Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|040360
Gene name
Locationscaffold_2:488926..492571
Strand+
Gene length (bp)3645
Transcript length (bp)2685
Coding sequence length (bp)2685
Protein length (aa) 895

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00082 Peptidase_S8 Subtilase family 3.0E-44 160 561
PF06280 fn3_5 Fn3-like domain 9.6E-10 605 709

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P29141|SUBV_BACSU Minor extracellular protease vpr OS=Bacillus subtilis (strain 168) GN=vpr PE=1 SV=1 41 645 2.0E-44
sp|P15293|P2P_LACLC PII-type proteinase OS=Lactococcus lactis subsp. cremoris GN=prt PE=3 SV=1 160 593 1.0E-21
sp|P16271|P1P_LACLC PI-type proteinase OS=Lactococcus lactis subsp. cremoris GN=prtP PE=3 SV=1 160 593 7.0E-21
sp|P15292|P3P_LACLS PIII-type proteinase OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=prtP PE=1 SV=2 160 593 2.0E-20
sp|Q02470|P2P_LACPA PII-type proteinase OS=Lactobacillus paracasei GN=prtP PE=1 SV=1 160 593 9.0E-20
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P29141|SUBV_BACSU Minor extracellular protease vpr OS=Bacillus subtilis (strain 168) GN=vpr PE=1 SV=1 41 645 2.0E-44
sp|P15293|P2P_LACLC PII-type proteinase OS=Lactococcus lactis subsp. cremoris GN=prt PE=3 SV=1 160 593 1.0E-21
sp|P16271|P1P_LACLC PI-type proteinase OS=Lactococcus lactis subsp. cremoris GN=prtP PE=3 SV=1 160 593 7.0E-21
sp|P15292|P3P_LACLS PIII-type proteinase OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=prtP PE=1 SV=2 160 593 2.0E-20
sp|Q02470|P2P_LACPA PII-type proteinase OS=Lactobacillus paracasei GN=prtP PE=1 SV=1 160 593 9.0E-20
sp|Q45670|THES_BACSJ Thermophilic serine proteinase OS=Bacillus sp. (strain AK1) PE=1 SV=1 162 340 5.0E-18
sp|P11018|ISP1_BACSU Major intracellular serine protease OS=Bacillus subtilis (strain 168) GN=isp PE=1 SV=2 152 315 5.0E-17
sp|P04189|SUBT_BACSU Subtilisin E OS=Bacillus subtilis (strain 168) GN=aprE PE=1 SV=3 153 319 5.0E-16
sp|P35835|SUBN_BACNA Subtilisin NAT OS=Bacillus subtilis subsp. natto GN=aprN PE=1 SV=1 153 319 6.0E-16
sp|P07518|SUBT_BACPU Subtilisin OS=Bacillus pumilus GN=apr PE=1 SV=1 153 319 1.0E-15
sp|P29139|ISP_PAEPO Intracellular serine protease OS=Paenibacillus polymyxa GN=isp PE=1 SV=1 137 315 4.0E-15
sp|P29142|SUBT_GEOSE Subtilisin J OS=Geobacillus stearothermophilus GN=aprJ PE=3 SV=1 2 314 5.0E-15
sp|P42780|BPRX_DICNO Extracellular subtilisin-like protease OS=Dichelobacter nodosus PE=3 SV=1 26 337 7.0E-15
sp|P00783|SUBT_BACSA Subtilisin amylosacchariticus OS=Bacillus subtilis subsp. amylosacchariticus GN=apr PE=1 SV=2 153 314 1.0E-14
sp|P00781|SUBD_BACLI Subtilisin DY OS=Bacillus licheniformis GN=apr PE=1 SV=1 151 339 3.0E-14
sp|P04072|THET_THEVU Thermitase OS=Thermoactinomyces vulgaris PE=1 SV=1 160 287 2.0E-13
sp|P00782|SUBT_BACAM Subtilisin BPN' OS=Bacillus amyloliquefaciens GN=apr PE=1 SV=1 77 287 3.0E-13
sp|P0DD35|C5AP_STRPQ C5a peptidase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=scpA PE=3 SV=1 114 541 7.0E-13
sp|P0DD34|C5AP_STRP3 C5a peptidase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=scpA PE=3 SV=1 114 541 7.0E-13
sp|I3R794|HLY_HALMT Halolysin OS=Haloferax mediterranei (strain ATCC 33500 / DSM 1411 / JCM 8866 / NBRC 14739 / NCIMB 2177 / R-4) GN=hly PE=1 SV=1 163 315 2.0E-12
sp|P23314|EXPR_XANCP Extracellular protease OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=XCC0851 PE=3 SV=1 159 337 6.0E-12
sp|P58099|C5AP_STRP1 C5a peptidase OS=Streptococcus pyogenes serotype M1 GN=scpA PE=3 SV=1 94 541 2.0E-11
sp|Q5X9R0|C5AP_STRP6 C5a peptidase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=scpA PE=3 SV=1 94 541 4.0E-11
sp|Q8NZ80|C5AP_STRP8 C5a peptidase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=scpA PE=3 SV=1 124 541 5.0E-11
sp|P15926|C5AP_STRPY C5a peptidase OS=Streptococcus pyogenes GN=scpA PE=1 SV=1 124 541 9.0E-11
sp|P16396|SUBE_BACSU Minor extracellular protease Epr OS=Bacillus subtilis (strain 168) GN=epr PE=2 SV=1 157 315 1.0E-10
sp|P29122|PCSK6_HUMAN Proprotein convertase subtilisin/kexin type 6 OS=Homo sapiens GN=PCSK6 PE=1 SV=1 156 353 1.0E-10
sp|P00780|SUBT_BACLI Subtilisin Carlsberg OS=Bacillus licheniformis GN=apr PE=1 SV=1 132 295 3.0E-10
sp|P29599|SUBB_BACLE Subtilisin BL OS=Bacillus lentus PE=1 SV=1 154 338 5.0E-10
sp|Q63415|PCSK6_RAT Proprotein convertase subtilisin/kexin type 6 OS=Rattus norvegicus GN=Pcsk6 PE=2 SV=1 156 340 5.0E-10
sp|P42779|BPRV_DICNO Extracellular basic protease OS=Dichelobacter nodosus GN=bprV PE=1 SV=1 151 314 6.0E-10
sp|Q9WTZ2|MBTP1_MOUSE Membrane-bound transcription factor site-1 protease OS=Mus musculus GN=Mbtps1 PE=1 SV=1 36 338 6.0E-10
sp|P13134|KEX2_YEAST Kexin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KEX2 PE=1 SV=1 153 354 2.0E-09
sp|Q78EH2|PCSK4_RAT Proprotein convertase subtilisin/kexin type 4 OS=Rattus norvegicus GN=Pcsk4 PE=2 SV=1 152 350 3.0E-09
sp|P29121|PCSK4_MOUSE Proprotein convertase subtilisin/kexin type 4 OS=Mus musculus GN=Pcsk4 PE=2 SV=1 152 350 3.0E-09
sp|Q0WUG6|SBT61_ARATH Subtilisin-like protease SBT6.1 OS=Arabidopsis thaliana GN=SBT6.1 PE=1 SV=1 149 339 1.0E-08
sp|P30432|FUR2_DROME Furin-like protease 2 OS=Drosophila melanogaster GN=Fur2 PE=2 SV=2 156 353 2.0E-08
sp|P29600|SUBS_BACLE Subtilisin Savinase OS=Bacillus lentus PE=1 SV=1 154 338 2.0E-08
sp|P54423|WPRA_BACSU Cell wall-associated protease OS=Bacillus subtilis (strain 168) GN=wprA PE=1 SV=2 165 338 4.0E-08
sp|P27693|ELYA_BACAO Alkaline protease OS=Bacillus alcalophilus PE=1 SV=1 134 341 6.0E-08
sp|P41362|ELYA_BACCS Alkaline protease OS=Bacillus clausii PE=1 SV=1 134 341 7.0E-08
sp|Q99405|PRTM_BACSK M-protease OS=Bacillus clausii (strain KSM-K16) GN=aprE PE=1 SV=2 154 341 1.0E-07
sp|O17798|FKPC1_CAEEL Furin-like protease kpc-1 OS=Caenorhabditis elegans GN=kpc-1 PE=1 SV=2 157 382 1.0E-07
sp|P29146|NECA_HYDVU PC3-like endoprotease variant A OS=Hydra vulgaris PE=2 SV=1 156 267 1.0E-07
sp|Q6UW60|PCSK4_HUMAN Proprotein convertase subtilisin/kexin type 4 OS=Homo sapiens GN=PCSK4 PE=2 SV=2 155 350 1.0E-07
sp|P16588|PROA_VIBAL Alkaline serine exoprotease A OS=Vibrio alginolyticus GN=proA PE=3 SV=1 96 338 1.0E-07
sp|P72186|PLS_PYRFU Pyrolysin OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=pls PE=1 SV=2 466 587 1.0E-07
sp|P23377|FURIN_RAT Furin OS=Rattus norvegicus GN=Furin PE=1 SV=1 150 340 2.0E-07
sp|P26016|FUR11_DROME Furin-like protease 1, isoforms 1/1-X/2 OS=Drosophila melanogaster GN=Fur1 PE=2 SV=2 157 340 2.0E-07
sp|F4HSQ2|SBT51_ARATH Subtilisin-like protease SBT5.1 OS=Arabidopsis thaliana GN=SBT5.1 PE=3 SV=1 218 588 2.0E-07
sp|P29145|NECB_HYDVU PC3-like endoprotease variant B OS=Hydra vulgaris PE=2 SV=1 156 267 2.0E-07
sp|Q9LNU1|CRSP_ARATH CO(2)-response secreted protease OS=Arabidopsis thaliana GN=CRSP PE=2 SV=1 208 539 3.0E-07
sp|Q92824|PCSK5_HUMAN Proprotein convertase subtilisin/kexin type 5 OS=Homo sapiens GN=PCSK5 PE=1 SV=4 113 340 3.0E-07
sp|P30430|FUR1C_DROME Furin-like protease 1, isoform 1-CRR OS=Drosophila melanogaster GN=Fur1 PE=2 SV=2 157 340 4.0E-07
sp|P23188|FURIN_MOUSE Furin OS=Mus musculus GN=Furin PE=1 SV=2 150 340 4.0E-07
sp|P41413|PCSK5_RAT Proprotein convertase subtilisin/kexin type 5 OS=Rattus norvegicus GN=Pcsk5 PE=2 SV=3 113 340 4.0E-07
sp|P28840|NEC1_RAT Neuroendocrine convertase 1 OS=Rattus norvegicus GN=Pcsk1 PE=2 SV=1 156 328 4.0E-07
sp|O31788|APRX_BACSU Serine protease AprX OS=Bacillus subtilis (strain 168) GN=aprX PE=1 SV=1 141 339 5.0E-07
sp|P29120|NEC1_HUMAN Neuroendocrine convertase 1 OS=Homo sapiens GN=PCSK1 PE=1 SV=2 64 328 5.0E-07
sp|Q28193|FURIN_BOVIN Furin OS=Bos taurus GN=FURIN PE=1 SV=1 150 267 8.0E-07
sp|P09958|FURIN_HUMAN Furin OS=Homo sapiens GN=FURIN PE=1 SV=2 155 340 1.0E-06
sp|P09231|KEX1A_KLULA Protease KEX1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=KEX1 PE=3 SV=2 137 352 1.0E-06
sp|Q9GLR0|NEC2_BOVIN Neuroendocrine convertase 2 OS=Bos taurus GN=PCSK2 PE=2 SV=1 53 252 1.0E-06
sp|Q04592|PCSK5_MOUSE Proprotein convertase subtilisin/kexin type 5 OS=Mus musculus GN=Pcsk5 PE=1 SV=3 113 340 1.0E-06
sp|P28842|SUBT_BACS9 Subtilisin OS=Bacillus sp. (strain TA39) GN=sub1 PE=1 SV=1 62 262 2.0E-06
sp|A1XIH4|SUB7_TRITO Subtilisin-like protease 7 OS=Trichophyton tonsurans GN=SUB7 PE=1 SV=1 160 316 2.0E-06
sp|P29143|HLY_NATA1 Halolysin OS=Natrialba asiatica (strain ATCC 700177 / DSM 12278 / JCM 9576 / FERM P-10747 / NBRC 102637 / 172P1) GN=hly PE=1 SV=1 162 313 3.0E-06
sp|Q9GLR1|NEC1_BOVIN Neuroendocrine convertase 1 OS=Bos taurus GN=PCSK1 PE=2 SV=1 156 328 3.0E-06
sp|Q9NJ15|PCSK5_BRACL Proprotein convertase subtilisin/kexin type 5 OS=Branchiostoma californiense GN=PC6 PE=2 SV=1 150 267 3.0E-06
sp|Q9FI12|SBT23_ARATH Subtilisin-like protease SBT2.3 OS=Arabidopsis thaliana GN=SBT2.3 PE=2 SV=1 158 591 4.0E-06
sp|L8FSM5|SUB2_PSED2 Subtilisin-like protease 2 OS=Pseudogymnoascus destructans (strain ATCC MYA-4855 / 20631-21) GN=SP2 PE=3 SV=1 144 341 4.0E-06
sp|P41363|ELYA_BACHD Thermostable alkaline protease OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=BH0855 PE=1 SV=2 151 338 5.0E-06
sp|Q64K31|SUB6_ARTBE Subtilisin-like protease 6 OS=Arthroderma benhamiae GN=SUB6 PE=3 SV=1 160 337 6.0E-06
sp|D4ALV9|SUB6_ARTBC Subtilisin-like protease 6 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=SUB6 PE=2 SV=1 160 337 6.0E-06
sp|A1XIH3|SUB7_TRIEQ Subtilisin-like protease 7 OS=Trichophyton equinum GN=SUB7 PE=1 SV=1 160 316 7.0E-06
sp|P63240|NEC1_MUSCO Neuroendocrine convertase 1 OS=Mus cookii GN=Pcsk1 PE=2 SV=1 156 328 8.0E-06
sp|P63239|NEC1_MOUSE Neuroendocrine convertase 1 OS=Mus musculus GN=Pcsk1 PE=1 SV=1 156 328 8.0E-06
sp|Q8J077|SUB6_TRISH Subtilisin-like protease 6 (Fragment) OS=Trichophyton schoenleinii GN=SUB6 PE=1 SV=1 14 337 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0004252 serine-type endopeptidase activity Yes
GO:0006508 proteolysis Yes
GO:0016020 membrane Yes
GO:0008236 serine-type peptidase activity Yes
GO:0005618 cell wall Yes
GO:0110165 cellular anatomical entity No
GO:0140096 catalytic activity, acting on a protein No
GO:0016787 hydrolase activity No
GO:0005575 cellular_component No
GO:1901564 organonitrogen compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0017171 serine hydrolase activity No
GO:0008150 biological_process No
GO:0019538 protein metabolic process No
GO:0008233 peptidase activity No
GO:0008152 metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0004175 endopeptidase activity No
GO:0044238 primary metabolic process No
GO:0003824 catalytic activity No
GO:0030312 external encapsulating structure No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|040360
MMKARTLLIFLLNIHLVLAAIKSISSVQHKSNLPTASNRFIVEVEDTSQIPPSERSTLSPHELLFEHLKARNVTF
NVTKQYKAEGLFVGASITLDNPQDVSALKSAPGVKDVRPVRQFSIPKPVSKYTVTGRNDPAIPPDTEGTHVATGV
DKLHAEGITGKGIKIGIIDSGVDYTHPSLGGGFGPGFKIVGGYDFVGDDYDGTNTPAPDDDPMDKCSGHGTHVAG
IIAADPGNEFNISGVAYEASLSMYRVFGCSGSVADDVLVDALLMAFIDEQDILTLSIGGTDGWTESISAVLTSRF
VEQGKVVTIAAGNDGIWGSWYTSSPGNGIDVISVASTDNYAIPLQNATVGGVKHDPITYLDTLPLPVNGTFPIYA
TSNSTTVEDDACNPLPDSTPDLSDMVVIIRNGSCTAVQKLTNAAAKGAQVVLIYDEFFTSMDLGSFTASIIQQAD
GEWLVQQFVAGTPVTLTFPQHGGSADFPNPFGGLISIFTSYGPSNDFYFKPAIATPGGNILSTLPDGTFGVASGT
SMATPFAAGSAALILQARGKDVELARGVRSLLESTGQKVPSTKIEGDPLQTVTQQGAGLVNVYDAVHAETIVMPT
ELIVNDTAHAEPKQSFSVLNAGKSSKEYILSHVPAGTALTVQADSIAPAPGPVPLSNSTATVSISPSKFTLGPGD
SQNVTAEIFGPTGLDRTTFPVYSGFIDIDDGSQSFHVVYLGLTGSLIDKQVIDDTDSFFGVNVPTIIDSEGNVQQ
GAMNYTFEGGDIPTLIWRQVFGSPRVVVDLVDRDIQINTTLNSRDVDNGARPFISFPTSTAPGSFAQVETIGSIL
EYNFVSRNSDNPNVNGYYSFAWETPTYANGTVVENGVYRLLLRALRVTGDVAKEEDYEVYLSSIVGVDT*
Coding >AgabiH97|040360
ATGATGAAGGCTCGAACGTTGCTTATCTTTTTGCTGAACATACATTTGGTGTTGGCCGCGATCAAATCCATTTCC
AGTGTCCAACACAAATCCAATCTCCCAACCGCAAGCAACAGATTTATTGTTGAAGTTGAGGATACATCCCAGATT
CCTCCCTCAGAGCGTTCTACTTTATCACCACACGAGCTTCTGTTTGAACATCTCAAAGCTCGGAATGTGACTTTC
AATGTTACGAAACAATATAAGGCTGAAGGCCTTTTTGTTGGGGCTTCAATCACGTTGGACAATCCTCAAGATGTT
TCTGCGTTAAAATCTGCACCAGGAGTGAAAGATGTCCGGCCCGTGCGGCAATTCAGTATCCCAAAACCTGTATCA
AAATATACCGTTACCGGTCGGAACGATCCTGCCATTCCACCTGACACTGAAGGTACTCACGTTGCTACGGGTGTT
GATAAACTTCATGCCGAGGGGATTACTGGTAAAGGAATCAAAATCGGCATCATTGACTCGGGTGTCGATTATACT
CATCCATCTCTTGGAGGTGGTTTTGGACCAGGGTTTAAAATCGTTGGTGGATATGATTTCGTCGGGGATGACTAC
GATGGTACGAATACTCCCGCACCTGACGATGATCCTATGGACAAATGTAGTGGACACGGCACACATGTAGCAGGC
ATCATTGCTGCTGACCCGGGGAATGAATTCAATATCAGCGGTGTGGCATACGAAGCGTCACTTTCTATGTATAGG
GTCTTTGGATGTTCTGGATCTGTCGCTGACGATGTTCTTGTGGATGCACTGTTAATGGCATTCATCGATGAACAA
GATATATTGACGTTATCAATTGGTGGGACCGATGGTTGGACCGAATCCATTTCAGCAGTTTTGACAAGTCGATTT
GTTGAGCAAGGAAAGGTTGTGACTATTGCTGCTGGAAACGATGGTATTTGGGGATCTTGGTATACGTCTAGCCCT
GGGAACGGTATCGACGTTATCTCTGTTGCTAGTACCGACAACTACGCTATTCCTCTTCAAAACGCAACCGTCGGT
GGAGTCAAACACGACCCGATAACTTATCTGGATACCCTCCCACTTCCTGTCAACGGTACCTTTCCTATATACGCT
ACTTCGAATTCAACTACAGTCGAAGACGACGCATGTAACCCACTCCCGGATTCGACACCGGATTTATCTGATATG
GTTGTGATCATTCGGAATGGGTCATGTACTGCTGTTCAAAAATTGACAAATGCAGCTGCGAAAGGAGCTCAAGTT
GTTTTGATCTATGACGAGTTTTTCACGTCGATGGATCTGGGATCTTTTACTGCTTCGATTATTCAACAAGCCGAC
GGTGAATGGCTTGTACAGCAATTTGTTGCTGGTACTCCTGTTACATTAACCTTTCCGCAACATGGAGGATCGGCC
GATTTTCCTAACCCATTCGGGGGCCTCATATCCATTTTTACCAGTTACGGACCCAGTAATGATTTCTACTTCAAA
CCCGCTATAGCGACGCCAGGTGGAAACATTCTTTCCACATTACCTGATGGTACATTTGGTGTTGCATCTGGAACA
TCCATGGCTACACCATTCGCTGCTGGCAGTGCTGCTCTGATTCTTCAAGCTCGAGGCAAGGATGTTGAACTTGCA
AGAGGCGTTCGTTCGTTATTGGAATCTACTGGACAGAAAGTGCCTTCTACTAAAATTGAAGGTGATCCATTACAA
ACGGTGACGCAACAAGGAGCTGGGTTGGTTAATGTTTATGATGCTGTGCATGCGGAGACGATTGTTATGCCGACG
GAGTTGATTGTGAATGATACTGCGCATGCTGAACCAAAGCAGAGCTTTAGTGTTTTGAATGCAGGAAAATCGTCA
AAGGAGTATATTCTTAGTCATGTTCCAGCTGGTACGGCTTTAACTGTCCAAGCTGACTCTATCGCCCCAGCGCCC
GGTCCAGTTCCTCTATCAAATTCCACAGCGACTGTATCTATCAGTCCCTCGAAATTCACTTTGGGACCTGGTGAT
TCGCAAAACGTGACTGCCGAGATTTTTGGACCTACTGGACTGGATAGGACAACCTTTCCGGTGTATTCTGGGTTT
ATTGATATTGATGATGGGAGTCAGAGTTTTCATGTTGTGTATCTTGGGTTGACTGGGTCGTTGATCGATAAACAA
GTGATTGACGATACTGATTCTTTTTTTGGTGTGAATGTTCCTACTATCATTGATAGTGAAGGGAATGTTCAGCAG
GGAGCTATGAATTATACATTTGAAGGTGGAGACATTCCGACATTAATTTGGCGACAAGTGTTTGGATCCCCGCGT
GTGGTAGTTGACCTTGTGGATCGGGATATTCAAATCAATACGACATTGAATAGTAGGGATGTCGACAACGGAGCA
AGACCATTTATTTCTTTCCCCACATCAACAGCACCGGGAAGTTTTGCTCAAGTGGAGACAATAGGATCTATATTA
GAGTATAATTTCGTTTCGCGGAACTCTGACAATCCTAATGTGAATGGGTATTATTCATTCGCCTGGGAGACGCCA
ACGTACGCGAATGGGACAGTGGTAGAGAATGGAGTGTATAGACTGCTCTTGCGAGCATTACGAGTTACGGGAGAT
GTGGCGAAAGAAGAGGATTACGAGGTTTACCTGAGCTCTATTGTTGGGGTTGATACTTAA
Transcript >AgabiH97|040360
ATGATGAAGGCTCGAACGTTGCTTATCTTTTTGCTGAACATACATTTGGTGTTGGCCGCGATCAAATCCATTTCC
AGTGTCCAACACAAATCCAATCTCCCAACCGCAAGCAACAGATTTATTGTTGAAGTTGAGGATACATCCCAGATT
CCTCCCTCAGAGCGTTCTACTTTATCACCACACGAGCTTCTGTTTGAACATCTCAAAGCTCGGAATGTGACTTTC
AATGTTACGAAACAATATAAGGCTGAAGGCCTTTTTGTTGGGGCTTCAATCACGTTGGACAATCCTCAAGATGTT
TCTGCGTTAAAATCTGCACCAGGAGTGAAAGATGTCCGGCCCGTGCGGCAATTCAGTATCCCAAAACCTGTATCA
AAATATACCGTTACCGGTCGGAACGATCCTGCCATTCCACCTGACACTGAAGGTACTCACGTTGCTACGGGTGTT
GATAAACTTCATGCCGAGGGGATTACTGGTAAAGGAATCAAAATCGGCATCATTGACTCGGGTGTCGATTATACT
CATCCATCTCTTGGAGGTGGTTTTGGACCAGGGTTTAAAATCGTTGGTGGATATGATTTCGTCGGGGATGACTAC
GATGGTACGAATACTCCCGCACCTGACGATGATCCTATGGACAAATGTAGTGGACACGGCACACATGTAGCAGGC
ATCATTGCTGCTGACCCGGGGAATGAATTCAATATCAGCGGTGTGGCATACGAAGCGTCACTTTCTATGTATAGG
GTCTTTGGATGTTCTGGATCTGTCGCTGACGATGTTCTTGTGGATGCACTGTTAATGGCATTCATCGATGAACAA
GATATATTGACGTTATCAATTGGTGGGACCGATGGTTGGACCGAATCCATTTCAGCAGTTTTGACAAGTCGATTT
GTTGAGCAAGGAAAGGTTGTGACTATTGCTGCTGGAAACGATGGTATTTGGGGATCTTGGTATACGTCTAGCCCT
GGGAACGGTATCGACGTTATCTCTGTTGCTAGTACCGACAACTACGCTATTCCTCTTCAAAACGCAACCGTCGGT
GGAGTCAAACACGACCCGATAACTTATCTGGATACCCTCCCACTTCCTGTCAACGGTACCTTTCCTATATACGCT
ACTTCGAATTCAACTACAGTCGAAGACGACGCATGTAACCCACTCCCGGATTCGACACCGGATTTATCTGATATG
GTTGTGATCATTCGGAATGGGTCATGTACTGCTGTTCAAAAATTGACAAATGCAGCTGCGAAAGGAGCTCAAGTT
GTTTTGATCTATGACGAGTTTTTCACGTCGATGGATCTGGGATCTTTTACTGCTTCGATTATTCAACAAGCCGAC
GGTGAATGGCTTGTACAGCAATTTGTTGCTGGTACTCCTGTTACATTAACCTTTCCGCAACATGGAGGATCGGCC
GATTTTCCTAACCCATTCGGGGGCCTCATATCCATTTTTACCAGTTACGGACCCAGTAATGATTTCTACTTCAAA
CCCGCTATAGCGACGCCAGGTGGAAACATTCTTTCCACATTACCTGATGGTACATTTGGTGTTGCATCTGGAACA
TCCATGGCTACACCATTCGCTGCTGGCAGTGCTGCTCTGATTCTTCAAGCTCGAGGCAAGGATGTTGAACTTGCA
AGAGGCGTTCGTTCGTTATTGGAATCTACTGGACAGAAAGTGCCTTCTACTAAAATTGAAGGTGATCCATTACAA
ACGGTGACGCAACAAGGAGCTGGGTTGGTTAATGTTTATGATGCTGTGCATGCGGAGACGATTGTTATGCCGACG
GAGTTGATTGTGAATGATACTGCGCATGCTGAACCAAAGCAGAGCTTTAGTGTTTTGAATGCAGGAAAATCGTCA
AAGGAGTATATTCTTAGTCATGTTCCAGCTGGTACGGCTTTAACTGTCCAAGCTGACTCTATCGCCCCAGCGCCC
GGTCCAGTTCCTCTATCAAATTCCACAGCGACTGTATCTATCAGTCCCTCGAAATTCACTTTGGGACCTGGTGAT
TCGCAAAACGTGACTGCCGAGATTTTTGGACCTACTGGACTGGATAGGACAACCTTTCCGGTGTATTCTGGGTTT
ATTGATATTGATGATGGGAGTCAGAGTTTTCATGTTGTGTATCTTGGGTTGACTGGGTCGTTGATCGATAAACAA
GTGATTGACGATACTGATTCTTTTTTTGGTGTGAATGTTCCTACTATCATTGATAGTGAAGGGAATGTTCAGCAG
GGAGCTATGAATTATACATTTGAAGGTGGAGACATTCCGACATTAATTTGGCGACAAGTGTTTGGATCCCCGCGT
GTGGTAGTTGACCTTGTGGATCGGGATATTCAAATCAATACGACATTGAATAGTAGGGATGTCGACAACGGAGCA
AGACCATTTATTTCTTTCCCCACATCAACAGCACCGGGAAGTTTTGCTCAAGTGGAGACAATAGGATCTATATTA
GAGTATAATTTCGTTTCGCGGAACTCTGACAATCCTAATGTGAATGGGTATTATTCATTCGCCTGGGAGACGCCA
ACGTACGCGAATGGGACAGTGGTAGAGAATGGAGTGTATAGACTGCTCTTGCGAGCATTACGAGTTACGGGAGAT
GTGGCGAAAGAAGAGGATTACGAGGTTTACCTGAGCTCTATTGTTGGGGTTGATACTTAA
Gene >AgabiH97|040360
ATGATGAAGGCTCGAACGTTGCTTATCTTTTTGCTGAACATACATTTGGTGTTGGCCGCGATCAAATCCATTTCC
AGTGTCCAACACAAATCCAATCTCCCAACCGCAAGCAACAGATTTATTGTTGAAGTTGAGGATACATCCCAGATT
CCTCCCTCAGAGCGTTCTACTTTATCAGTATGTGCCCTGGTTCTGGACCTTTGAAACTTGTACTCATGGATTTAT
TTGTAAAGCCACACGAGCTTCTGTTTGAACATCTCAAAGCTCGGAATGTGACTTTCAATGTTACGAAACAATATA
AGGCTGAAGGCCTTTTTGTTGGGGCTTCAATCACGTTGGACAATCCTCAAGTAAGCGATCGTATGCTCTTGTCTA
CCAACGAAGCTAAAAGAAATGAACCAAGGATGTTTCTGCGTTAAAATCTGCACCAGGAGTGAAAGATGTCCGGCC
CGTGCGGCAATTCAGTATCCCAAAGTATGTTCTCATCCTCGTATAAATATATAGGAACGGAGGTTTTTGCTAGAC
CTGTATCAAAATATACCGTTACCGGTCGGAACGATCCTGCCATTCCACCTGACACTGAAGGTACTCACGTTGCTA
CGGTGAGAACCTCCACTTGTTCATATCTAGTCTTCCTCTTACATTTTCTTATAGGGTGTTGATAAACTTCATGCC
GAGGGGATTACTGGTAAAGGAATCAAAATCGGCATGTAAGCAACCCATTCGATCCTTTTTTTTGCGCCTTTCTCT
CATCTCTCTTTTTTTTAGCATTGACTCGGGTATGAATGATTTATGATCTTCAAGAAATCTGGAAAGGGATTGAAT
GTTCTAGGTGTCGATTATACTCATCCATCTCTTGGAGGTGGTTTTGGACCAGGGTTTAAAATCGTTGGTGGATAT
GATTTCGTCGGGGATGACTACGATGGTCGATATAGACTCCCATAAATTTCATAAACCCAAATCTCACACATGCTC
CCCTTTACAGGTACGAATACTCCCGCACCTGACGATGATCCTATGGACAAATGTAGTGGACACGGCACACATGTA
GCAGTGAGTCTCCCTCTTGAAATTCCTCTACTTTCATTTTTTACATCTTTTTGGAACTACAGGGCATCATTGCTG
CTGACCCGGGGAATGAATTCAATATCAGCGGTGTGGCATACGAAGCGTCACTTTCTATGTATAGGGTCTTTGGAT
GTTCTGGATCTGTCGCTGACGATGGTACGTTGTCGTACATTTCTTTCCAAAGTAGCAGACACAAACAATTTTCAA
CTCGCGTGATTTTCTAGTTCTTGTGGATGCACTGTTAATGGCATTCATCGATGAACAAGATATATTGACGTTATC
AATTGGTGGGACCGATGGTTGGACCGAATCCATTTCAGCAGTTTTGACAAGTCGATTTGTTGAGCAAGGAAAGGT
TGTGACTATTGCTGCTGGAAACGATGTGAGTTTATAGATCCCTCCACCCACTCTATACCGGCACCGGTTATTGAC
TGAGGGTTTAGGGTATTTGGGGATCTTGGTATACGTCTAGCCCTGGGAACGGTATCGACGTTATCTCTGTTGCTA
GTACCGACAAGTAAGAACTTCAATGTCTCTTTTAGTCATACTATGAAACTGACAAATATTAAAGCTACGCTATTC
CTCTTCAAAACGCAACCGTCGGTGGAGTCAAACACGACCCGATAACTTATCTGGATACCCTCCCACTTCCTGTCA
ACGGTACCTTTCCTATATACGCTACTTCGAATTCAACTACAGTCGAAGACGACGCATGTAACCCACTCCCGGATT
CGACACCGGATTTATCTGATATGGTTGTGATCATTCGGAATGGGTCATGTACTGCTGTTCAAAAATTGACAAATG
CAGCTGCGAAAGGAGCTCAAGTTGTTTTGATCTATGAGTGAGTTTTGTGTTTGGGAATAGGTGATCTTGGTTGTC
GTTGATGCATGTGATTTTTGTAGCGAGTTTTTCACGTCGATGGATCTGGGATCTTTTACTGCTTCGATTATTCAA
CAAGCCGACGGTGAATGGGTGAGCTTGATTGTCCTAATTCATGTTCTTCTATCTTACGATTTTCTCGTAGCTTGT
ACAGCAATTTGTTGCTGGTACTCCTGTTACATTAACCTTTCCGCAACATGGAGGATCGGCCGATTTTCCTAACCC
ATTCGGGGGCCTCATATCCATTTTTACCAGGTACCCACTAAGTAATCCTAAAAAAACCACGCTTTTAACAGCAGT
ACAGTTACGGACCCAGTAATGATTTCTACTTCAAACCCGCTATAGCGACGCCAGGTGGAAACATTCTTTCCACAT
TACCTGATGGTACATTTGGTGTTGCATCTGGAACATCCATGGCTACACCATTCGCTGCTGGCAGTGCTGCTCTGA
TTCTTCAAGCTCGAGGCAAGGATGTTGAACTTGCAAGAGGCGTTCGTTCGTTATTGGAATCTACTGGACAGAAAG
TGCCTTCTACTAAAATTGAAGGTGATCCATTACAAACGGTGACGCAACAAGGAGCTGGGTTGGTTAATGTTTATG
ATGCTGTGCATGCGGAGACGATTGTTATGCCGACGGAGTTGATTGTGAATGATACTGCGCATGCTGAACCAAAGT
AGGTTTTGTGTGTGACACTATTTTTTTGGGGGAATTTTTTGATTATTATTGTTTAGGCAGAGCTTTAGTGTTTTG
AATGCAGGAAAATCGTCAAAGGAGTATATTCTTAGTCATGTTCCAGCTGGTACGGCTTTAACTGTCCAAGCTGAC
TCTATCGCCCCAGCGCCCGGTCCAGTTCCTCTATCAAATTCCACAGCGACTGTATCTATCAGTCCCTCGAAATTC
ACTTTGGGACCTGGTGATTCGCAAAACGTGACTGCCGAGATTTTTGGACCTACTGGACTGGATAGGACAACCTTT
CCGGTGTATTCTGGGTTTATTGATATTGATGATGGGAGTCAGAGTTTTCATGTTGTGTATCTTGGGTTGACTGGG
TCGTTGATCGATAAACAAGTGATTGACGATACTGATTCTTTTTTTGGTGTGAATGTTCCTACTATCATTGATAGT
GAAGGGAATGTTCAGCAGGGAGCTATGAATTATACATTTGAAGGTGGAGACATTCCGACATTAATTTGGCGGTGA
GTTGATTTGCTAACTTGTAAAAGACATGAATGCTAAAAACTTGTTTATAGACAAGTGTTTGGATCCCCGCGTGTG
GTAGTTGACCTTGTGGATCGGGATATTCAAATCAATACGACATTGAATAGTAGGGATGTCGACAACGGAGCAAGA
CCATTTATTTCTTTCCCCACATCAACAGCACCGGGAAGTTTTGCTCAAGTGGAGACAATAGGATCTATATTAGAG
TATAATTTCGTTTCGCGGAACTCTGACGTGAGTGAATATGAAGTTAGCGTAAGAGAGATTTTTTGAAAGCTAATA
ATCTGATTTGGAAAGAATCCTAATGTGAATGGGTATTATTCATTCGCCTGGGAGACGCCAACGTACGCGAATGGG
ACAGTGGTAGAGAATGGAGTGTATAGACTGCTCTTGCGAGCATTACGAGTTACGGGAGATGTGGCGAAAGAAGAG
GATTACGAGGTTTACCTGAGCTCTATTGTTGGGGTTGATACTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail