_YEAST Adenylate cyclase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CYR1 PE=1 SV=2 210 306 1.0E-05
sp|O88520|SHOC2_MOUSE Leucine-rich repeat protein SHOC-2 OS=Mus musculus GN=Shoc2 PE=1 SV=2 220 324 1.0E-05
sp|Q66HD6|LRC18_RAT Leucine-rich repeat-containing protein 18 OS=Rattus norvegicus GN=Lrrc18 PE=2 SV=1 214 318 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|040370
MYYPQQSPGINHKLANPHDQSPWSRPHHAILVPPGAQSAVGPPPSPGYALYANGAVNPLQHHPAHHPLSHPLQHH
HHNSLPHYPSPPNGTSHPQHPYGQGSPASSNGQIMSQHWQQQLLKCEMVRSSRSPHHRARANAMAARSVTKSAIT
IANPNKPPPEVNGISGDSSPSSVHTHAEGSPNNHHPSVTAHVAPISLTPRPFSLRPPENNWTSLDMGGVNIKNLP
SSSGLFSFTFLVTLYLNHNALSSIPPEIAKLRHLELLDLSGNNLTSLPPELGMLTQLKELYVFDNHLSTLPPEVG
SLHHLQTFGVEGNPLDATLKSLVQKDGTPALISYLRDTGPVPAPPPERTWKYLLSQVEQQALMSDPNSENISVLS
YNILCEKYATERLYGYTPAWALLWDYRKELILNELLASDADFLCVQEMDVAQYEEYFSKHLSRDYTGVYSPKSRA
KTMDNEQERRFVDGCAIFYKTSRFQLVEKQLIEFSAVAMQRQDFKKTDDMFNRVLGKDHIAVVCLMEDKQTGTRF
IIANTHIHSHPAYRDVKLVQVALLVEEVEKIANNFSRLPPRPPQQHSDGGSSPPPTRPPPAYSDGTKIPLIIAGD
FNSIPQSGVYEFLNNGTLAADHPDFMSHTYGRYTSEGPRHRLGLKSANSSLGVGEPLTNHTPPFQGTIDYIWYST
ANLGVNAVLGEVDKAYLEKVVGFPNAHFPSDHICQIAEFRVKHPKDQAPRTPSL*
Coding >AgabiH97|040370
ATGTACTATCCTCAGCAATCCCCCGGAATCAACCACAAACTCGCAAACCCACACGACCAGTCTCCGTGGTCTCGG
CCCCACCACGCCATCCTCGTCCCGCCCGGCGCTCAGTCCGCCGTCGGCCCGCCCCCGTCTCCTGGCTATGCCCTC
TACGCCAATGGCGCAGTGAATCCCCTCCAGCACCATCCCGCGCACCATCCTCTCTCCCATCCCCTCCAACACCAC
CACCACAACTCTTTGCCCCATTACCCGTCCCCACCCAATGGCACATCCCATCCCCAGCATCCCTATGGCCAGGGA
TCCCCAGCCAGCTCCAACGGCCAGATCATGTCGCAACATTGGCAGCAGCAGTTGCTCAAATGCGAGATGGTTCGG
TCTTCGCGATCCCCCCACCACCGCGCTCGTGCAAACGCCATGGCCGCAAGATCTGTAACAAAGTCCGCGATCACC
ATCGCAAATCCAAATAAACCGCCACCCGAAGTCAATGGCATATCCGGCGACTCTTCTCCTTCCTCAGTCCACACT
CACGCGGAAGGTTCTCCCAATAATCATCACCCCTCCGTAACCGCACACGTAGCTCCCATCTCCCTCACTCCTCGT
CCCTTCTCCTTGCGCCCACCGGAAAACAATTGGACTTCATTGGACATGGGTGGCGTCAACATCAAGAATCTGCCT
TCCTCTTCCGGCCTCTTCTCATTCACCTTTCTTGTCACACTCTATCTCAACCATAACGCTCTATCCTCAATACCG
CCGGAAATTGCCAAGCTACGACACCTCGAGCTACTCGATTTGTCTGGCAACAATCTCACTTCCCTTCCCCCCGAA
TTAGGAATGCTCACCCAGCTGAAAGAGTTGTATGTGTTTGACAATCACCTCTCTACCCTTCCTCCGGAAGTTGGA
AGTTTGCATCACCTACAGACGTTTGGTGTCGAGGGTAATCCGTTGGACGCTACACTCAAATCCCTCGTCCAAAAG
GACGGCACGCCCGCTCTTATATCTTATCTCAGAGATACGGGTCCTGTCCCTGCCCCTCCCCCCGAACGAACCTGG
AAATATCTCCTATCTCAGGTAGAGCAGCAGGCGCTCATGAGTGATCCAAATTCGGAAAACATCAGTGTACTTTCT
TACAACATCCTTTGTGAAAAGTATGCGACGGAACGGCTGTATGGATATACACCCGCATGGGCATTGCTGTGGGAC
TACAGGAAGGAGTTGATTTTGAACGAGCTTCTAGCTTCGGACGCCGACTTTTTGTGCGTGCAAGAAATGGACGTG
GCCCAATATGAGGAATATTTCTCCAAGCACCTTTCGCGCGATTACACGGGCGTTTATTCGCCAAAATCGAGGGCA
AAGACAATGGACAATGAACAGGAACGGAGGTTTGTTGATGGGTGTGCCATATTCTACAAGACGTCCAGATTTCAA
CTTGTAGAGAAGCAGCTGATCGAGTTCAGCGCGGTCGCCATGCAACGGCAAGACTTTAAGAAGACAGACGATATG
TTCAATCGTGTTTTAGGCAAAGACCATATCGCCGTTGTCTGTCTGATGGAAGACAAGCAAACGGGAACTCGATTC
ATCATCGCCAACACCCATATTCATTCTCATCCTGCATACCGTGACGTCAAGCTCGTTCAAGTCGCGCTCCTTGTC
GAAGAGGTTGAGAAAATTGCCAACAATTTCTCTAGACTTCCTCCCCGACCTCCACAGCAGCATAGTGATGGGGGG
AGTAGCCCACCGCCTACACGCCCACCGCCCGCGTATTCTGACGGGACGAAGATTCCGCTGATCATTGCTGGAGAT
TTCAACTCTATACCCCAGTCGGGTGTGTATGAGTTTTTGAATAATGGAACTTTGGCGGCGGACCATCCTGATTTT
ATGTCGCATACGTATGGACGATATACGTCAGAGGGTCCACGGCATCGACTTGGGTTGAAGAGTGCAAATTCGTCG
CTTGGGGTTGGCGAACCGTTGACAAATCACACACCACCTTTCCAGGGCACCATTGACTACATCTGGTATTCCACA
GCCAATCTAGGCGTGAACGCGGTGCTTGGAGAGGTAGATAAAGCGTATCTGGAGAAGGTGGTAGGGTTCCCGAAT
GCACACTTCCCTTCAGATCACATTTGCCAAATCGCAGAGTTCCGGGTGAAGCATCCCAAGGACCAAGCGCCACGC
ACGCCTAGCCTCTAG
Transcript >AgabiH97|040370
ATGTACTATCCTCAGCAATCCCCCGGAATCAACCACAAACTCGCAAACCCACACGACCAGTCTCCGTGGTCTCGG
CCCCACCACGCCATCCTCGTCCCGCCCGGCGCTCAGTCCGCCGTCGGCCCGCCCCCGTCTCCTGGCTATGCCCTC
TACGCCAATGGCGCAGTGAATCCCCTCCAGCACCATCCCGCGCACCATCCTCTCTCCCATCCCCTCCAACACCAC
CACCACAACTCTTTGCCCCATTACCCGTCCCCACCCAATGGCACATCCCATCCCCAGCATCCCTATGGCCAGGGA
TCCCCAGCCAGCTCCAACGGCCAGATCATGTCGCAACATTGGCAGCAGCAGTTGCTCAAATGCGAGATGGTTCGG
TCTTCGCGATCCCCCCACCACCGCGCTCGTGCAAACGCCATGGCCGCAAGATCTGTAACAAAGTCCGCGATCACC
ATCGCAAATCCAAATAAACCGCCACCCGAAGTCAATGGCATATCCGGCGACTCTTCTCCTTCCTCAGTCCACACT
CACGCGGAAGGTTCTCCCAATAATCATCACCCCTCCGTAACCGCACACGTAGCTCCCATCTCCCTCACTCCTCGT
CCCTTCTCCTTGCGCCCACCGGAAAACAATTGGACTTCATTGGACATGGGTGGCGTCAACATCAAGAATCTGCCT
TCCTCTTCCGGCCTCTTCTCATTCACCTTTCTTGTCACACTCTATCTCAACCATAACGCTCTATCCTCAATACCG
CCGGAAATTGCCAAGCTACGACACCTCGAGCTACTCGATTTGTCTGGCAACAATCTCACTTCCCTTCCCCCCGAA
TTAGGAATGCTCACCCAGCTGAAAGAGTTGTATGTGTTTGACAATCACCTCTCTACCCTTCCTCCGGAAGTTGGA
AGTTTGCATCACCTACAGACGTTTGGTGTCGAGGGTAATCCGTTGGACGCTACACTCAAATCCCTCGTCCAAAAG
GACGGCACGCCCGCTCTTATATCTTATCTCAGAGATACGGGTCCTGTCCCTGCCCCTCCCCCCGAACGAACCTGG
AAATATCTCCTATCTCAGGTAGAGCAGCAGGCGCTCATGAGTGATCCAAATTCGGAAAACATCAGTGTACTTTCT
TACAACATCCTTTGTGAAAAGTATGCGACGGAACGGCTGTATGGATATACACCCGCATGGGCATTGCTGTGGGAC
TACAGGAAGGAGTTGATTTTGAACGAGCTTCTAGCTTCGGACGCCGACTTTTTGTGCGTGCAAGAAATGGACGTG
GCCCAATATGAGGAATATTTCTCCAAGCACCTTTCGCGCGATTACACGGGCGTTTATTCGCCAAAATCGAGGGCA
AAGACAATGGACAATGAACAGGAACGGAGGTTTGTTGATGGGTGTGCCATATTCTACAAGACGTCCAGATTTCAA
CTTGTAGAGAAGCAGCTGATCGAGTTCAGCGCGGTCGCCATGCAACGGCAAGACTTTAAGAAGACAGACGATATG
TTCAATCGTGTTTTAGGCAAAGACCATATCGCCGTTGTCTGTCTGATGGAAGACAAGCAAACGGGAACTCGATTC
ATCATCGCCAACACCCATATTCATTCTCATCCTGCATACCGTGACGTCAAGCTCGTTCAAGTCGCGCTCCTTGTC
GAAGAGGTTGAGAAAATTGCCAACAATTTCTCTAGACTTCCTCCCCGACCTCCACAGCAGCATAGTGATGGGGGG
AGTAGCCCACCGCCTACACGCCCACCGCCCGCGTATTCTGACGGGACGAAGATTCCGCTGATCATTGCTGGAGAT
TTCAACTCTATACCCCAGTCGGGTGTGTATGAGTTTTTGAATAATGGAACTTTGGCGGCGGACCATCCTGATTTT
ATGTCGCATACGTATGGACGATATACGTCAGAGGGTCCACGGCATCGACTTGGGTTGAAGAGTGCAAATTCGTCG
CTTGGGGTTGGCGAACCGTTGACAAATCACACACCACCTTTCCAGGGCACCATTGACTACATCTGGTATTCCACA
GCCAATCTAGGCGTGAACGCGGTGCTTGGAGAGGTAGATAAAGCGTATCTGGAGAAGGTGGTAGGGTTCCCGAAT
GCACACTTCCCTTCAGATCACATTTGCCAAATCGCAGAGTTCCGGGTGAAGCATCCCAAGGACCAAGCGCCACGC
ACGCCTAGCCTCTAG
Gene >AgabiH97|040370
ATGTACTATCCTCAGCAATCCCCCGGAATCAACCACAAACTCGCAAACCCACACGACCAGTCTCCGTGGTCTCGG
CCCCACCACGCCATCCTCGTCCCGCCCGGCGCTCAGTCCGCCGTCGGCCCGCCCCCGTCTCCTGGCTATGCCCTC
TACGCCAATGGCGCAGTGAATCCCCTCCAGCACCATCCCGCGCACCATCCTCTCTCCCATCCCCTCCAACACCAC
CACCACAACTCTTTGCCCCATTACCCGTCCCCACCCAATGGCACATCCCATCCCCAGCATCCCTATGGCCAGGGA
TCCCCAGCCAGCTCCAACGGCCAGATCATGTCGCAACATTGGCAGCAGCAGTTGCTCAAATGCGAGGTGCGTCGG
TATCACTTTTTCTTTCTTTTTTTCTTTGTCCTCATCTGTATCAAAGATGGTTCGGTCTTCGCGATCCCCCCACCA
CCGCGCTCGTGCAAACGCCATGGCCGCAAGATCTGTAACAAAGTCCGCGATCACCATCGCAAATCCAAATAAACC
GCCACCCGAAGTCAATGGCATATCCGGCGACTCTTCTCCTTCCTCAGTCCACACTCACGCGGAAGGTTCTCCCAA
TAATCATCACCCCTCCGTAACCGCACACGTAGCTCCCATCTCCCTCACTCCTCGTCCCTTCTCCTTGCGCCCACC
GGAAAACAATTGGACTTCATTGGACATGGGTGGCGTCAACATCAAGAATCTGCCTTCCTCTTCCGGCCTCTTCTC
ATTCACCTTTCTTGTCACACTCTATCTCAACCATAACGCTCTATCCTCAATACCGCCGGAAATTGCCAAGCTACG
ACACCTCGAGCTACTCGATTTGTCTGGCAACAATCTCACTTCCCTTCCCCCCGAATTAGGAATGCTCACCCAGCT
GAAAGAGTTGTATGTGTTTGACAATCACCTCTCTACCCTTCCTCCGGAAGTTGGAAGTTTGCATCACCTACAGAC
GTTTGGTGTCGAGGGTAATCCGTTGGACGCTACACTCAAATCCCTCGTCCAAAAGGACGGCACGCCCGCTCTTAT
ATCTTATCTCAGAGATACGGGTCCTGTCCCTGCCCCTCCCCCCGAACGAACCTGGAAATATCTCCTATCTCAGGT
AGAGCAGCAGGCGCTCATGAGTGATCCAAATTCGGAAAACATCAGTGTACTTTCTTACAACATCCTTTGTGAAAA
GTATGCGACGGAACGGCTGTATGGATATACACCCGCATGGGCATTGCTGTGGGACTACAGGAAGGAGTTGATTTT
GAACGAGCTTCTAGCTTCGGACGCCGACTTTTTGTGCGTGCAAGAAATGGACGTGGCCCAATATGAGGAATATTT
CTCCAAGCACCTTTCGCGCGATTACACGGGCGTTTATTCGCCAAAATCGAGGGCAAAGACAATGGACAATGAACA
GGAACGGAGGTTTGTTGATGGGTGTGCCATATTCTACAAGACGTCCAGGTGCGTTTCTCAGAACTACAGCTTTCG
TCGTTTTTCTAATGCCATATTAGATTTCAACTTGTAGAGAAGCAGCTGATCGAGTTCAGCGCGGTCGCCATGCAA
CGGCAAGACTTTAAGAAGACAGACGATATGTTCAATCGTGTTTTAGGCAAAGACCATATCGCCGTTGTCTGTCTG
ATGGAAGACAAGCAAACGGGAACTCGATTCATCATCGCCAACACCCATATTCATTCTCATCCTGCATACCGTGAC
GTCAAGCTCGTTCAAGTCGCGCTCCTTGTCGAAGAGGTTGAGAAAATTGCCAACAATTTCTCTAGACTTCCTCCC
CGACCTCCACAGCAGCATAGTGATGGGGGGAGTAGCCCACCGCCTACACGCCCACCGCCCGCGTATTCTGACGGG
ACGAAGATTCCGCTGATCATTGCTGGAGATTTCAACTCTATACCCCAGTCGGGTGTGTATGAGTTTTTGAATAAT
GGAACTTTGGCGGCGGACCATCCTGATTTTATGTCGCATACGTATGGACGATATACGTCAGAGGGTCCACGGCAT
CGACTTGGGTTGAAGAGTGCAAATTCGTCGCTTGGGGTTGGCGAACCGTTGACAAATCACACACCACCTTTCCAG
GGCACCATTGACTACATCTGGTATTCCACAGCCAATCTAGGCGTGAACGCGGTGCTTGGAGAGGTAGATAAAGCG
TATCTGGAGAAGGTGGTAGGGTTCCCGAATGCACACTTCCCTTCAGAGTAAGTTGCAACTTTTTTTTCGTTCGGC
CTGTTTCTGACCTGAGTTATCACAGTCACATTTGCCAAATCGCAGAGTTCCGGGTGAAGCATCCCAAGGACCAAG
CGCCACGCACGCCTAGCCTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail