Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|040120
Gene name
Locationscaffold_2:429130..430450
Strand+
Gene length (bp)1320
Transcript length (bp)1122
Coding sequence length (bp)1122
Protein length (aa) 374

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04032 Rpr2 RNAse P Rpr2/Rpp21/SNM1 subunit domain 2.4E-22 103 224

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5TM57|RPP21_MACMU Ribonuclease P protein subunit p21 OS=Macaca mulatta GN=RPP21 PE=3 SV=1 95 245 7.0E-11
sp|Q9H633|RPP21_HUMAN Ribonuclease P protein subunit p21 OS=Homo sapiens GN=RPP21 PE=1 SV=1 95 248 9.0E-11
sp|Q8R040|RPP21_MOUSE Ribonuclease P protein subunit p21 OS=Mus musculus GN=Rpp21 PE=1 SV=2 161 262 4.0E-10
sp|Q9Y813|RPR2_SCHPO Ribonuclease P protein subunit rpr2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpr2 PE=3 SV=1 161 229 4.0E-09
sp|Q5JEC9|RNP4_THEKO Ribonuclease P protein component 4 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=rnp4 PE=3 SV=1 160 252 4.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5TM57|RPP21_MACMU Ribonuclease P protein subunit p21 OS=Macaca mulatta GN=RPP21 PE=3 SV=1 95 245 7.0E-11
sp|Q9H633|RPP21_HUMAN Ribonuclease P protein subunit p21 OS=Homo sapiens GN=RPP21 PE=1 SV=1 95 248 9.0E-11
sp|Q8R040|RPP21_MOUSE Ribonuclease P protein subunit p21 OS=Mus musculus GN=Rpp21 PE=1 SV=2 161 262 4.0E-10
sp|Q9Y813|RPR2_SCHPO Ribonuclease P protein subunit rpr2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpr2 PE=3 SV=1 161 229 4.0E-09
sp|Q5JEC9|RNP4_THEKO Ribonuclease P protein component 4 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=rnp4 PE=3 SV=1 160 252 4.0E-07
sp|Q12VV9|RNP4_METBU Ribonuclease P protein component 4 OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=rnp4 PE=3 SV=1 165 230 1.0E-06
sp|Q2FTK3|RNP4_METHJ Ribonuclease P protein component 4 OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=rnp4 PE=3 SV=1 166 234 2.0E-06
sp|Q8TGY1|RNP4_METKA Ribonuclease P protein component 4 OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=rnp4 PE=3 SV=1 160 234 2.0E-06
sp|Q9V166|RNP4_PYRAB Ribonuclease P protein component 4 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=rnp4 PE=3 SV=1 160 230 4.0E-06
sp|Q8U0H6|RNP4_PYRFU Ribonuclease P protein component 4 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=rnp4 PE=1 SV=1 160 230 6.0E-06
sp|O59248|RNP4_PYRHO Ribonuclease P protein component 4 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=rnp4 PE=1 SV=1 160 233 8.0E-06
sp|C6A4A4|RNP4_THESM Ribonuclease P protein component 4 OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=rnp4 PE=3 SV=1 160 230 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006396 RNA processing Yes
GO:0008152 metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0016070 RNA metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0044237 cellular metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0008150 biological_process No
GO:0043170 macromolecule metabolic process No
GO:0071704 organic substance metabolic process No
GO:0009987 cellular process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0044238 primary metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 36 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|040120
MTAERRTDYVEAVKPTTMSTWHYITLLQTRANIRAVRHQVSPVIFLKKKGSSVVVFRSRHPVTPLYLKAVTMGKN
DNKKSATGGKGVNLAGINTVPNRDIMQRMNFLWQASVLLGGSGVGDTGTGTSTSRGDGASEVKGNSVESGMKTKK
VKTKKVNGSDLARMYVRTMNVVGQRTTTKMDPSVKRTICKGCSSVLIPGISARIRNRPSRQHEHLMIYTCLTCNT
SRRIPAPRNGVIASPEARLGIGATATEIIDTSAENVQRLVQSSNPSNPHPIRQQQSQHHLEEQLGDKKDDIEMNE
QQDHHTKRNIIDPREDEKTKSLTKQKKTKKKKKKKLPTIVPTPREPPLFSRKDAGHVVYRSGEVIDMDGVYCI*
Coding >AgabiH97|040120
ATGACTGCGGAGCGCAGGACAGACTACGTGGAAGCCGTGAAGCCAACCACAATGTCGACGTGGCATTATATAACA
CTTCTCCAAACACGCGCAAATATCAGGGCTGTGAGGCACCAGGTTTCCCCGGTCATCTTTCTCAAGAAAAAAGGG
TCATCAGTGGTTGTTTTCCGGTCCCGACACCCTGTGACACCCCTCTATCTCAAGGCGGTTACGATGGGAAAGAAT
GATAACAAGAAAAGTGCCACTGGAGGGAAAGGCGTCAATCTTGCGGGTATCAATACTGTTCCGAATAGAGATATC
ATGCAGCGGATGAATTTTTTATGGCAGGCTAGTGTATTGCTTGGAGGGAGTGGCGTTGGTGATACTGGTACTGGT
ACTAGTACTAGTCGTGGCGATGGCGCCAGTGAAGTGAAGGGTAATAGTGTTGAGAGCGGTATGAAGACAAAGAAG
GTGAAGACGAAAAAGGTGAATGGATCTGATTTGGCCAGGATGTATGTGAGGACGATGAACGTCGTTGGACAAAGA
ACCACCACCAAAATGGACCCAAGCGTAAAGCGTACTATATGTAAAGGTTGCTCAAGCGTCCTCATTCCAGGTATT
TCTGCTCGAATTCGCAATCGACCGAGTCGACAACACGAACATCTGATGATATATACATGCTTAACATGCAATACT
TCAAGAAGGATTCCCGCACCTCGAAATGGCGTGATCGCCTCTCCTGAAGCGAGACTTGGAATTGGTGCTACGGCT
ACCGAAATTATCGACACTTCGGCAGAGAATGTCCAGCGACTGGTACAATCGTCGAATCCTTCTAATCCTCATCCT
ATACGACAGCAGCAATCACAACACCATTTGGAGGAACAACTCGGCGATAAGAAGGATGATATCGAAATGAACGAA
CAACAGGATCATCATACTAAGAGGAATATCATTGATCCACGGGAAGATGAGAAGACCAAATCACTGACGAAGCAA
AAGAAGACTAAAAAGAAGAAGAAGAAGAAATTGCCCACCATAGTACCAACACCTCGTGAGCCACCATTATTCTCC
AGAAAAGATGCGGGGCATGTGGTTTATAGGAGTGGAGAAGTTATTGATATGGATGGCGTATACTGTATATGA
Transcript >AgabiH97|040120
ATGACTGCGGAGCGCAGGACAGACTACGTGGAAGCCGTGAAGCCAACCACAATGTCGACGTGGCATTATATAACA
CTTCTCCAAACACGCGCAAATATCAGGGCTGTGAGGCACCAGGTTTCCCCGGTCATCTTTCTCAAGAAAAAAGGG
TCATCAGTGGTTGTTTTCCGGTCCCGACACCCTGTGACACCCCTCTATCTCAAGGCGGTTACGATGGGAAAGAAT
GATAACAAGAAAAGTGCCACTGGAGGGAAAGGCGTCAATCTTGCGGGTATCAATACTGTTCCGAATAGAGATATC
ATGCAGCGGATGAATTTTTTATGGCAGGCTAGTGTATTGCTTGGAGGGAGTGGCGTTGGTGATACTGGTACTGGT
ACTAGTACTAGTCGTGGCGATGGCGCCAGTGAAGTGAAGGGTAATAGTGTTGAGAGCGGTATGAAGACAAAGAAG
GTGAAGACGAAAAAGGTGAATGGATCTGATTTGGCCAGGATGTATGTGAGGACGATGAACGTCGTTGGACAAAGA
ACCACCACCAAAATGGACCCAAGCGTAAAGCGTACTATATGTAAAGGTTGCTCAAGCGTCCTCATTCCAGGTATT
TCTGCTCGAATTCGCAATCGACCGAGTCGACAACACGAACATCTGATGATATATACATGCTTAACATGCAATACT
TCAAGAAGGATTCCCGCACCTCGAAATGGCGTGATCGCCTCTCCTGAAGCGAGACTTGGAATTGGTGCTACGGCT
ACCGAAATTATCGACACTTCGGCAGAGAATGTCCAGCGACTGGTACAATCGTCGAATCCTTCTAATCCTCATCCT
ATACGACAGCAGCAATCACAACACCATTTGGAGGAACAACTCGGCGATAAGAAGGATGATATCGAAATGAACGAA
CAACAGGATCATCATACTAAGAGGAATATCATTGATCCACGGGAAGATGAGAAGACCAAATCACTGACGAAGCAA
AAGAAGACTAAAAAGAAGAAGAAGAAGAAATTGCCCACCATAGTACCAACACCTCGTGAGCCACCATTATTCTCC
AGAAAAGATGCGGGGCATGTGGTTTATAGGAGTGGAGAAGTTATTGATATGGATGGCGTATACTGTATATGA
Gene >AgabiH97|040120
ATGACTGCGGAGCGCAGGACAGACTACGTGGAAGCCGTGAAGCCAACCACAATGTCGACGTGGCATTATATAACA
CTTCTCCAAACACGCGCAAATATCAGGGCTGTGAGGCACCAGGTTTCCCCGGTCATCTTTCTCAAGGTCCGCTTA
TTTATTTATGTAACCTCGTGTGTTCACCTCGCACGCGCGTGTGTCTGAGAAACGCGTTCTCATTCGTCCTTTTGC
TACTGGCAGAAAAAAGGGTCATCAGTGGTTGTTTTCCGGTCCCGACACCCTGTGACACCCCTCTATCTCAAGGCG
GTTACGATGGGAAAGAATGATAACAAGAAAAGTGCCACTGGAGGGAAAGGCGTCAATCTTGCGGGTATCAATACT
GTTCCGAATAGAGATATCATGCAGCGGATGAATTTTTTATGGCAGGCTAGTGTATTGCTTGGAGGGAGTGGCGTT
GGTGATACTGGTACTGGTACTAGTACTAGTCGTGGCGATGGCGCCAGTGAAGTGAAGGGTAATAGTGTTGAGAGC
GGTATGAAGACAAAGAAGGTGAAGACGAAAAAGGTGAATGGATCTGATTTGGCCAGGATGTATGTGAGGACGATG
AACGTCGTTGGACAAAGAACCACCACCAAAATGTTTGTTCTCTCCGTTTTCCCCTCGTCCATTCTGATAATTAAA
TCTTTACAGGGACCCAAGCGTAAAGCGTACTATATGTAAAGGTTGCTCAAGCGTCCTCATTCCAGGTATTTCTGC
TCGAATTCGCAATCGACGTGAGTCATCTTAAAGATTTGATCTATGTACATAATATCTGATCTTTCTCTAGCGAGT
CGACAACACGAACATCTGATGATATATACATGCTTAACATGCAATACTTCAAGAAGGATTCCCGCACCTCGAAAT
GGCGTGATCGCCTCTCCTGAAGCGAGACTTGGAATTGGTGCTACGGCTACCGAAATTATCGACACTTCGGCAGAG
AATGTCCAGCGACTGGTACAATCGTCGAATCCTTCTAATCCTCATCCTATACGACAGCAGCAATCACAACACCAT
TTGGAGGAACAACTCGGCGATAAGAAGGATGATATCGAAATGAACGAACAACAGGATCATCATACTAAGAGGAAT
ATCATTGATCCACGGGAAGATGAGAAGACCAAATCACTGACGAAGCAAAAGAAGACTAAAAAGAAGAAGAAGAAG
AAATTGCCCACCATAGTACCAACACCTCGTGAGCCACCATTATTCTCCAGAAAAGATGCGGGGCATGTGGTTTAT
AGGAGTGGAGAAGTTATTGATATGGATGGCGTATACTGTATATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail