Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|040260
Gene name
Locationscaffold_2:462215..465910
Strand+
Gene length (bp)3695
Transcript length (bp)2706
Coding sequence length (bp)2706
Protein length (aa) 902

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00082 Peptidase_S8 Subtilase family 3.0E-44 165 568
PF06280 fn3_5 Fn3-like domain 2.9E-14 612 716
PF02225 PA PA domain 3.5E-07 386 457

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P29141|SUBV_BACSU Minor extracellular protease vpr OS=Bacillus subtilis (strain 168) GN=vpr PE=1 SV=1 37 647 1.0E-51
sp|P15293|P2P_LACLC PII-type proteinase OS=Lactococcus lactis subsp. cremoris GN=prt PE=3 SV=1 165 735 4.0E-26
sp|P16271|P1P_LACLC PI-type proteinase OS=Lactococcus lactis subsp. cremoris GN=prtP PE=3 SV=1 165 735 1.0E-24
sp|Q02470|P2P_LACPA PII-type proteinase OS=Lactobacillus paracasei GN=prtP PE=1 SV=1 165 735 2.0E-24
sp|P15292|P3P_LACLS PIII-type proteinase OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=prtP PE=1 SV=2 165 735 2.0E-23
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P29141|SUBV_BACSU Minor extracellular protease vpr OS=Bacillus subtilis (strain 168) GN=vpr PE=1 SV=1 37 647 1.0E-51
sp|P15293|P2P_LACLC PII-type proteinase OS=Lactococcus lactis subsp. cremoris GN=prt PE=3 SV=1 165 735 4.0E-26
sp|P16271|P1P_LACLC PI-type proteinase OS=Lactococcus lactis subsp. cremoris GN=prtP PE=3 SV=1 165 735 1.0E-24
sp|Q02470|P2P_LACPA PII-type proteinase OS=Lactobacillus paracasei GN=prtP PE=1 SV=1 165 735 2.0E-24
sp|P15292|P3P_LACLS PIII-type proteinase OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=prtP PE=1 SV=2 165 735 2.0E-23
sp|P00781|SUBD_BACLI Subtilisin DY OS=Bacillus licheniformis GN=apr PE=1 SV=1 156 410 9.0E-19
sp|Q8NZ80|C5AP_STRP8 C5a peptidase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=scpA PE=3 SV=1 94 605 2.0E-17
sp|P0DD35|C5AP_STRPQ C5a peptidase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=scpA PE=3 SV=1 149 605 2.0E-17
sp|P0DD34|C5AP_STRP3 C5a peptidase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=scpA PE=3 SV=1 149 605 2.0E-17
sp|P58099|C5AP_STRP1 C5a peptidase OS=Streptococcus pyogenes serotype M1 GN=scpA PE=3 SV=1 155 605 4.0E-17
sp|Q5X9R0|C5AP_STRP6 C5a peptidase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=scpA PE=3 SV=1 99 605 1.0E-16
sp|P15926|C5AP_STRPY C5a peptidase OS=Streptococcus pyogenes GN=scpA PE=1 SV=1 99 605 2.0E-16
sp|Q45670|THES_BACSJ Thermophilic serine proteinase OS=Bacillus sp. (strain AK1) PE=1 SV=1 167 377 5.0E-16
sp|P42780|BPRX_DICNO Extracellular subtilisin-like protease OS=Dichelobacter nodosus PE=3 SV=1 156 341 9.0E-15
sp|P04189|SUBT_BACSU Subtilisin E OS=Bacillus subtilis (strain 168) GN=aprE PE=1 SV=3 2 324 1.0E-14
sp|P35835|SUBN_BACNA Subtilisin NAT OS=Bacillus subtilis subsp. natto GN=aprN PE=1 SV=1 2 324 1.0E-14
sp|P29139|ISP_PAEPO Intracellular serine protease OS=Paenibacillus polymyxa GN=isp PE=1 SV=1 142 343 2.0E-14
sp|P11018|ISP1_BACSU Major intracellular serine protease OS=Bacillus subtilis (strain 168) GN=isp PE=1 SV=2 157 342 2.0E-14
sp|P07518|SUBT_BACPU Subtilisin OS=Bacillus pumilus GN=apr PE=1 SV=1 158 324 4.0E-14
sp|P42779|BPRV_DICNO Extracellular basic protease OS=Dichelobacter nodosus GN=bprV PE=1 SV=1 156 341 9.0E-13
sp|P00780|SUBT_BACLI Subtilisin Carlsberg OS=Bacillus licheniformis GN=apr PE=1 SV=1 122 417 3.0E-12
sp|P29142|SUBT_GEOSE Subtilisin J OS=Geobacillus stearothermophilus GN=aprJ PE=3 SV=1 2 319 3.0E-12
sp|P00783|SUBT_BACSA Subtilisin amylosacchariticus OS=Bacillus subtilis subsp. amylosacchariticus GN=apr PE=1 SV=2 2 319 5.0E-12
sp|P00782|SUBT_BACAM Subtilisin BPN' OS=Bacillus amyloliquefaciens GN=apr PE=1 SV=1 158 345 7.0E-12
sp|P04072|THET_THEVU Thermitase OS=Thermoactinomyces vulgaris PE=1 SV=1 165 292 2.0E-11
sp|P23314|EXPR_XANCP Extracellular protease OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=XCC0851 PE=3 SV=1 7 341 3.0E-11
sp|I3R794|HLY_HALMT Halolysin OS=Haloferax mediterranei (strain ATCC 33500 / DSM 1411 / JCM 8866 / NBRC 14739 / NCIMB 2177 / R-4) GN=hly PE=1 SV=1 168 343 3.0E-11
sp|F4HSQ2|SBT51_ARATH Subtilisin-like protease SBT5.1 OS=Arabidopsis thaliana GN=SBT5.1 PE=3 SV=1 223 595 3.0E-10
sp|Q8L7I2|SBT36_ARATH Subtilisin-like protease SBT3.6 OS=Arabidopsis thaliana GN=SBT3.6 PE=2 SV=1 4 593 4.0E-10
sp|Q9LNU1|CRSP_ARATH CO(2)-response secreted protease OS=Arabidopsis thaliana GN=CRSP PE=2 SV=1 170 546 4.0E-10
sp|Q9FLI4|SBT13_ARATH Subtilisin-like protease SBT1.3 OS=Arabidopsis thaliana GN=SBT1.3 PE=2 SV=1 156 568 8.0E-10
sp|P29599|SUBB_BACLE Subtilisin BL OS=Bacillus lentus PE=1 SV=1 159 343 8.0E-10
sp|P23377|FURIN_RAT Furin OS=Rattus norvegicus GN=Furin PE=1 SV=1 108 333 2.0E-09
sp|P27693|ELYA_BACAO Alkaline protease OS=Bacillus alcalophilus PE=1 SV=1 139 343 1.0E-08
sp|P23188|FURIN_MOUSE Furin OS=Mus musculus GN=Furin PE=1 SV=2 108 333 1.0E-08
sp|P80146|SEPR_THESR Extracellular serine proteinase OS=Thermus sp. (strain Rt41A) PE=1 SV=3 22 345 1.0E-08
sp|Q9FI12|SBT23_ARATH Subtilisin-like protease SBT2.3 OS=Arabidopsis thaliana GN=SBT2.3 PE=2 SV=1 163 598 1.0E-08
sp|P28840|NEC1_RAT Neuroendocrine convertase 1 OS=Rattus norvegicus GN=Pcsk1 PE=2 SV=1 161 333 1.0E-08
sp|P41362|ELYA_BACCS Alkaline protease OS=Bacillus clausii PE=1 SV=1 139 343 2.0E-08
sp|P29120|NEC1_HUMAN Neuroendocrine convertase 1 OS=Homo sapiens GN=PCSK1 PE=1 SV=2 161 333 2.0E-08
sp|A1XIH0|SUB6_TRIEQ Subtilisin-like protease 6 OS=Trichophyton equinum GN=SUB6 PE=1 SV=1 27 341 2.0E-08
sp|P13134|KEX2_YEAST Kexin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KEX2 PE=1 SV=1 122 359 2.0E-08
sp|Q9GLR1|NEC1_BOVIN Neuroendocrine convertase 1 OS=Bos taurus GN=PCSK1 PE=2 SV=1 161 333 3.0E-08
sp|P16396|SUBE_BACSU Minor extracellular protease Epr OS=Bacillus subtilis (strain 168) GN=epr PE=2 SV=1 162 320 3.0E-08
sp|P29600|SUBS_BACLE Subtilisin Savinase OS=Bacillus lentus PE=1 SV=1 159 343 3.0E-08
sp|Q28193|FURIN_BOVIN Furin OS=Bos taurus GN=FURIN PE=1 SV=1 59 333 3.0E-08
sp|O65351|SBT17_ARATH Subtilisin-like protease SBT1.7 OS=Arabidopsis thaliana GN=SBT1.7 PE=1 SV=1 46 581 4.0E-08
sp|Q9C7U8|SBT3H_ARATH Subtilisin-like protease SBT3.17 OS=Arabidopsis thaliana GN=SBT3.17 PE=3 SV=1 223 623 4.0E-08
sp|O64495|SBT12_ARATH Subtilisin-like protease SBT1.2 OS=Arabidopsis thaliana GN=SBT1.2 PE=2 SV=1 137 599 4.0E-08
sp|P09958|FURIN_HUMAN Furin OS=Homo sapiens GN=FURIN PE=1 SV=2 108 333 4.0E-08
sp|Q99405|PRTM_BACSK M-protease OS=Bacillus clausii (strain KSM-K16) GN=aprE PE=1 SV=2 159 343 5.0E-08
sp|Q9FHA4|SBT19_ARATH Subtilisin-like protease SBT1.9 OS=Arabidopsis thaliana GN=SBT1.9 PE=2 SV=1 165 548 5.0E-08
sp|F4JXC5|SBT54_ARATH Subtilisin-like protease SBT5.4 OS=Arabidopsis thaliana GN=SBT5.4 PE=1 SV=1 212 546 7.0E-08
sp|Q0WUG6|SBT61_ARATH Subtilisin-like protease SBT6.1 OS=Arabidopsis thaliana GN=SBT6.1 PE=1 SV=1 152 344 9.0E-08
sp|P63240|NEC1_MUSCO Neuroendocrine convertase 1 OS=Mus cookii GN=Pcsk1 PE=2 SV=1 62 333 1.0E-07
sp|P63239|NEC1_MOUSE Neuroendocrine convertase 1 OS=Mus musculus GN=Pcsk1 PE=1 SV=1 62 333 1.0E-07
sp|G3X9R7|RN148_MOUSE RING finger protein 148 OS=Mus musculus GN=Rnf148 PE=2 SV=1 389 520 1.0E-07
sp|Q3ZEJ8|SUB6_TRITO Subtilisin-like protease 6 OS=Trichophyton tonsurans GN=SUB6 PE=3 SV=1 27 341 2.0E-07
sp|L8G6I7|SUB1_PSED2 Subtilisin-like protease 1 OS=Pseudogymnoascus destructans (strain ATCC MYA-4855 / 20631-21) GN=SP1 PE=1 SV=1 74 357 2.0E-07
sp|Q64K31|SUB6_ARTBE Subtilisin-like protease 6 OS=Arthroderma benhamiae GN=SUB6 PE=3 SV=1 165 341 2.0E-07
sp|D4ALV9|SUB6_ARTBC Subtilisin-like protease 6 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=SUB6 PE=2 SV=1 165 341 2.0E-07
sp|P30432|FUR2_DROME Furin-like protease 2 OS=Drosophila melanogaster GN=Fur2 PE=2 SV=2 161 343 3.0E-07
sp|Q8GUK4|SBT3D_ARATH Subtilisin-like protease SBT3.13 OS=Arabidopsis thaliana GN=SBT3.13 PE=2 SV=1 66 593 3.0E-07
sp|Q9SZY3|SBT38_ARATH Subtilisin-like protease SBT3.8 OS=Arabidopsis thaliana GN=SBT3.8 PE=3 SV=1 165 593 3.0E-07
sp|F4HPF1|SBT34_ARATH Subtilisin-like protease SBT3.4 OS=Arabidopsis thaliana GN=SBT3.4 PE=3 SV=1 165 593 3.0E-07
sp|P72186|PLS_PYRFU Pyrolysin OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=pls PE=1 SV=2 466 594 4.0E-07
sp|C5PGK9|SUB7A_COCP7 Subtilisin-like protease CPC735_050320 OS=Coccidioides posadasii (strain C735) GN=CPC735_050320 PE=3 SV=1 27 319 5.0E-07
sp|P16588|PROA_VIBAL Alkaline serine exoprotease A OS=Vibrio alginolyticus GN=proA PE=3 SV=1 139 343 6.0E-07
sp|Q78EH2|PCSK4_RAT Proprotein convertase subtilisin/kexin type 4 OS=Rattus norvegicus GN=Pcsk4 PE=2 SV=1 157 333 6.0E-07
sp|Q8J077|SUB6_TRISH Subtilisin-like protease 6 (Fragment) OS=Trichophyton schoenleinii GN=SUB6 PE=1 SV=1 36 341 7.0E-07
sp|E4UPZ4|SUB1_ARTGP Subtilisin-like protease 1 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=SUB1 PE=3 SV=1 42 341 7.0E-07
sp|P29121|PCSK4_MOUSE Proprotein convertase subtilisin/kexin type 4 OS=Mus musculus GN=Pcsk4 PE=2 SV=1 157 390 8.0E-07
sp|O49607|SBT16_ARATH Subtilisin-like protease SBT1.6 OS=Arabidopsis thaliana GN=SBT1.6 PE=2 SV=1 223 546 8.0E-07
sp|A1XIH4|SUB7_TRITO Subtilisin-like protease 7 OS=Trichophyton tonsurans GN=SUB7 PE=1 SV=1 165 319 1.0E-06
sp|C5FQI3|SUB6_ARTOC Subtilisin-like protease 6 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SUB6 PE=3 SV=1 165 351 2.0E-06
sp|P29146|NECA_HYDVU PC3-like endoprotease variant A OS=Hydra vulgaris PE=2 SV=1 161 290 2.0E-06
sp|P00782|SUBT_BACAM Subtilisin BPN' OS=Bacillus amyloliquefaciens GN=apr PE=1 SV=1 493 594 2.0E-06
sp|P04072|THET_THEVU Thermitase OS=Thermoactinomyces vulgaris PE=1 SV=1 493 599 2.0E-06
sp|P07518|SUBT_BACPU Subtilisin OS=Bacillus pumilus GN=apr PE=1 SV=1 493 574 3.0E-06
sp|Q84WS0|SBT11_ARATH Subtilisin-like protease SBT1.1 OS=Arabidopsis thaliana GN=SBTI1.1 PE=1 SV=1 223 551 3.0E-06
sp|A1XIH3|SUB7_TRIEQ Subtilisin-like protease 7 OS=Trichophyton equinum GN=SUB7 PE=1 SV=1 165 319 3.0E-06
sp|Q9FIG1|SBT4B_ARATH Subtilisin-like protease SBT4.11 OS=Arabidopsis thaliana GN=SBT4.11 PE=2 SV=2 170 546 3.0E-06
sp|P29145|NECB_HYDVU PC3-like endoprotease variant B OS=Hydra vulgaris PE=2 SV=1 161 290 3.0E-06
sp|Q9LLL8|SBT4E_ARATH Subtilisin-like protease SBT4.14 OS=Arabidopsis thaliana GN=SBT4.14 PE=2 SV=1 152 546 4.0E-06
sp|Q07596|NISP_LACLL Nisin leader peptide-processing serine protease NisP OS=Lactococcus lactis subsp. lactis GN=nisP PE=1 SV=1 166 288 4.0E-06
sp|P26016|FUR11_DROME Furin-like protease 1, isoforms 1/1-X/2 OS=Drosophila melanogaster GN=Fur1 PE=2 SV=2 162 304 5.0E-06
sp|P35835|SUBN_BACNA Subtilisin NAT OS=Bacillus subtilis subsp. natto GN=aprN PE=1 SV=1 493 574 7.0E-06
sp|Q9ZUF6|SBT18_ARATH Subtilisin-like protease SBT1.8 OS=Arabidopsis thaliana GN=SBT1.8 PE=2 SV=1 158 546 7.0E-06
sp|Q9SZY2|SBT37_ARATH Subtilisin-like protease SBT3.7 OS=Arabidopsis thaliana GN=SBT3.7 PE=3 SV=2 165 593 7.0E-06
sp|P00783|SUBT_BACSA Subtilisin amylosacchariticus OS=Bacillus subtilis subsp. amylosacchariticus GN=apr PE=1 SV=2 493 594 8.0E-06
sp|P29142|SUBT_GEOSE Subtilisin J OS=Geobacillus stearothermophilus GN=aprJ PE=3 SV=1 493 594 8.0E-06
sp|P20724|ELYA_BACYA Alkaline elastase YaB OS=Bacillus sp. (strain YaB) GN=ale PE=1 SV=1 139 343 8.0E-06
sp|P30430|FUR1C_DROME Furin-like protease 1, isoform 1-CRR OS=Drosophila melanogaster GN=Fur1 PE=2 SV=2 162 291 9.0E-06
sp|P04189|SUBT_BACSU Subtilisin E OS=Bacillus subtilis (strain 168) GN=aprE PE=1 SV=3 493 574 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0004252 serine-type endopeptidase activity Yes
GO:0006508 proteolysis Yes
GO:0016020 membrane Yes
GO:0008236 serine-type peptidase activity Yes
GO:0005618 cell wall Yes
GO:0110165 cellular anatomical entity No
GO:0140096 catalytic activity, acting on a protein No
GO:0016787 hydrolase activity No
GO:0005575 cellular_component No
GO:1901564 organonitrogen compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0017171 serine hydrolase activity No
GO:0008150 biological_process No
GO:0019538 protein metabolic process No
GO:0008233 peptidase activity No
GO:0008152 metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0004175 endopeptidase activity No
GO:0044238 primary metabolic process No
GO:0003824 catalytic activity No
GO:0030312 external encapsulating structure No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|040260
MKSLVLSLVWLLNVYPTFAAIASISDIPLKSLNLPTVSNKFIIEVDEAANIPPSATERFTESLSVHDFVFENLKR
RDVNLNITKRYNVKGVFVGAAITLDNPQDVAAIRQVPGIKDIRPVQKFNIPKPVFKHVVTGPDDPAIPPDSESTH
IMTGVDKLHAEGITGEGIKIGILDTGVDYNHPSLGGGFGPGFKFVGGFDFVGDDYDGTNAPIPDDDPLDICAGHG
SHVSGIVGADPGNEFGISGVAYDATFSMYRVFGCVGFVTDDVLVEALLMGFQDGQDILTLSLGGPDGWTESSSSV
VASRLVEQGMVVTISAGNDGASGSWYTSSPGNGINVISVASVDNTVVPLQNATVGGIQHDPITYFNTFPLPINTT
LPIFATSNSTTVVDDACAPLPNSTPDLSDKVVVIRRGTCTFVEKLTNAAEKGAQVVLIYDNGSGFAGIGVGDFIA
TLIQSADGEFLVQQFAAGVPVTLTFPQTGGSTDFPDPNGGLVSSFTSFGPTNDFFFKPAIAAPGGSILSTLPNGT
FGVESGTSMAAPFAAGSVALILQSRGKNADTAKGVRSLLESTGQRIASSKTDGDPLQTVTQQGGGLVNVFNAVHA
ETIVTPAELIVNDTAHAVPEQKFTVQNTGKSSKDYTLSHIPAGTALTIRAGSILPENGPVPLSSSPATVSINPST
FTLEPGASQTVTATISGPTGLDDTTFPVYSGFIEISDGDQSFHVTYLGLVGSLIDKQVIDDTDFFFGIPLPFIFN
STGAVQVGPVNYTFAGDDFPIFVWRQAFGSPRVTVDLVNPDIQIDATLNARVVDDNKKPFISFPTPHTSGTYGQV
QTIGSMLEFNFLGRNNENPADNGANAFSITTPTFANGTIIPNGSYRLLLRALRVTGDATKEEDTEAFLSEIIGIN
A*
Coding >AgabiH97|040260
ATGAAGAGTCTGGTATTATCGCTAGTATGGTTATTGAACGTATATCCTACGTTTGCAGCCATCGCTTCCATTTCA
GATATCCCACTCAAATCTTTGAATCTCCCAACTGTCTCCAATAAATTTATAATCGAAGTCGATGAAGCTGCGAAT
ATCCCTCCTTCAGCCACTGAACGTTTCACGGAATCTCTCTCAGTACATGATTTCGTTTTTGAGAATCTCAAAAGG
AGAGATGTAAATTTGAATATAACAAAACGATATAATGTCAAAGGCGTCTTTGTAGGAGCAGCAATCACATTGGAT
AATCCCCAGGATGTGGCTGCTATAAGACAAGTACCTGGAATCAAAGATATTCGTCCTGTGCAAAAGTTCAATATA
CCCAAGCCTGTGTTCAAACATGTTGTTACTGGTCCGGATGATCCTGCTATTCCACCTGACTCGGAATCAACTCAT
ATTATGACTGGTGTTGATAAACTCCATGCGGAAGGAATTACTGGTGAAGGAATTAAGATTGGGATCCTCGATACT
GGTGTGGATTATAATCATCCTTCTTTGGGTGGTGGTTTCGGACCTGGATTCAAGTTTGTTGGTGGATTCGATTTT
GTTGGAGACGATTATGATGGTACTAATGCCCCGATTCCGGATGATGATCCTCTTGATATATGTGCTGGACATGGA
AGTCATGTATCTGGTATTGTTGGTGCTGACCCGGGAAACGAATTTGGTATAAGTGGTGTTGCATACGATGCAACA
TTTTCCATGTACAGAGTTTTCGGATGCGTAGGATTCGTCACTGACGACGTTCTCGTTGAAGCGCTTTTGATGGGT
TTCCAAGACGGTCAAGATATATTGACGTTATCACTTGGAGGTCCTGATGGTTGGACTGAGTCTTCTTCTTCTGTC
GTTGCTAGTAGATTGGTTGAACAAGGAATGGTCGTTACTATCTCAGCTGGTAATGATGGCGCTTCTGGGTCTTGG
TATACGTCAAGTCCAGGGAATGGTATCAACGTTATATCCGTTGCCAGTGTCGACAATACTGTCGTTCCATTACAA
AACGCAACAGTAGGCGGCATCCAACACGATCCCATAACTTATTTCAACACGTTCCCACTTCCCATCAACACCACC
CTCCCTATATTCGCTACATCAAATTCGACTACAGTCGTCGACGATGCGTGTGCCCCACTCCCCAATTCGACACCA
GATCTATCTGATAAAGTCGTTGTGATACGGAGAGGTACTTGTACCTTTGTGGAAAAGTTGACAAACGCGGCTGAG
AAGGGGGCTCAAGTTGTTTTGATTTATGACAATGGTTCTGGATTTGCTGGAATCGGTGTTGGCGATTTCATTGCT
ACTCTTATTCAATCCGCTGATGGTGAATTCCTTGTACAACAATTCGCTGCCGGTGTCCCTGTTACCCTCACCTTC
CCACAAACTGGAGGATCGACAGATTTCCCTGATCCAAATGGTGGCCTCGTTTCCAGTTTCACTAGTTTCGGTCCC
ACAAACGATTTCTTCTTCAAACCCGCCATTGCCGCACCAGGAGGCAGTATCCTTTCCACCTTACCTAATGGCACA
TTTGGCGTTGAATCCGGAACGTCTATGGCTGCACCATTCGCTGCTGGCAGTGTCGCACTTATCCTTCAATCTAGA
GGTAAGAACGCTGATACTGCAAAAGGCGTTCGTTCTCTTTTGGAATCTACTGGACAGAGAATTGCATCTAGTAAA
ACTGATGGTGACCCGTTGCAAACTGTGACTCAACAAGGTGGTGGATTGGTGAATGTGTTTAATGCTGTTCATGCT
GAGACTATTGTTACACCTGCCGAGTTGATTGTGAATGATACAGCGCATGCGGTGCCGGAGCAGAAGTTTACTGTT
CAAAATACGGGAAAGTCGTCAAAGGACTATACTCTCAGTCATATTCCCGCAGGCACAGCTTTAACCATCCGAGCC
GGTTCGATCCTCCCAGAAAACGGTCCCGTTCCTCTATCATCTTCTCCCGCAACAGTATCCATCAACCCCTCAACC
TTCACTCTCGAACCAGGTGCTTCCCAAACCGTCACAGCCACAATCTCCGGACCTACAGGACTTGACGACACGACA
TTCCCTGTGTATTCTGGGTTTATCGAGATTAGCGATGGCGATCAGAGTTTCCATGTTACGTATCTTGGTCTCGTT
GGATCGTTGATTGATAAACAGGTTATTGATGATACGGATTTCTTCTTTGGTATTCCTCTTCCTTTTATTTTTAAT
AGCACTGGGGCTGTTCAAGTGGGTCCTGTGAATTATACGTTTGCTGGTGATGACTTTCCGATATTCGTCTGGCGA
CAAGCATTTGGTTCTCCTCGTGTTACTGTTGATCTCGTCAACCCGGATATTCAAATCGACGCTACACTAAACGCC
AGAGTAGTCGATGATAACAAGAAACCTTTCATTTCATTCCCTACACCCCATACATCAGGCACTTACGGACAAGTA
CAAACCATCGGATCTATGCTCGAGTTCAACTTCCTCGGCCGGAACAACGAGAACCCTGCAGACAATGGAGCCAAT
GCATTCAGCATAACGACACCGACGTTTGCGAATGGAACGATCATTCCTAATGGGTCGTATAGGCTTCTCTTGCGC
GCGTTGAGAGTCACAGGAGATGCTACGAAAGAAGAGGATACCGAGGCTTTCCTGAGTGAAATCATTGGGATTAAT
GCTTAA
Transcript >AgabiH97|040260
ATGAAGAGTCTGGTATTATCGCTAGTATGGTTATTGAACGTATATCCTACGTTTGCAGCCATCGCTTCCATTTCA
GATATCCCACTCAAATCTTTGAATCTCCCAACTGTCTCCAATAAATTTATAATCGAAGTCGATGAAGCTGCGAAT
ATCCCTCCTTCAGCCACTGAACGTTTCACGGAATCTCTCTCAGTACATGATTTCGTTTTTGAGAATCTCAAAAGG
AGAGATGTAAATTTGAATATAACAAAACGATATAATGTCAAAGGCGTCTTTGTAGGAGCAGCAATCACATTGGAT
AATCCCCAGGATGTGGCTGCTATAAGACAAGTACCTGGAATCAAAGATATTCGTCCTGTGCAAAAGTTCAATATA
CCCAAGCCTGTGTTCAAACATGTTGTTACTGGTCCGGATGATCCTGCTATTCCACCTGACTCGGAATCAACTCAT
ATTATGACTGGTGTTGATAAACTCCATGCGGAAGGAATTACTGGTGAAGGAATTAAGATTGGGATCCTCGATACT
GGTGTGGATTATAATCATCCTTCTTTGGGTGGTGGTTTCGGACCTGGATTCAAGTTTGTTGGTGGATTCGATTTT
GTTGGAGACGATTATGATGGTACTAATGCCCCGATTCCGGATGATGATCCTCTTGATATATGTGCTGGACATGGA
AGTCATGTATCTGGTATTGTTGGTGCTGACCCGGGAAACGAATTTGGTATAAGTGGTGTTGCATACGATGCAACA
TTTTCCATGTACAGAGTTTTCGGATGCGTAGGATTCGTCACTGACGACGTTCTCGTTGAAGCGCTTTTGATGGGT
TTCCAAGACGGTCAAGATATATTGACGTTATCACTTGGAGGTCCTGATGGTTGGACTGAGTCTTCTTCTTCTGTC
GTTGCTAGTAGATTGGTTGAACAAGGAATGGTCGTTACTATCTCAGCTGGTAATGATGGCGCTTCTGGGTCTTGG
TATACGTCAAGTCCAGGGAATGGTATCAACGTTATATCCGTTGCCAGTGTCGACAATACTGTCGTTCCATTACAA
AACGCAACAGTAGGCGGCATCCAACACGATCCCATAACTTATTTCAACACGTTCCCACTTCCCATCAACACCACC
CTCCCTATATTCGCTACATCAAATTCGACTACAGTCGTCGACGATGCGTGTGCCCCACTCCCCAATTCGACACCA
GATCTATCTGATAAAGTCGTTGTGATACGGAGAGGTACTTGTACCTTTGTGGAAAAGTTGACAAACGCGGCTGAG
AAGGGGGCTCAAGTTGTTTTGATTTATGACAATGGTTCTGGATTTGCTGGAATCGGTGTTGGCGATTTCATTGCT
ACTCTTATTCAATCCGCTGATGGTGAATTCCTTGTACAACAATTCGCTGCCGGTGTCCCTGTTACCCTCACCTTC
CCACAAACTGGAGGATCGACAGATTTCCCTGATCCAAATGGTGGCCTCGTTTCCAGTTTCACTAGTTTCGGTCCC
ACAAACGATTTCTTCTTCAAACCCGCCATTGCCGCACCAGGAGGCAGTATCCTTTCCACCTTACCTAATGGCACA
TTTGGCGTTGAATCCGGAACGTCTATGGCTGCACCATTCGCTGCTGGCAGTGTCGCACTTATCCTTCAATCTAGA
GGTAAGAACGCTGATACTGCAAAAGGCGTTCGTTCTCTTTTGGAATCTACTGGACAGAGAATTGCATCTAGTAAA
ACTGATGGTGACCCGTTGCAAACTGTGACTCAACAAGGTGGTGGATTGGTGAATGTGTTTAATGCTGTTCATGCT
GAGACTATTGTTACACCTGCCGAGTTGATTGTGAATGATACAGCGCATGCGGTGCCGGAGCAGAAGTTTACTGTT
CAAAATACGGGAAAGTCGTCAAAGGACTATACTCTCAGTCATATTCCCGCAGGCACAGCTTTAACCATCCGAGCC
GGTTCGATCCTCCCAGAAAACGGTCCCGTTCCTCTATCATCTTCTCCCGCAACAGTATCCATCAACCCCTCAACC
TTCACTCTCGAACCAGGTGCTTCCCAAACCGTCACAGCCACAATCTCCGGACCTACAGGACTTGACGACACGACA
TTCCCTGTGTATTCTGGGTTTATCGAGATTAGCGATGGCGATCAGAGTTTCCATGTTACGTATCTTGGTCTCGTT
GGATCGTTGATTGATAAACAGGTTATTGATGATACGGATTTCTTCTTTGGTATTCCTCTTCCTTTTATTTTTAAT
AGCACTGGGGCTGTTCAAGTGGGTCCTGTGAATTATACGTTTGCTGGTGATGACTTTCCGATATTCGTCTGGCGA
CAAGCATTTGGTTCTCCTCGTGTTACTGTTGATCTCGTCAACCCGGATATTCAAATCGACGCTACACTAAACGCC
AGAGTAGTCGATGATAACAAGAAACCTTTCATTTCATTCCCTACACCCCATACATCAGGCACTTACGGACAAGTA
CAAACCATCGGATCTATGCTCGAGTTCAACTTCCTCGGCCGGAACAACGAGAACCCTGCAGACAATGGAGCCAAT
GCATTCAGCATAACGACACCGACGTTTGCGAATGGAACGATCATTCCTAATGGGTCGTATAGGCTTCTCTTGCGC
GCGTTGAGAGTCACAGGAGATGCTACGAAAGAAGAGGATACCGAGGCTTTCCTGAGTGAAATCATTGGGATTAAT
GCTTAA
Gene >AgabiH97|040260
ATGAAGAGTCTGGTATTATCGCTAGTATGGTTATTGAACGTATATCCTACGTTTGCAGCCATCGCTTCCATTTCA
GATATCCCACTCAAATCTTTGAATCTCCCAACTGTCTCCAATAAATTTATAATCGAAGTCGATGAAGCTGCGAAT
ATCCCTCCTTCAGCCACTGAACGTTTCACGGAATCTCTCTCAGTACGCTTTGTTTCGTACTTGTTTTATAAACTT
TCTAAATATCAACTTCAGGTACATGATTTCGTTTTTGAGAATCTCAAAAGGAGAGATGTAAATTTGAATATAACA
AAACGATATAATGTCAAAGGCGTCTTTGTAGGAGCAGCAATCACATTGGATAATCCCCAGGTCATTCATTACTGG
CTCTCTCTCTTTCATCGCTTCACACGCACTAAAAATAAAATTCTATACTATAGGATGTGGCTGCTATAAGACAAG
TACCTGGAATCAAAGATATTCGTCCTGTGCAAAAGTTCAATATACCCAAGTACGTTCCTTTTTTTTTGTTTATAT
TTGAGGGTTGAAACGTTGTTGTTAGGCCTGTGTTCAAACATGTTGTTACTGGTCCGGATGATCCTGCTATTCCAC
CTGACTCGGAATCAACTCATATTATGACTGTAAGGATGAGACAGGATTAATCTCTCGCTCTGTTTGTCTAATTGT
CTTTTTTGATACTAGGGTGTTGATAAACTCCATGCGGAAGGAATTACTGGTGAAGGAATTAAGATTGGGATGTAA
GTGCATCATCATCAAGTTTTAACCTACGCAAATATAAACTAAATCAACCGCGGCTTTTTTTTTTAAAGCCTCGAT
ACTGGTATTCAAACCATTTTAAATTCCATCTCTCCTCAAATTTAAAAAACATTTTTATTAAAGGTGTGGATTATA
ATCATCCTTCTTTGGGTGGTGGTTTCGGACCTGGATTCAAGTTTGTTGGTGGATTCGATTTTGTTGGAGACGATT
ATGATGGTTTAGTTGATTCGTAAATCCGTTATAATTCATTTGGGTCTCAACGTCATTTGAATAGGTACTAATGCC
CCGATTCCGGATGATGATCCTCTTGATATATGTGCTGGACATGGAAGTCATGTATCTGTAAGTTCCGTTTTTTTC
CAAAATTTTTTTGATTCGAGACTTAGAAACCCTGTAGGGTATTGTTGGTGCTGACCCGGGAAACGAATTTGGTAT
AAGTGGTGTTGCATACGATGCAACATTTTCCATGTACAGAGTTTTCGGATGCGTAGGATTCGTCACTGACGACGG
TACGTACACAACCTCAACTTTCCCTATATATCTAACCCCTCTTCTTCTTTAATCATCATTAGTTCTCGTTGAAGC
GCTTTTGATGGGTTTCCAAGACGGTCAAGATATATTGACGTTATCACTTGGAGGTCCTGATGGTTGGACTGAGTC
TTCTTCTTCTGTCGTTGCTAGTAGATTGGTTGAACAAGGAATGGTCGTTACTATCTCAGCTGGTAATGATGTGAG
TTTCTCAGTTTTTATCTATTTTGATATTCAATGATGAGAAATTTTTTATATGTAGGGCGCTTCTGGGTCTTGGTA
TACGTCAAGTCCAGGGAATGGTATCAACGTTATATCCGTTGCCAGTGTCGACAAGTAACGAATTTCATTTTTATG
TCTTGGTAATTCTTCAATTGACCAATGCTTAAAGTACTGTCGTTCCATTACAAAACGCAACAGTAGGCGGCATCC
AACACGATCCCATAACTTATTTCAACACGTTCCCACTTCCCATCAACACCACCCTCCCTATATTCGCTACATCAA
ATTCGACTACAGTCGTCGACGATGCGTGTGCCCCACTCCCCAATTCGACACCAGATCTATCTGATAAAGTCGTTG
TGATACGGAGAGGTACTTGTACCTTTGTGGAAAAGTTGACAAACGCGGCTGAGAAGGGGGCTCAAGTTGTTTTGA
TTTATGAGTATGTACTATCCTCTACTACTACTACGTTTGCTAGTCTGATTCGGTATAATTATAGCAATGGTTCTG
GATTTGCTGGAATCGGTGTTGGCGATTTCATTGCTACTCTTATTCAATCCGCTGATGGTGAATTCGTAAGTTAAT
TCCTCCCCAAGTTAATATGAAGGATGAAGGACTCACAGAACGGCTTTTTCTTTAGCTTGTACAACAATTCGCTGC
CGGTGTCCCTGTTACCCTCACCTTCCCACAAACTGGAGGATCGACAGATTTCCCTGATCCAAATGGTGGCCTCGT
TTCCAGTTTCACTAGGTACTACTGTCGTATAACTTTCCCAAACTTAATTGTCTAATCGTTAAATTAGTTTCGGTC
CCACAAACGATTTCTTCTTCAAACCCGCCATTGCCGCACCAGGAGGCAGTATCCTTTCCACCTTACCTAATGGCA
CATTTGGCGTTGAATCCGGAACGTCTATGGCTGCACCATTCGCTGCTGGCAGTGTCGCACTTATCCTTCAATCTA
GAGGTAAGAACGCTGATACTGCAAAAGGCGTTCGTTCTCTTTTGGAATCTACTGGACAGAGAATTGCATCTAGTA
AAACTGATGGTGACCCGTTGCAAACTGTGACTCAACAAGGTGGTGGATTGGTGAATGTGTTTAATGCTGTTCATG
CTGAGACTATTGTTACACCTGCCGAGTTGATTGTGAATGATACAGCGCATGCGGTGCCGGAGTAAGTGATAAAAC
AAAGTTGGGAACATATAGCTGATCTGGTACTTGGTTATTTTTAGGCAGAAGTTTACTGTTCAAAATACGGGAAAG
TCGTCAAAGGACTATACTCTCAGTCATATTCCCGCAGGCACAGCTTTAACCATCCGAGCCGGTTCGATCCTCCCA
GAAAACGGTCCCGTTCCTCTATCATCTTCTCCCGCAACAGTATCCATCAACCCCTCAACCTTCACTCTCGAACCA
GGTGCTTCCCAAACCGTCACAGCCACAATCTCCGGACCTACAGGACTTGACGACACGACATTCCCTGTGTATTCT
GGGTTTATCGAGATTAGCGATGGCGATCAGAGTTTCCATGTTACGTATCTTGGTCTCGTTGGATCGTTGATTGAT
AAACAGGTTATTGATGATACGGATTTCTTCTTTGGTATTCCTCTTCCTTTTATTTTTAATAGCACTGGGGCTGTT
CAAGTGGGTCCTGTGAATTATACGTTTGCTGGTGATGACTTTCCGATATTCGTCTGGCGGTAAGATTCTTAATAG
CGACAAGGATTGAGCTGATATTTTTTTCTATAGACAAGCATTTGGTTCTCCTCGTGTTACTGTTGATCTCGTCAA
CCCGGATATTCAAATCGACGCTACACTAAACGCCAGAGTAGTCGATGATAACAAGAAACCTTTCATTTCATTCCC
TACACCCCATACATCAGGCACTTACGGACAAGTACAAACCATCGGATCTATGCTCGAGTTCAACTTCCTCGGCCG
GAACAACGAGGTTAACGAACCATCCCCCTTCTGTTTACTTTGAGCTAATAGTTTTTCTATCGTAGAACCCTGCAG
ACAATGGAGCCAATGCATTCAGCATAACGACACCGACGTTTGCGAATGGAACGATCATTCCTAATGGGTCGTATA
GGCTTCTCTTGCGCGCGTTGAGAGTCACAGGAGATGCTACGAAAGAAGAGGATACCGAGGCTTTCCTGAGTGAAA
TCATTGGGATTAATGCTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail