Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|040190
Gene name
Locationscaffold_2:450852..454485
Strand-
Gene length (bp)3633
Transcript length (bp)2571
Coding sequence length (bp)2571
Protein length (aa) 857

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04100 Vps53_N Vps53-like, N-terminal 3.0E-88 26 387
PF16854 VPS53_C Vacuolar protein sorting-associated protein 53 C-terminus 3.1E-06 634 718

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5ZLD7|VPS53_CHICK Vacuolar protein sorting-associated protein 53 homolog OS=Gallus gallus GN=VPS53 PE=2 SV=1 1 717 6.0E-114
sp|Q8CCB4|VPS53_MOUSE Vacuolar protein sorting-associated protein 53 homolog OS=Mus musculus GN=Vps53 PE=1 SV=1 9 765 7.0E-113
sp|Q5R5J4|VPS53_PONAB Vacuolar protein sorting-associated protein 53 homolog OS=Pongo abelii GN=VPS53 PE=2 SV=1 6 637 9.0E-94
sp|Q5VIR6|VPS53_HUMAN Vacuolar protein sorting-associated protein 53 homolog OS=Homo sapiens GN=VPS53 PE=1 SV=1 6 637 1.0E-93
sp|P87129|VPS53_SCHPO Vacuolar protein sorting-associated protein 53 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vps53 PE=1 SV=1 24 717 3.0E-83
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5ZLD7|VPS53_CHICK Vacuolar protein sorting-associated protein 53 homolog OS=Gallus gallus GN=VPS53 PE=2 SV=1 1 717 6.0E-114
sp|Q8CCB4|VPS53_MOUSE Vacuolar protein sorting-associated protein 53 homolog OS=Mus musculus GN=Vps53 PE=1 SV=1 9 765 7.0E-113
sp|Q5R5J4|VPS53_PONAB Vacuolar protein sorting-associated protein 53 homolog OS=Pongo abelii GN=VPS53 PE=2 SV=1 6 637 9.0E-94
sp|Q5VIR6|VPS53_HUMAN Vacuolar protein sorting-associated protein 53 homolog OS=Homo sapiens GN=VPS53 PE=1 SV=1 6 637 1.0E-93
sp|P87129|VPS53_SCHPO Vacuolar protein sorting-associated protein 53 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vps53 PE=1 SV=1 24 717 3.0E-83
sp|Q0WQF4|VP53A_ARATH Vacuolar protein sorting-associated protein 53 A OS=Arabidopsis thaliana GN=VPS53 PE=1 SV=1 28 726 6.0E-83
sp|P34561|VPS53_CAEEL Vacuolar protein sorting-associated protein 53 homolog OS=Caenorhabditis elegans GN=vps-53 PE=1 SV=4 33 719 4.0E-71
sp|P47061|VPS53_YEAST Vacuolar protein sorting-associated protein 53 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS53 PE=1 SV=1 26 718 5.0E-46
sp|F4I7Y2|VP53B_ARATH Vacuolar protein sorting-associated protein 53 B OS=Arabidopsis thaliana GN=At1g50970 PE=2 SV=1 30 387 4.0E-33
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|040190
MQTDDLPHEIVLAIERALEPAPENQEFNPLTIINELFPNEASLAYIDSVDRKLNETQSKFQKEIDELQEELKKNQ
DPERMSMIQEMISDLLGQMSRIREKATESEAVVRNITKDIQVLDLAKKNLILSMTVLRRLQMLVNAMTQLQDYIK
EKRYKEVSESLATVKEISATFKQYTSVQRISRVWKRIQELQGELRTQLDADFDAFFIQDSTKQVKPALITQACLV
VDVLGSDFRTHLIDRHVALELKEYRRIFKTNDEAGQLDNISRRFAWFRRLIQNHELEQGRVFPSLWRVGWYLLAK
FAEITRDDISALLSKAASNMTVKTLLDYLQQTIEFELSMAKKWATPFAEILKFTNGSSQPQKVISSSFEPHLGIF
VDAQDKVLAEMLAPHRKKGKPPPRTSLETNRASTEENADDEPPIVVLPSSTELFYLYGQSLEQCAKLSTGKTLFD
LCNLHKKWLRIYAEDVLSLSNPKQRPTARRSMESRFDINEIKRACLVINTADYCQTTASELEEKIKEKINEDFKE
KITLQKERDLFVSVISSAITLLLREVENATDVYFTTMIRSNWPALNQVSGQSHYVGELVKATEQVVETIKPLIEQ
KRYLRNFLDKVCSVVLAKFTNALVRSKPLKEIGAEQLLLDLQVLKGYLTKMPGENLLTNIYSKALTKTATRLETL
LKVIITPMDPKENFILNYTFLIGDASLINFQKILDLKGVPRTLHQDFEDTFLMITSTKTDLDSTSFLSSLDMDPQ
GGGGGGSNLLLLSPTASRVALPLGSNTISDGGGLFHSLSGGSGGASVSGSSGPATGSSVGGGVGGVGTGEGGFGP
GARGMSGETNVFSDFRRFVSFGLRKESTPPS*
Coding >AgabiH97|040190
ATGCAAACCGATGATTTGCCTCACGAAATAGTCCTCGCCATTGAGCGCGCGCTCGAGCCTGCTCCGGAAAACCAA
GAATTCAATCCTCTCACAATCATCAATGAGCTGTTTCCTAATGAGGCTTCACTCGCCTATATTGACTCTGTGGAT
CGGAAACTTAATGAGACACAATCCAAATTTCAGAAAGAGATAGATGAACTTCAAGAGGAATTGAAAAAGAACCAG
GATCCCGAGCGTATGTCCATGATTCAAGAGATGATTTCCGACCTCTTGGGACAAATGTCACGTATTCGTGAAAAA
GCTACTGAATCGGAAGCAGTTGTCAGGAATATTACGAAGGACATACAGGTCCTGGATCTCGCGAAGAAGAATTTG
ATCCTTAGTATGACTGTATTAAGACGGTTGCAGATGCTAGTCAATGCAATGACGCAGCTCCAGGATTACATCAAG
GAAAAGAGGTACAAAGAAGTATCCGAATCCCTAGCCACTGTCAAAGAAATATCCGCTACTTTCAAACAATACACA
TCAGTTCAACGAATCTCAAGAGTCTGGAAACGAATACAAGAATTGCAAGGGGAGTTACGCACTCAGTTAGATGCA
GACTTCGACGCCTTCTTTATTCAGGATTCCACGAAACAAGTCAAACCCGCTTTGATAACTCAAGCTTGTCTCGTC
GTCGACGTTCTAGGTTCTGATTTTCGTACCCACCTCATAGACCGTCACGTTGCACTCGAACTCAAAGAATACCGA
CGTATATTCAAAACCAACGATGAAGCTGGCCAGTTGGATAATATCTCGAGACGTTTCGCTTGGTTCAGGCGGTTG
ATACAGAACCATGAGCTTGAACAGGGTAGGGTGTTTCCATCGCTTTGGAGAGTTGGGTGGTACTTGTTAGCCAAA
TTCGCCGAGATCACAAGGGATGATATTTCGGCGTTGCTGTCAAAGGCGGCATCGAATATGACTGTGAAAACGTTA
CTCGATTATCTACAACAGACCATAGAGTTCGAGCTTTCAATGGCGAAGAAATGGGCAACCCCCTTTGCGGAAATA
TTGAAGTTTACCAACGGCTCCAGTCAGCCGCAGAAAGTTATATCCTCATCCTTTGAGCCTCATCTTGGCATATTC
GTCGATGCTCAAGACAAAGTTTTGGCAGAGATGCTGGCACCACATCGAAAGAAGGGAAAACCTCCACCGAGGACG
TCCCTTGAAACTAACCGTGCATCGACTGAAGAAAATGCAGATGACGAACCACCAATAGTTGTCTTACCCTCATCT
ACAGAATTGTTTTATCTTTATGGACAGAGTTTGGAGCAATGTGCGAAATTATCGACTGGGAAAACATTGTTTGAC
CTATGTAATCTGCACAAGAAGTGGTTGAGAATATATGCAGAGGATGTCTTGTCATTGAGCAATCCCAAACAACGT
CCCACGGCGCGTAGATCCATGGAATCGCGATTTGACATAAACGAAATTAAACGAGCGTGTTTGGTCATCAATACC
GCGGACTATTGCCAAACTACAGCGTCCGAGCTCGAAGAGAAAATCAAGGAAAAGATTAATGAAGATTTCAAAGAG
AAAATCACACTGCAAAAGGAACGTGATCTCTTTGTCAGTGTCATATCATCAGCTATAACTCTCCTCCTTCGCGAA
GTTGAGAACGCCACTGATGTATATTTTACGACAATGATCCGTTCGAATTGGCCAGCTTTGAACCAAGTCAGCGGG
CAGTCACATTATGTTGGGGAATTGGTCAAGGCTACGGAACAGGTGGTGGAGACTATCAAACCGTTGATCGAGCAA
AAAAGATATCTGAGGAATTTTCTGGATAAAGTTTGTAGTGTCGTGTTGGCCAAATTTACAAATGCGCTTGTGAGA
AGTAAACCATTAAAAGAGATTGGTGCCGAACAGCTCCTACTTGACTTACAAGTTCTCAAAGGGTATCTTACTAAG
ATGCCGGGAGAGAATTTGTTAACGAATATTTACTCGAAGGCGTTAACCAAAACGGCGACACGACTTGAGACGCTT
CTTAAAGTCATCATAACTCCAATGGACCCAAAAGAGAACTTTATACTCAACTATACATTCCTCATCGGAGATGCT
TCACTAATCAACTTCCAAAAGATTCTTGACCTAAAAGGAGTCCCGCGCACTCTTCATCAAGATTTCGAAGACACA
TTCTTGATGATCACGAGTACCAAGACCGATTTAGACAGTACTTCTTTCTTATCTTCGCTCGATATGGATCCCCAA
GGAGGTGGAGGAGGAGGAAGCAATCTTCTCCTTCTCAGTCCTACAGCTAGTCGAGTTGCATTACCGCTTGGATCA
AATACCATTAGCGATGGTGGTGGTTTATTTCATAGTTTAAGCGGCGGGAGTGGTGGTGCGTCGGTATCCGGTTCG
AGTGGACCAGCGACGGGTTCGAGTGTTGGTGGTGGGGTGGGTGGTGTTGGTACTGGCGAAGGCGGTTTTGGTCCT
GGAGCGAGAGGAATGTCGGGTGAGACGAATGTCTTTTCTGATTTTAGAAGATTTGTTAGTTTTGGATTGAGGAAA
GAGTCGACTCCGCCTTCATAA
Transcript >AgabiH97|040190
ATGCAAACCGATGATTTGCCTCACGAAATAGTCCTCGCCATTGAGCGCGCGCTCGAGCCTGCTCCGGAAAACCAA
GAATTCAATCCTCTCACAATCATCAATGAGCTGTTTCCTAATGAGGCTTCACTCGCCTATATTGACTCTGTGGAT
CGGAAACTTAATGAGACACAATCCAAATTTCAGAAAGAGATAGATGAACTTCAAGAGGAATTGAAAAAGAACCAG
GATCCCGAGCGTATGTCCATGATTCAAGAGATGATTTCCGACCTCTTGGGACAAATGTCACGTATTCGTGAAAAA
GCTACTGAATCGGAAGCAGTTGTCAGGAATATTACGAAGGACATACAGGTCCTGGATCTCGCGAAGAAGAATTTG
ATCCTTAGTATGACTGTATTAAGACGGTTGCAGATGCTAGTCAATGCAATGACGCAGCTCCAGGATTACATCAAG
GAAAAGAGGTACAAAGAAGTATCCGAATCCCTAGCCACTGTCAAAGAAATATCCGCTACTTTCAAACAATACACA
TCAGTTCAACGAATCTCAAGAGTCTGGAAACGAATACAAGAATTGCAAGGGGAGTTACGCACTCAGTTAGATGCA
GACTTCGACGCCTTCTTTATTCAGGATTCCACGAAACAAGTCAAACCCGCTTTGATAACTCAAGCTTGTCTCGTC
GTCGACGTTCTAGGTTCTGATTTTCGTACCCACCTCATAGACCGTCACGTTGCACTCGAACTCAAAGAATACCGA
CGTATATTCAAAACCAACGATGAAGCTGGCCAGTTGGATAATATCTCGAGACGTTTCGCTTGGTTCAGGCGGTTG
ATACAGAACCATGAGCTTGAACAGGGTAGGGTGTTTCCATCGCTTTGGAGAGTTGGGTGGTACTTGTTAGCCAAA
TTCGCCGAGATCACAAGGGATGATATTTCGGCGTTGCTGTCAAAGGCGGCATCGAATATGACTGTGAAAACGTTA
CTCGATTATCTACAACAGACCATAGAGTTCGAGCTTTCAATGGCGAAGAAATGGGCAACCCCCTTTGCGGAAATA
TTGAAGTTTACCAACGGCTCCAGTCAGCCGCAGAAAGTTATATCCTCATCCTTTGAGCCTCATCTTGGCATATTC
GTCGATGCTCAAGACAAAGTTTTGGCAGAGATGCTGGCACCACATCGAAAGAAGGGAAAACCTCCACCGAGGACG
TCCCTTGAAACTAACCGTGCATCGACTGAAGAAAATGCAGATGACGAACCACCAATAGTTGTCTTACCCTCATCT
ACAGAATTGTTTTATCTTTATGGACAGAGTTTGGAGCAATGTGCGAAATTATCGACTGGGAAAACATTGTTTGAC
CTATGTAATCTGCACAAGAAGTGGTTGAGAATATATGCAGAGGATGTCTTGTCATTGAGCAATCCCAAACAACGT
CCCACGGCGCGTAGATCCATGGAATCGCGATTTGACATAAACGAAATTAAACGAGCGTGTTTGGTCATCAATACC
GCGGACTATTGCCAAACTACAGCGTCCGAGCTCGAAGAGAAAATCAAGGAAAAGATTAATGAAGATTTCAAAGAG
AAAATCACACTGCAAAAGGAACGTGATCTCTTTGTCAGTGTCATATCATCAGCTATAACTCTCCTCCTTCGCGAA
GTTGAGAACGCCACTGATGTATATTTTACGACAATGATCCGTTCGAATTGGCCAGCTTTGAACCAAGTCAGCGGG
CAGTCACATTATGTTGGGGAATTGGTCAAGGCTACGGAACAGGTGGTGGAGACTATCAAACCGTTGATCGAGCAA
AAAAGATATCTGAGGAATTTTCTGGATAAAGTTTGTAGTGTCGTGTTGGCCAAATTTACAAATGCGCTTGTGAGA
AGTAAACCATTAAAAGAGATTGGTGCCGAACAGCTCCTACTTGACTTACAAGTTCTCAAAGGGTATCTTACTAAG
ATGCCGGGAGAGAATTTGTTAACGAATATTTACTCGAAGGCGTTAACCAAAACGGCGACACGACTTGAGACGCTT
CTTAAAGTCATCATAACTCCAATGGACCCAAAAGAGAACTTTATACTCAACTATACATTCCTCATCGGAGATGCT
TCACTAATCAACTTCCAAAAGATTCTTGACCTAAAAGGAGTCCCGCGCACTCTTCATCAAGATTTCGAAGACACA
TTCTTGATGATCACGAGTACCAAGACCGATTTAGACAGTACTTCTTTCTTATCTTCGCTCGATATGGATCCCCAA
GGAGGTGGAGGAGGAGGAAGCAATCTTCTCCTTCTCAGTCCTACAGCTAGTCGAGTTGCATTACCGCTTGGATCA
AATACCATTAGCGATGGTGGTGGTTTATTTCATAGTTTAAGCGGCGGGAGTGGTGGTGCGTCGGTATCCGGTTCG
AGTGGACCAGCGACGGGTTCGAGTGTTGGTGGTGGGGTGGGTGGTGTTGGTACTGGCGAAGGCGGTTTTGGTCCT
GGAGCGAGAGGAATGTCGGGTGAGACGAATGTCTTTTCTGATTTTAGAAGATTTGTTAGTTTTGGATTGAGGAAA
GAGTCGACTCCGCCTTCATAA
Gene >AgabiH97|040190
ATGCAAACCGATGATTTGCCTCACGAAATAGTCCTCGCCATTGAGCGCGCGCTCGAGCCTGCTCCGGAAAACCAA
GAATTCAATCCTCTCACAATCATCAATGAGCTGTTTCCTAATGGTTGGTGGTATGCGGCCGTGGCTTCAATTCAT
GTGCTGATGAATATTCTTGTTAGAGGCTTCACTCGCCTATATTGACTCTGTGGATCGGAAACTTAATGAGACACA
ATCCAAATTTCAGAAAGAGATAGATGAACTTCAAGAGGAATTGAAAAAGAACCAGGATCCCGAGCGTATGTCCAT
GATTCAAGAGATGATTTCCGTAAGTACTGGTCACCGTTCCTTTTAACTTGACATTGTTCTCAACATTTTTAGGAC
CTCTTGGGACAAATGTCACGTATTCGTGAAAAAGCTACTGAATCGGAAGCAGTTGTCAGGAATATTACGAAGGAC
ATACAGGTCCTGGATCTCGCGAAGAAGAATTTGATCCTTAGTATGACTGTATTAAGACGGTTGCAGATGCTAGGT
TCGTTCTCTAAGTTTCTTTCTTTTCCTAATCCACCTCACCTACTTTCCTCCAGTCAATGCAATGACGCAGCTCCA
GGATTACATCAAGGAAAAGAGGTACAAAGAAGTATCCGAATCCCTAGCCGTGCGTCATAGGTGTTAATCATCAAC
GCCAGTAATATTCAACAGTGCCGTCGATGAATAGACTGTCAAAGAAATATCCGCTACTTTCAAACAATACACATC
AGTTCAACGAATCTCAAGAGTCTGGAAACGAATACAAGAATTGCAAGGGGAGTTACGCACTCAGTTAGATGCAGA
CTTCGACGCCTTGTATGTCTACCTGTATCCTACCAGTCAATCTCATCTTCTGATTGCATCAAAGCTTTATTCAGG
ATTCCACGAAACAAGTCAAACCCGCTTTGATAACTCAAGCTTGTCTCGTCGTCGACGTTCTAGGTTCTGATTTTC
GTACCCACCTCATAGACCGTCACGTTGCACTCGAACTCAAAGAATACCGACGTATATTCAAAACCAACGATGAAG
CTGGCCAGTTGGATAATATCTCGAGACGTTTCGCTTGGTTCAGGCGGTTGATACAGAACCATGAGCTTGAACAGG
GTAGGGTGTTTCCATCGCTTTGGAGAGTTGGGTGGTACTTGTTAGCCAAATTCGCCGAGATCACAAGGTATGTGC
GCGTCTGTTTTCTTGTGGCTTTGCGGTCCTGACTTGTCATAACTAAGGGATGATATTTCGGCGTTGCTGTCAAAG
GCGGCATCGAATATGACTGTGAAAACGTTACTCGATTATCTACAACAGACCATAGAGTTCGAGCTTTCAATGGCG
AAGAAATGGGCAACCCCCGTGAGTTGTGTGCTGCCTTGTATGGCCGACCACATGCTTACTGTTGTTTTACAAGTT
TGCGGAAATATTGAAGTTTACCAACGGCTCCAGTCAGCCGCAGAAAGTTATATCCTCATCCTTTGAGCCTCATCT
TGGCATATTCGTCGATGCTCAAGACAAGTCAGTTTATCCAGTGTCTTCCGCCTTACGGGTATTGAATAACAGTTC
TAGAGTTTTGGCAGAGATGCTGGCACCACATCGAAAGAAGGGAAAACCTCCACCGAGGACGTCCCTTGAAACTAA
CCGTGCATCGACTGAAGAAAATGCAGATGACGAACCACCAATAGTTGTCTTACCCTCATCTACAGAATTGTTTTA
TCTTTATGGACAGAGTTTGGAGCAATGTGCGAAATTATCGACTGGGAAAACATTGTTTGACCTATGTAATCTGCA
CAAGAAGTGGTTGAGAATATATGCAGGTATGTCATGATTGCTTTTTTCTGTTCTTTTTGCTCATATGCGTCTCCT
TTTTAGAGGATGTCTTGTCATTGAGCAATCCCAAACAACGGTCAGCATATTTCAAATACTTCCTCGGTGATAGAC
TGATGTTTCTTTTTAACTTGAAAGTCCCACGGCGCGTAGATCCATGGAATCGCGATTTGACATAAACGAAATTAA
ACGAGCGTGTTTGGTCATCAATACCGCGGACTATTGCCAAACTACAGCGTCCGAGGTAGAGAATTCATCTTTCCG
ATGCAAGCGCGCACGAATTCATTTCTTAATTCACTCTAGCTCGAAGAGAAAATCAAGGAAAAGATTAATGAAGAT
TTCAAAGAGAAAATCACACTGCAAAAGGAACGTGATCTCTTTGTCAGGTATCCCGTCTCCTGTTCCTTCTTCCAC
TTCCGCTCTAATTCCTCTACCTTTATTCTATTTCCTATTCATCCCTGTCGTTAGTGTCATATCATCAGCTATAAC
TCTCCTCCTTCGCGAAGTTGAGAACGCCACTGATGTATATTTTACGACAATGATCCGTTCGAATTGGCCAGCTTT
GAACCAAGTCAGCGGGCAGTCACATTATGTTGGGGAATTGGTCAAGGCTACGGAACAGGTGGTGGAGACTATCAA
ACCGTTGATCGAGCAAAAAAGATATCTGAGGAATTTTCTGGATAAAGTTTGTAGGTGAGTCAGACTTTTTCTCTT
GTTTTTTTTTTTCACTTTGCCGCGGGGTTCGCTCTAATAATGACGTTCATCTCTCTGATTTCTAGTGTCGTGTTG
GCCAAATTTACAAATGCGCTTGTGAGAAGTAAACCATTAAAAGAGATTGGTGCCGAACAGGTCAGTGGCGTTCTT
TCAGCGGTTGTTGTCAAGGTCTATTGATTAACTGTCAAAACCGACTTAGCTCCTACTTGACTTACAAGTTCTCAA
AGGGTATCTTACTAAGATGCCGGGAGAGAATTTGTTAACGAATATGTCAGCCTTTACATACCATACTCCTCTTCA
CTTCAATCTTTTCTGACGTGAGCCACATGTTCTTCTTCTTCTGTCTGACAGTTACTCGAAGGCGTTAACCAAAAC
GGCGACACGACTTGAGACGCTTCTTAAAGTCATCATAACTCCAATGGTACGTCGTTCGGATCTTTTGAATTTTTG
TGTGCCTTGGTTTGACATGGGAGAACGGTTACTCTTTTTTATCAAGGACCCAAAAGAGAACTTTATACTCAACTA
TACATTCCTCATCGGAGATGCTTCACTAATCAACTTCCAAAAGGTAACCAAAAAAATAAATTCTTGTTGTTTCAG
AGGAATAAATTCATTAATTTTATCCTTTTCTAGATTCTTGACCTAAAAGGAGTCCCGCGCACTCTTCATCAAGAT
TTCGAAGACACATTCTTGATGATCACGAGTACCAAGACCGATTTAGACAGTACTTCTTTCTTATCTTCGCTCGAT
ATGGATCCCCAAGGAGGTGGAGGAGGAGGAAGCAATCTTCTCCTTCTCAGTCCTACAGCTAGTCGAGTTGCATTA
CCGCTTGGATCAAATACCATTAGCGATGGTGGTGGTTTATTTCATAGTTTAAGCGGCGGGAGTGGTGGTGCGTCG
GTATCCGGTTCGAGTGGACCAGCGACGGGTTCGAGTGTTGGTGGTGGGGTGGGTGGTGTTGGTACTGGCGAAGGC
GGTTTTGGTCCTGGAGCGAGAGGAATGTCGGGTGAGACGAATGTCTTTTCTGATTTTAGAAGATTTGTTAGTTTT
GGATTGAGGAAAGAGTCGACTCCGCCTTCATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail