Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|040320
Gene name
Locationscaffold_2:477513..478724
Strand-
Gene length (bp)1211
Transcript length (bp)1110
Coding sequence length (bp)1110
Protein length (aa) 370

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 30 0.45

Transmembrane Domains

Domain # Start End Length
1 152 174 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 29.07 15.99 42.15
Initials Initials knots 25.90 14.01 37.78
Pileal_Stipeal_center Stage I stipe center 19.16 9.89 28.43
Pileal_Stipeal_shell Stage I stipe shell 28.30 15.30 41.30
DIF_stipe_center Stage II stipe center 21.26 11.19 31.32
DIF_stipe_shell Stage II stipe shell 14.30 7.15 21.46
DIF_stipe_skin Stage II stipe skin 14.76 7.37 22.16
DIF_cap_skin Stage II cap skin 27.06 14.66 39.47
DIF_cap_tissue Stage II cap tissue 36.83 20.82 52.84
DIF_gill_tissue Stage II gill tissue 33.18 18.46 47.90
YFB_stipe_center Young fruiting body stipe center 16.09 8.03 24.14
YFB_stipe_shell Young fruiting body stipe shell 14.53 7.26 21.81
YFB_stipe_skin Young fruiting body stipe skin 11.87 5.78 17.96
YFB_cap_skin Young fruiting body cap skin 11.10 5.35 16.85
YFB_cap_tissue Young fruiting body cap tissue 23.18 12.30 34.05
YFB_gill_tissue Young fruiting body gill tissue 15.47 7.81 23.13
YFB_veil Young fruiting body veil 19.54 10.20 28.89

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.790488 no
Casing YFB_stipe_center 0.068640 no
Casing YFB_stipe_shell 0.028675 yes
Casing YFB_stipe_skin 0.003365 yes
Casing YFB_cap_skin 0.002084 yes
Casing YFB_cap_tissue 0.601584 no
Casing YFB_gill_tissue 0.040723 yes
Casing YFB_veil 0.263795 no
Casing Initials 0.825138 no
Casing Pileal_Stipeal_center 0.247581 no
Casing Pileal_Stipeal_shell 0.964775 no
Casing DIF_stipe_center 0.406997 no
Casing DIF_stipe_shell 0.021322 yes
Casing DIF_stipe_skin 0.030372 yes
Casing DIF_cap_skin 0.900117 no
Casing DIF_cap_tissue 0.550526 no
DIF_gill_tissue YFB_stipe_center 0.017226 yes
DIF_gill_tissue YFB_stipe_shell 0.006742 yes
DIF_gill_tissue YFB_stipe_skin 0.000613 yes
DIF_gill_tissue YFB_cap_skin 0.001140 yes
DIF_gill_tissue YFB_cap_tissue 0.323876 no
DIF_gill_tissue YFB_gill_tissue 0.009773 yes
DIF_gill_tissue YFB_veil 0.100249 no
YFB_stipe_center YFB_stipe_shell 0.869625 no
YFB_stipe_center YFB_stipe_skin 0.485285 no
YFB_stipe_center YFB_cap_skin 0.378147 no
YFB_stipe_center YFB_cap_tissue 0.353531 no
YFB_stipe_center YFB_gill_tissue 0.954661 no
YFB_stipe_center YFB_veil 0.694456 no
YFB_stipe_shell YFB_stipe_skin 0.688376 no
YFB_stipe_shell YFB_cap_skin 0.570149 no
YFB_stipe_shell YFB_cap_tissue 0.199255 no
YFB_stipe_shell YFB_gill_tissue 0.924260 no
YFB_stipe_shell YFB_veil 0.490356 no
YFB_stipe_skin YFB_cap_skin 0.919172 no
YFB_stipe_skin YFB_cap_tissue 0.040947 yes
YFB_stipe_skin YFB_gill_tissue 0.547045 no
YFB_stipe_skin YFB_veil 0.154391 no
YFB_cap_skin YFB_cap_tissue 0.022369 yes
YFB_cap_skin YFB_gill_tissue 0.434333 no
YFB_cap_skin YFB_veil 0.106659 no
YFB_cap_tissue YFB_gill_tissue 0.267262 no
YFB_cap_tissue YFB_veil 0.729074 no
YFB_gill_tissue YFB_veil 0.601101 no
Initials DIF_gill_tissue 0.538350 no
Initials YFB_stipe_center 0.173213 no
Initials YFB_stipe_shell 0.080179 no
Initials YFB_stipe_skin 0.011968 yes
Initials YFB_cap_skin 0.009446 yes
Initials YFB_cap_tissue 0.840653 no
Initials YFB_gill_tissue 0.120972 no
Initials YFB_veil 0.484539 no
Initials Pileal_Stipeal_center 0.449640 no
Initials Pileal_Stipeal_shell 0.877533 no
Initials DIF_stipe_center 0.663271 no
Initials DIF_stipe_shell 0.068081 no
Initials DIF_stipe_skin 0.094323 no
Initials DIF_cap_skin 0.943101 no
Initials DIF_cap_tissue 0.311558 no
Pileal_Stipeal_center DIF_gill_tissue 0.092165 no
Pileal_Stipeal_center YFB_stipe_center 0.734338 no
Pileal_Stipeal_center YFB_stipe_shell 0.528175 no
Pileal_Stipeal_center YFB_stipe_skin 0.184329 no
Pileal_Stipeal_center YFB_cap_skin 0.135591 no
Pileal_Stipeal_center YFB_cap_tissue 0.700081 no
Pileal_Stipeal_center YFB_gill_tissue 0.654695 no
Pileal_Stipeal_center YFB_veil 0.977071 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.289965 no
Pileal_Stipeal_center DIF_stipe_center 0.859259 no
Pileal_Stipeal_center DIF_stipe_shell 0.496016 no
Pileal_Stipeal_center DIF_stipe_skin 0.569705 no
Pileal_Stipeal_center DIF_cap_skin 0.365398 no
Pileal_Stipeal_center DIF_cap_tissue 0.033444 yes
Pileal_Stipeal_shell DIF_gill_tissue 0.740753 no
Pileal_Stipeal_shell YFB_stipe_center 0.091998 no
Pileal_Stipeal_shell YFB_stipe_shell 0.041824 yes
Pileal_Stipeal_shell YFB_stipe_skin 0.005302 yes
Pileal_Stipeal_shell YFB_cap_skin 0.003765 yes
Pileal_Stipeal_shell YFB_cap_tissue 0.668205 no
Pileal_Stipeal_shell YFB_gill_tissue 0.058926 no
Pileal_Stipeal_shell YFB_veil 0.320555 no
Pileal_Stipeal_shell DIF_stipe_center 0.472029 no
Pileal_Stipeal_shell DIF_stipe_shell 0.032978 yes
Pileal_Stipeal_shell DIF_stipe_skin 0.046327 yes
Pileal_Stipeal_shell DIF_cap_skin 0.941882 no
Pileal_Stipeal_shell DIF_cap_tissue 0.501820 no
DIF_stipe_center DIF_gill_tissue 0.176682 no
DIF_stipe_center YFB_stipe_center 0.513267 no
DIF_stipe_center YFB_stipe_shell 0.317155 no
DIF_stipe_center YFB_stipe_skin 0.075908 no
DIF_stipe_center YFB_cap_skin 0.056760 no
DIF_stipe_center YFB_cap_tissue 0.884771 no
DIF_stipe_center YFB_gill_tissue 0.428971 no
DIF_stipe_center YFB_veil 0.887400 no
DIF_stipe_center DIF_stipe_shell 0.291240 no
DIF_stipe_center DIF_stipe_skin 0.354048 no
DIF_stipe_center DIF_cap_skin 0.567498 no
DIF_stipe_center DIF_cap_tissue 0.067896 no
DIF_stipe_shell DIF_gill_tissue 0.006387 yes
DIF_stipe_shell YFB_stipe_center 0.843211 no
DIF_stipe_shell YFB_stipe_shell 0.981565 no
DIF_stipe_shell YFB_stipe_skin 0.718377 no
DIF_stipe_shell YFB_cap_skin 0.597930 no
DIF_stipe_shell YFB_cap_tissue 0.176182 no
DIF_stipe_shell YFB_gill_tissue 0.901232 no
DIF_stipe_shell YFB_veil 0.455342 no
DIF_stipe_shell DIF_stipe_skin 0.965732 no
DIF_stipe_shell DIF_cap_skin 0.050706 no
DIF_stipe_shell DIF_cap_tissue 0.001625 yes
DIF_stipe_skin DIF_gill_tissue 0.008121 yes
DIF_stipe_skin YFB_stipe_center 0.892019 no
DIF_stipe_skin YFB_stipe_shell 0.981129 no
DIF_stipe_skin YFB_stipe_skin 0.653857 no
DIF_stipe_skin YFB_cap_skin 0.536081 no
DIF_stipe_skin YFB_cap_tissue 0.218856 no
DIF_stipe_skin YFB_gill_tissue 0.943362 no
DIF_stipe_skin YFB_veil 0.516827 no
DIF_stipe_skin DIF_cap_skin 0.065086 no
DIF_stipe_skin DIF_cap_tissue 0.000613 yes
DIF_cap_skin DIF_gill_tissue 0.639885 no
DIF_cap_skin YFB_stipe_center 0.121880 no
DIF_cap_skin YFB_stipe_shell 0.056958 no
DIF_cap_skin YFB_stipe_skin 0.009446 yes
DIF_cap_skin YFB_cap_skin 0.004928 yes
DIF_cap_skin YFB_cap_tissue 0.759934 no
DIF_cap_skin YFB_gill_tissue 0.085220 no
DIF_cap_skin YFB_veil 0.395351 no
DIF_cap_skin DIF_cap_tissue 0.400613 no
DIF_cap_tissue DIF_gill_tissue 0.842540 no
DIF_cap_tissue YFB_stipe_center 0.005302 yes
DIF_cap_tissue YFB_stipe_shell 0.002525 yes
DIF_cap_tissue YFB_stipe_skin 0.000613 yes
DIF_cap_tissue YFB_cap_skin 0.000613 yes
DIF_cap_tissue YFB_cap_tissue 0.157303 no
DIF_cap_tissue YFB_gill_tissue 0.001625 yes
DIF_cap_tissue YFB_veil 0.036683 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|040320
MYSMPPSTISSGPAALFVLLQLQAWTARASLIRRQDGDSDSDSDSDSDSDSESCQNNVCVKESCSRGVCTTVTST
KGVKGGAAGPTPTNGGASGTAGVTQTPPPAPAPDATSHTKGHQQSSQSSTDSLSAGPSQQTNASGLSNNSDGLSK
GGIAGIVLAIAFLIGLLIMCLTAYRNRRRRAQTKPQGFVPATFLNGPPATHSNTPNNNNEMSPVEFANRSPVTAA
TRMSRNLRGSADNNYNTSPTSPALAPLLPGIASGYEGRERPLPPSRGINQHNHTRSLSRGDNGSILTSPYSDHHH
TSIFVDAPLPPLPHEADRAGGSSIPAGTLHSDIRAYQKALEADNTKRTEAAMASQEPSRDPPPSYFPMR*
Coding >AgabiH97|040320
ATGTACTCAATGCCGCCCTCCACAATCTCCTCGGGACCCGCAGCTTTGTTCGTGCTGTTGCAACTCCAAGCATGG
ACCGCTCGTGCCAGCCTTATTCGTCGCCAAGATGGTGATTCCGACTCCGACAGTGATTCAGACTCGGACTCGGAC
AGCGAATCTTGTCAAAACAACGTTTGTGTTAAAGAATCGTGCAGTCGTGGTGTCTGTACAACGGTTACCAGTACC
AAAGGTGTCAAAGGTGGTGCAGCCGGTCCAACCCCAACGAATGGGGGGGCTTCGGGAACGGCTGGGGTAACGCAG
ACCCCACCTCCAGCTCCAGCCCCAGATGCTACGTCCCATACAAAAGGCCATCAGCAAAGTTCACAAAGTTCAACG
GACAGTCTATCAGCGGGACCTTCTCAACAAACTAACGCTTCGGGTCTCTCCAATAACTCCGATGGTCTCAGCAAA
GGTGGAATTGCCGGTATAGTTCTTGCCATCGCGTTTCTTATTGGTCTGTTAATTATGTGCCTCACTGCGTATCGC
AATCGCCGAAGACGAGCTCAAACAAAACCCCAAGGTTTCGTTCCTGCTACTTTCCTCAATGGGCCTCCTGCTACT
CATAGCAACACACCGAATAACAATAATGAGATGTCCCCAGTTGAGTTCGCAAACAGATCCCCTGTTACAGCGGCC
ACGCGCATGAGCCGTAACCTTCGTGGCAGCGCCGATAACAACTACAACACTAGTCCGACATCACCCGCGCTTGCA
CCTCTCTTACCTGGCATAGCATCGGGTTATGAGGGAAGAGAAAGACCTCTACCTCCGAGTCGTGGCATCAACCAA
CACAACCACACTCGTTCACTCTCGCGAGGCGATAACGGTTCAATCCTCACCTCACCCTATTCTGATCATCATCAT
ACGAGCATCTTTGTTGACGCACCTCTACCACCATTACCCCACGAAGCTGATCGTGCGGGTGGAAGTAGCATTCCC
GCCGGAACACTTCATTCTGACATACGAGCGTACCAGAAAGCTTTAGAAGCCGACAACACTAAACGAACAGAGGCT
GCCATGGCCTCACAAGAACCCAGTAGAGATCCTCCGCCATCATACTTCCCTATGCGATGA
Transcript >AgabiH97|040320
ATGTACTCAATGCCGCCCTCCACAATCTCCTCGGGACCCGCAGCTTTGTTCGTGCTGTTGCAACTCCAAGCATGG
ACCGCTCGTGCCAGCCTTATTCGTCGCCAAGATGGTGATTCCGACTCCGACAGTGATTCAGACTCGGACTCGGAC
AGCGAATCTTGTCAAAACAACGTTTGTGTTAAAGAATCGTGCAGTCGTGGTGTCTGTACAACGGTTACCAGTACC
AAAGGTGTCAAAGGTGGTGCAGCCGGTCCAACCCCAACGAATGGGGGGGCTTCGGGAACGGCTGGGGTAACGCAG
ACCCCACCTCCAGCTCCAGCCCCAGATGCTACGTCCCATACAAAAGGCCATCAGCAAAGTTCACAAAGTTCAACG
GACAGTCTATCAGCGGGACCTTCTCAACAAACTAACGCTTCGGGTCTCTCCAATAACTCCGATGGTCTCAGCAAA
GGTGGAATTGCCGGTATAGTTCTTGCCATCGCGTTTCTTATTGGTCTGTTAATTATGTGCCTCACTGCGTATCGC
AATCGCCGAAGACGAGCTCAAACAAAACCCCAAGGTTTCGTTCCTGCTACTTTCCTCAATGGGCCTCCTGCTACT
CATAGCAACACACCGAATAACAATAATGAGATGTCCCCAGTTGAGTTCGCAAACAGATCCCCTGTTACAGCGGCC
ACGCGCATGAGCCGTAACCTTCGTGGCAGCGCCGATAACAACTACAACACTAGTCCGACATCACCCGCGCTTGCA
CCTCTCTTACCTGGCATAGCATCGGGTTATGAGGGAAGAGAAAGACCTCTACCTCCGAGTCGTGGCATCAACCAA
CACAACCACACTCGTTCACTCTCGCGAGGCGATAACGGTTCAATCCTCACCTCACCCTATTCTGATCATCATCAT
ACGAGCATCTTTGTTGACGCACCTCTACCACCATTACCCCACGAAGCTGATCGTGCGGGTGGAAGTAGCATTCCC
GCCGGAACACTTCATTCTGACATACGAGCGTACCAGAAAGCTTTAGAAGCCGACAACACTAAACGAACAGAGGCT
GCCATGGCCTCACAAGAACCCAGTAGAGATCCTCCGCCATCATACTTCCCTATGCGATGA
Gene >AgabiH97|040320
ATGTACTCAATGCCGCCCTCCACAATCTCCTCGGGACCCGCAGCTTTGTTCGTGCTGTTGCAACTCCAAGCATGG
ACCGCTCGTGCCAGCCTTATTCGGTGCGTTAATACAACCACGCAGTATTACGCCAACTAAAAATTTTCGATAAGT
CGCCAAGATGGTGATTCCGACTCCGACAGTGATTCAGACTCGGACTCGGACAGCGAATCTTGTCAAAACAACGTT
TGTGTTAAAGAATCGTGCAGTCGTGGTGTCTGTACAACGGTTACCAGTACCAAAGGTGTCAAAGGTGGTGCAGCC
GGTCCAACCCCAACGAATGGGGGGGCTTCGGGAACGGCTGGGGTAACGCAGACCCCACCTCCAGCTCCAGCCCCA
GATGCTACGTCCCATACAAAAGGCCATCAGCAAAGTTCACAAAGTTCAACGGACAGTCTATCAGCGGGACCTTCT
CAACAAACTAACGCTTCGGGTCTCTCCAATAACTCCGATGGTCTCAGCAAAGGTGGAATTGCCGGTATAGTTCTT
GCCATCGGTGAGTATTTCTCCCCTTAACGCTGAGTTCTACTTCATCTCGCCACTCAGCGTTTCTTATTGGTCTGT
TAATTATGTGCCTCACTGCGTATCGCAATCGCCGAAGACGAGCTCAAACAAAACCCCAAGGTTTCGTTCCTGCTA
CTTTCCTCAATGGGCCTCCTGCTACTCATAGCAACACACCGAATAACAATAATGAGATGTCCCCAGTTGAGTTCG
CAAACAGATCCCCTGTTACAGCGGCCACGCGCATGAGCCGTAACCTTCGTGGCAGCGCCGATAACAACTACAACA
CTAGTCCGACATCACCCGCGCTTGCACCTCTCTTACCTGGCATAGCATCGGGTTATGAGGGAAGAGAAAGACCTC
TACCTCCGAGTCGTGGCATCAACCAACACAACCACACTCGTTCACTCTCGCGAGGCGATAACGGTTCAATCCTCA
CCTCACCCTATTCTGATCATCATCATACGAGCATCTTTGTTGACGCACCTCTACCACCATTACCCCACGAAGCTG
ATCGTGCGGGTGGAAGTAGCATTCCCGCCGGAACACTTCATTCTGACATACGAGCGTACCAGAAAGCTTTAGAAG
CCGACAACACTAAACGAACAGAGGCTGCCATGGCCTCACAAGAACCCAGTAGAGATCCTCCGCCATCATACTTCC
CTATGCGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail