Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|039900
Gene name
Locationscaffold_2:360043..366176
Strand-
Gene length (bp)6133
Transcript length (bp)6000
Coding sequence length (bp)6000
Protein length (aa) 2000

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07727 RVT_2 Reverse transcriptase (RNA-dependent DNA polymerase) 9.8E-65 1611 1842
PF00665 rve Integrase core domain 3.3E-13 1091 1188
PF13976 gag_pre-integrs GAG-pre-integrase domain 2.8E-08 1027 1077
PF14223 Retrotran_gag_2 gag-polypeptide of LTR copia-type 3.3E-07 81 188

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P10978|POLX_TOBAC Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum PE=2 SV=1 1569 1998 3.0E-89
sp|P04146|COPIA_DROME Copia protein OS=Drosophila melanogaster GN=GIP PE=1 SV=3 1592 1998 3.0E-62
sp|P10978|POLX_TOBAC Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum PE=2 SV=1 890 1299 2.0E-44
sp|P25600|YCH4_YEAST Putative transposon Ty5-1 protein YCL074W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY5A PE=5 SV=2 1685 1995 1.0E-34
sp|Q12501|YO22B_YEAST Transposon Ty2-OR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-OR2 PE=1 SV=1 1592 1991 5.0E-28
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P10978|POLX_TOBAC Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum PE=2 SV=1 1569 1998 3.0E-89
sp|P04146|COPIA_DROME Copia protein OS=Drosophila melanogaster GN=GIP PE=1 SV=3 1592 1998 3.0E-62
sp|P10978|POLX_TOBAC Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum PE=2 SV=1 890 1299 2.0E-44
sp|P25600|YCH4_YEAST Putative transposon Ty5-1 protein YCL074W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY5A PE=5 SV=2 1685 1995 1.0E-34
sp|Q12501|YO22B_YEAST Transposon Ty2-OR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-OR2 PE=1 SV=1 1592 1991 5.0E-28
sp|Q03494|YD22B_YEAST Transposon Ty2-DR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR2 PE=3 SV=2 1592 1991 7.0E-28
sp|Q12113|YO21B_YEAST Transposon Ty2-OR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-OR1 PE=3 SV=1 1592 1991 7.0E-28
sp|P0C2J3|YL21B_YEAST Transposon Ty2-LR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-LR1 PE=3 SV=1 1592 1991 1.0E-27
sp|P0CX63|YF21B_YEAST Transposon Ty2-F Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-F PE=3 SV=1 1592 1991 1.0E-27
sp|P0CX64|YG22B_YEAST Transposon Ty2-GR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-GR2 PE=3 SV=1 1592 1991 1.0E-27
sp|Q03855|YD11B_YEAST Transposon Ty1-DR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR1 PE=3 SV=2 1592 1991 1.0E-27
sp|P25384|YC21B_YEAST Transposon Ty2-C Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-C PE=3 SV=2 1592 1991 1.0E-27
sp|P0C2I7|YL14B_YEAST Transposon Ty1-LR4 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR4 PE=5 SV=1 1592 1991 1.0E-27
sp|P0C2I3|YD15B_YEAST Transposon Ty1-DR6 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR6 PE=3 SV=1 1592 1991 1.0E-27
sp|P92519|M810_ARATH Uncharacterized mitochondrial protein AtMg00810 OS=Arabidopsis thaliana GN=AtMg00810 PE=4 SV=1 1771 1999 1.0E-27
sp|Q07163|TY1AB_YEASX Transposon TyH3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae GN=TY1B PE=1 SV=2 1592 1990 1.0E-27
sp|Q12472|YD21B_YEAST Transposon Ty2-DR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR1 PE=1 SV=3 1592 1991 1.0E-27
sp|Q12337|YG21B_YEAST Transposon Ty2-GR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-GR1 PE=5 SV=2 1592 1991 2.0E-27
sp|Q12491|YB21B_YEAST Transposon Ty2-B Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-B PE=3 SV=1 1592 1991 2.0E-27
sp|Q99231|YD12B_YEAST Transposon Ty1-DR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR3 PE=1 SV=2 1592 1991 3.0E-27
sp|P04146|COPIA_DROME Copia protein OS=Drosophila melanogaster GN=GIP PE=1 SV=3 968 1296 3.0E-27
sp|P47100|YJ12B_YEAST Transposon Ty1-JR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-JR2 PE=3 SV=3 1592 1990 9.0E-27
sp|Q99337|YN12B_YEAST Transposon Ty1-NL2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-NL2 PE=3 SV=1 1592 1991 1.0E-26
sp|Q07791|YD23B_YEAST Transposon Ty2-DR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR3 PE=3 SV=1 1592 1991 1.0E-26
sp|Q12141|YG11B_YEAST Transposon Ty1-GR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR1 PE=3 SV=1 1592 1990 1.0E-26
sp|O13527|YA11B_YEAST Truncated transposon Ty1-A Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-A PE=3 SV=3 1592 1990 2.0E-26
sp|Q12490|YB11B_YEAST Transposon Ty1-BL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-BL PE=1 SV=1 1592 1990 2.0E-26
sp|P0C2I5|YL12B_YEAST Transposon Ty1-LR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR2 PE=3 SV=1 1592 1990 2.0E-26
sp|Q12414|YP11B_YEAST Transposon Ty1-PL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PL PE=3 SV=1 1592 1990 2.0E-26
sp|Q12273|YO11B_YEAST Transposon Ty1-OL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-OL PE=3 SV=1 1592 1990 3.0E-26
sp|Q03434|YM12B_YEAST Transposon Ty1-ML2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ML2 PE=3 SV=2 1592 1990 3.0E-26
sp|Q03612|YE11B_YEAST Transposon Ty1-ER1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ER1 PE=3 SV=1 1592 1990 3.0E-26
sp|P0C2I2|YD14B_YEAST Transposon Ty1-DR5 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR5 PE=3 SV=1 1592 1990 3.0E-26
sp|P0C2J0|YP13B_YEAST Transposon Ty1-PR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR2 PE=3 SV=1 1592 1990 3.0E-26
sp|Q12112|YN11B_YEAST Transposon Ty1-NL1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-NL1 PE=3 SV=1 1592 1990 4.0E-26
sp|Q12269|YG12B_YEAST Transposon Ty1-GR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR2 PE=3 SV=3 1592 1991 4.0E-26
sp|Q04711|YM11B_YEAST Transposon Ty1-ML1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ML1 PE=3 SV=2 1592 1990 4.0E-26
sp|Q12316|YG13B_YEAST Transposon Ty1-GR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR3 PE=3 SV=3 1592 1990 9.0E-26
sp|Q92393|YO12B_YEAST Transposon Ty1-OR Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-OR PE=3 SV=1 1592 1990 9.0E-26
sp|Q04214|YM13B_YEAST Transposon Ty1-MR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-MR1 PE=1 SV=2 1592 1990 1.0E-25
sp|P47024|YJ41B_YEAST Transposon Ty4-J Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY4B-J PE=3 SV=3 1592 1988 1.0E-25
sp|Q12193|YB12B_YEAST Transposon Ty1-BR Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-BR PE=3 SV=1 1592 1990 2.0E-25
sp|P0C2J7|YH41B_YEAST Transposon Ty4-H Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY4B-H PE=3 SV=1 1592 1988 2.0E-25
sp|P47098|YJ11B_YEAST Transposon Ty1-JR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-JR1 PE=3 SV=3 1592 1990 2.0E-25
sp|P0C2I6|YL13B_YEAST Transposon Ty1-LR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR3 PE=3 SV=1 1592 1991 3.0E-25
sp|P0C2I9|YP12B_YEAST Transposon Ty1-PR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR1 PE=3 SV=1 1592 1991 3.0E-25
sp|P0C2J1|YP14B_YEAST Transposon Ty1-PR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR3 PE=1 SV=1 1592 1990 3.0E-25
sp|O13535|YH11B_YEAST Transposon Ty1-H Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-H PE=3 SV=1 1621 1990 6.0E-25
sp|Q04670|YM14B_YEAST Transposon Ty1-MR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-MR2 PE=3 SV=2 1592 1990 2.0E-24
sp|Q03619|YE12B_YEAST Transposon Ty1-ER2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ER2 PE=3 SV=1 1592 1990 3.0E-24
sp|Q12088|YL11B_YEAST Transposon Ty1-LR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR1 PE=3 SV=1 1592 1990 1.0E-23
sp|Q07793|YD13B_YEAST Transposon Ty1-DR4 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR4 PE=3 SV=2 1592 1926 3.0E-22
sp|P0C2J5|YL22B_YEAST Transposon Ty2-LR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-LR2 PE=5 SV=1 1592 1895 8.0E-17
sp|P92520|M820_ARATH Uncharacterized mitochondrial protein AtMg00820 OS=Arabidopsis thaliana GN=AtMg00820 PE=4 SV=1 1595 1675 2.0E-12
sp|A0A0B7P3V8|YP41B_YEAST Transposon Ty4-P Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY4B-P PE=5 SV=2 1113 1234 3.0E-09
sp|P47024|YJ41B_YEAST Transposon Ty4-J Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY4B-J PE=3 SV=3 1153 1234 4.0E-09
sp|P0C2J7|YH41B_YEAST Transposon Ty4-H Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY4B-H PE=3 SV=1 1113 1234 4.0E-09
sp|P93290|M240_ARATH Uncharacterized mitochondrial protein AtMg00240 OS=Arabidopsis thaliana GN=AtMg00240 PE=4 SV=1 1879 1956 2.0E-08
sp|Q07791|YD23B_YEAST Transposon Ty2-DR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR3 PE=3 SV=1 1033 1234 4.0E-06
sp|Q12472|YD21B_YEAST Transposon Ty2-DR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR1 PE=1 SV=3 1033 1234 4.0E-06
sp|P25384|YC21B_YEAST Transposon Ty2-C Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-C PE=3 SV=2 1033 1234 4.0E-06
sp|P0C2J5|YL22B_YEAST Transposon Ty2-LR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-LR2 PE=5 SV=1 1033 1234 4.0E-06
sp|Q12113|YO21B_YEAST Transposon Ty2-OR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-OR1 PE=3 SV=1 1033 1234 4.0E-06
sp|Q12501|YO22B_YEAST Transposon Ty2-OR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-OR2 PE=1 SV=1 1033 1234 4.0E-06
sp|Q12337|YG21B_YEAST Transposon Ty2-GR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-GR1 PE=5 SV=2 1033 1234 4.0E-06
sp|Q12491|YB21B_YEAST Transposon Ty2-B Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-B PE=3 SV=1 1033 1234 4.0E-06
sp|Q03494|YD22B_YEAST Transposon Ty2-DR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR2 PE=3 SV=2 1033 1234 4.0E-06
sp|P0CX63|YF21B_YEAST Transposon Ty2-F Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-F PE=3 SV=1 1033 1234 5.0E-06
sp|P0C2J3|YL21B_YEAST Transposon Ty2-LR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-LR1 PE=3 SV=1 1033 1234 5.0E-06
sp|P0CX64|YG22B_YEAST Transposon Ty2-GR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-GR2 PE=3 SV=1 1033 1234 5.0E-06
sp|O13527|YA11B_YEAST Truncated transposon Ty1-A Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-A PE=3 SV=3 1141 1234 8.0E-06
sp|P0C2I5|YL12B_YEAST Transposon Ty1-LR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR2 PE=3 SV=1 1141 1234 8.0E-06
sp|Q04670|YM14B_YEAST Transposon Ty1-MR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-MR2 PE=3 SV=2 1141 1234 8.0E-06
sp|P47098|YJ11B_YEAST Transposon Ty1-JR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-JR1 PE=3 SV=3 1141 1234 8.0E-06
sp|Q12273|YO11B_YEAST Transposon Ty1-OL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-OL PE=3 SV=1 1141 1234 8.0E-06
sp|P0C2I7|YL14B_YEAST Transposon Ty1-LR4 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR4 PE=5 SV=1 1141 1234 8.0E-06
sp|Q07793|YD13B_YEAST Transposon Ty1-DR4 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR4 PE=3 SV=2 1141 1234 8.0E-06
sp|P47100|YJ12B_YEAST Transposon Ty1-JR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-JR2 PE=3 SV=3 1141 1234 8.0E-06
sp|Q99231|YD12B_YEAST Transposon Ty1-DR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR3 PE=1 SV=2 1141 1234 8.0E-06
sp|Q04711|YM11B_YEAST Transposon Ty1-ML1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ML1 PE=3 SV=2 1141 1234 8.0E-06
sp|Q12141|YG11B_YEAST Transposon Ty1-GR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR1 PE=3 SV=1 1141 1234 9.0E-06
sp|Q03855|YD11B_YEAST Transposon Ty1-DR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR1 PE=3 SV=2 1141 1234 9.0E-06
sp|Q07163|TY1AB_YEASX Transposon TyH3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae GN=TY1B PE=1 SV=2 1141 1234 9.0E-06
sp|O13535|YH11B_YEAST Transposon Ty1-H Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-H PE=3 SV=1 1141 1234 9.0E-06
sp|Q12490|YB11B_YEAST Transposon Ty1-BL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-BL PE=1 SV=1 1141 1234 9.0E-06
sp|P0C2I9|YP12B_YEAST Transposon Ty1-PR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR1 PE=3 SV=1 1141 1234 9.0E-06
sp|Q12414|YP11B_YEAST Transposon Ty1-PL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PL PE=3 SV=1 1141 1234 9.0E-06
sp|Q03434|YM12B_YEAST Transposon Ty1-ML2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ML2 PE=3 SV=2 1141 1234 9.0E-06
sp|Q03612|YE11B_YEAST Transposon Ty1-ER1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ER1 PE=3 SV=1 1141 1234 9.0E-06
sp|Q12193|YB12B_YEAST Transposon Ty1-BR Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-BR PE=3 SV=1 1141 1234 9.0E-06
sp|P0C2I2|YD14B_YEAST Transposon Ty1-DR5 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR5 PE=3 SV=1 1141 1234 9.0E-06
sp|Q12269|YG12B_YEAST Transposon Ty1-GR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR2 PE=3 SV=3 1141 1234 9.0E-06
sp|Q92393|YO12B_YEAST Transposon Ty1-OR Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-OR PE=3 SV=1 1141 1234 9.0E-06
sp|P0C2J1|YP14B_YEAST Transposon Ty1-PR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR3 PE=1 SV=1 1141 1234 1.0E-05
sp|Q12316|YG13B_YEAST Transposon Ty1-GR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR3 PE=3 SV=3 1141 1234 1.0E-05
sp|P0C2I6|YL13B_YEAST Transposon Ty1-LR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR3 PE=3 SV=1 1141 1234 1.0E-05
sp|P0C2I3|YD15B_YEAST Transposon Ty1-DR6 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR6 PE=3 SV=1 1141 1234 1.0E-05
sp|Q04214|YM13B_YEAST Transposon Ty1-MR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-MR1 PE=1 SV=2 1141 1234 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0015074 DNA integration Yes
GO:0008150 biological_process No
GO:0006259 DNA metabolic process No
GO:0044238 primary metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0009987 cellular process No
GO:0071704 organic substance metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0008152 metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0044237 cellular metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|039900
MGPGWANVGTTTNALPKLSGAKDYDTWARRVKNALILMQHKDSPLTAWDVSGSSQPLPTLPTVPSELAKENAIRM
TLSLQATALIESTLPDYMIREEFNSPGDLWGKMKLNYGVRGPTFVYERLQALINFKVQDTQDPSGQIAEFIAICS
QITATGATLHDSLQTMMLLSALPARMESTIGIILASAAKVADLTIEKARGIITAAWRNPQNLAAARFKPSGQAPR
WQNATPGTSGQNQQQQQRPHGQQQQRPQGQQQRQQAPQGAKPDNDKKHKRTRGKGKGKGKGKAAAVEASPPDYTA
ASAIAFPTIAIPPGFEAQPYDPRSPSLSAPTTRSLVHRIRNEKAAITPPTPLIGELSHTTSQSSPDEISVHSPLH
TEIIMLNIHDGNEWIDDWRHDVDYQNSIESNPNYLESVDPSADGTWLDDESREQSISVDCDRPFWALYGMPNDNI
ERTVPSNQSDDVKSITRDSSESAARGWTTNNMGNDWDNQWLEPFSRPMDWNVEPAGSSTTSFRDAWDNANRFPID
DTSFEIPSNLSWGELIERGYSIDDINVIPFPVWESPSDDRILSGELSSNASVKFGSAIDYWLTDINNGYCDMFSD
NDELTHSPPSHYSYTWSFDLRHHYDLPFSLDDVITENELPHGRTYKWIRGRYTDITFMELDIDWIAPTGAQRTRD
PRLNVARTGRVTPYQTAKLNALLAWDKRLGARPIDRIALATHNEEATRPDETPSEYHTVAEEPERRSGSPIDYAI
EEFGNSVIEEKEDGEISIHSGQDLMDNEEEIDYDAENEGDSYSQVLPLNSRSITNSSFQRGDARSSSRGGPIPYG
TSQCLSQAWTECRKDLDSPNTSCNGSDINYAMELSVRNALLDNITPEFKSFIMSIRSNSDSYPIKWMLDSGASAH
FTGSLSDFSTVDRGFFGMVQTASGQLKIQGRGTVHIQHLVVDINTGTKEVQRTKLWPVFYINGMHMWLISVGQLL
RSGLRLEANAKHLTFRDENNHAVLSGISGHFPSISAILSRIIQEIPETGAYATTNTDYSTWHRRLGHPSDLVLSK
FSKESLGVPPISIPRDKPVCKGCVEGKFAQKPFPTSESRGTQVLELIHLDLFELPVISYHRHKWVLTILDDYSST
AFTVMLAHKSDAPREMTKVMTLLANSTDRKIKRLRTDRGGEYTNSALQEYLSTNGIKHELSAPNVHQQNGRAERL
NRTLHEKSQAMRKHACLPDSWWGFSMTYAVYIYNRTPMQRMKWKTPYELFYGTKPDLSKIRVFGCGAYVYLPKEI
RKNKLSSRSELMIFLGYQGPNYQFMRHQNGNVIFVSPTALFDEAFLPKCDKSKPGNLEKRLSNTPSRSNSSESEN
SRNGGEVDFNLDHNSLNGPSTDQPPINRAPPAAPPRPPTPPQPIVPPRQQRAPSPPPRNATPGPSNQPPRQERPT
WRKRRDITPPDESEHNVRRSRRETKVPNRPDNVYGDKHPSKVLRDYERQPFLPDFEERIQQRVPPRSDRQNARIP
TDDQADEARREEIRRHFEQASQRADEYEREHGSQLPSQFGDAPVPGEATMDEVQVLIREGGVRLNNFLFELANQI
QTPVQFKDLTQLPAAMRKKWIDACLEELEALQKRGVYELVDLPKGRRTIKNRWVFNEKSDGRLRARLVAKGFSQI
EGIDYNELFSPVVRYETARLLLGIAALEDWDMFSVDVKTAYLYGKLDEEIYMTQPEGFTATSKENKVWRLRRALY
GLKQAGLSWWKQLTASMTEIGFVRCKSDAGVYYYRHPKTRELVVALVYVDDVAFMGKKNSQLLKELKLKFSTKWE
CCDQGVMTEFLGMQISRDRQNKKIFLHQQKYLQKVLDRFGIKSGSEETPLPKGYVFKTSDKVPNNGFRTKYQQLV
GSLMYLMIGSRPDIAFAVVKLAQHMVTPNKEHYTAGMHLLRYLNGTKNMVLEFDGNSNQGVIAYSDSDWASDPED
RKSITGNFVTIANGTISWLSRKQKTVALSSTEAEYMAISDCSRQLVWVS*
Coding >AgabiH97|039900
ATGGGCCCCGGTTGGGCAAATGTTGGCACTACCACCAATGCTCTCCCCAAGCTCTCCGGCGCCAAGGACTACGAC
ACTTGGGCCCGTCGCGTCAAGAACGCACTGATCCTTATGCAGCATAAGGACTCCCCCCTGACCGCATGGGACGTT
AGCGGCAGCTCTCAGCCGCTCCCCACCTTGCCTACCGTTCCCTCTGAACTAGCCAAGGAAAATGCTATCAGAATG
ACTCTCAGCCTGCAGGCAACTGCGCTAATCGAGTCCACTCTCCCGGATTACATGATCCGAGAGGAATTCAACAGC
CCTGGAGACCTCTGGGGCAAAATGAAGTTGAATTACGGAGTCCGAGGACCAACTTTCGTCTACGAAAGGCTCCAG
GCCCTCATAAACTTTAAGGTTCAGGACACGCAGGATCCATCTGGACAAATCGCTGAGTTCATCGCGATCTGTTCA
CAGATCACTGCCACTGGGGCGACTCTTCATGACTCGCTCCAGACCATGATGCTCCTCTCCGCTCTTCCGGCTCGT
ATGGAATCTACGATCGGAATCATCCTCGCTTCGGCTGCGAAAGTAGCTGATCTCACTATTGAGAAAGCGAGAGGT
ATTATCACCGCGGCTTGGCGAAACCCTCAGAATCTCGCCGCCGCCAGGTTTAAGCCGTCCGGACAGGCTCCGCGA
TGGCAGAATGCCACGCCTGGAACATCCGGGCAAAATCAGCAGCAGCAGCAGCGTCCTCATGGACAGCAGCAGCAA
CGGCCGCAAGGCCAGCAGCAGAGGCAACAAGCTCCGCAAGGAGCTAAACCTGATAATGATAAAAAGCACAAGAGG
ACTCGTGGCAAAGGCAAGGGAAAGGGTAAAGGAAAAGCCGCAGCGGTCGAGGCCTCGCCTCCCGATTACACTGCA
GCTTCTGCAATCGCGTTTCCTACGATCGCCATTCCTCCGGGCTTCGAAGCTCAACCCTACGACCCTCGTTCTCCC
TCTCTCTCTGCACCGACCACACGGTCTTTAGTGCATCGCATCCGAAATGAGAAAGCAGCTATTACGCCGCCGACT
CCCTTGATTGGTGAGTTGTCTCATACTACATCGCAATCATCTCCTGACGAAATTTCTGTGCACTCTCCCCTTCAC
ACGGAAATCATCATGTTGAATATCCATGATGGAAACGAATGGATTGATGATTGGCGTCACGACGTCGATTACCAA
AACTCGATCGAATCTAACCCGAATTATCTCGAATCGGTTGATCCATCTGCTGATGGAACCTGGCTCGATGATGAA
TCTCGGGAACAATCAATCTCGGTTGATTGTGATCGACCCTTTTGGGCCTTATATGGTATGCCTAATGACAACATC
GAACGCACGGTTCCCTCGAACCAATCCGATGACGTCAAATCCATAACGCGCGATTCTTCTGAATCTGCTGCACGT
GGATGGACAACCAATAATATGGGTAACGACTGGGATAACCAATGGCTGGAACCATTTTCCCGGCCTATGGACTGG
AACGTTGAACCTGCCGGTTCTTCTACCACTTCCTTTCGTGATGCATGGGATAACGCTAACCGCTTTCCCATCGAT
GATACGTCATTCGAAATCCCTTCCAACCTCTCCTGGGGTGAATTAATCGAACGGGGATATTCCATTGACGACATA
AATGTCATACCATTCCCTGTATGGGAATCACCATCGGACGATCGCATCCTCTCGGGTGAACTGTCGTCCAATGCC
TCTGTTAAATTCGGATCTGCCATCGACTATTGGCTGACCGACATTAACAATGGATATTGTGACATGTTTTCGGAT
AACGACGAACTTACACATTCCCCTCCCTCGCACTATTCGTACACATGGTCGTTCGACCTCCGACATCATTACGAT
CTGCCGTTCTCTTTGGACGACGTGATCACGGAAAACGAACTTCCTCACGGACGAACATACAAATGGATCCGCGGC
CGCTATACCGATATTACCTTCATGGAACTCGATATAGATTGGATCGCTCCAACTGGTGCACAACGGACACGAGAC
CCTCGTCTCAACGTCGCTCGGACTGGTAGGGTCACACCTTACCAAACGGCTAAACTCAATGCCCTCCTCGCCTGG
GACAAACGTCTCGGTGCTCGACCTATTGATAGAATCGCTCTAGCGACTCACAATGAGGAAGCAACGAGGCCCGAT
GAAACTCCATCCGAGTATCACACGGTAGCAGAAGAACCGGAAAGACGATCCGGATCGCCTATTGATTATGCGATC
GAGGAATTTGGGAATTCTGTGATAGAAGAGAAGGAAGACGGTGAGATCTCGATCCATTCCGGGCAAGACCTGATG
GATAACGAAGAAGAAATCGACTATGATGCTGAGAACGAAGGGGACTCATACTCGCAAGTATTACCCCTTAACTCG
CGGTCAATTACTAATTCTTCTTTTCAGCGCGGTGATGCCCGCTCCAGTTCAAGAGGAGGACCGATACCTTATGGG
ACCAGCCAATGCCTATCTCAGGCTTGGACCGAGTGCCGGAAGGATCTAGATAGTCCTAATACCTCATGTAACGGT
TCGGATATAAATTATGCGATGGAATTGAGTGTCAGGAACGCTCTTCTCGATAACATCACGCCTGAATTTAAGTCA
TTCATCATGAGCATAAGATCAAACTCTGATTCTTATCCGATTAAGTGGATGCTAGATAGTGGCGCTTCTGCGCAC
TTTACTGGCAGTCTCTCAGACTTTTCTACAGTCGATCGAGGCTTCTTTGGAATGGTACAAACCGCCTCTGGCCAA
TTAAAAATCCAAGGCCGAGGAACAGTACACATCCAACACTTAGTTGTTGATATAAACACAGGAACCAAAGAAGTT
CAAAGGACTAAACTTTGGCCTGTCTTTTACATAAATGGTATGCACATGTGGCTCATCTCTGTCGGACAACTTTTA
CGGTCCGGACTAAGATTAGAAGCCAATGCGAAGCATCTCACCTTTCGAGATGAAAATAATCATGCTGTACTTTCG
GGTATCTCGGGACACTTTCCCAGTATTTCCGCCATCCTTTCCAGGATCATTCAGGAAATCCCCGAAACTGGTGCT
TATGCAACCACAAACACTGATTATTCTACCTGGCATCGTCGATTAGGACATCCGTCCGATCTCGTGTTGAGTAAA
TTCTCTAAAGAATCTTTAGGTGTTCCACCTATTAGTATTCCACGAGATAAACCAGTTTGTAAAGGGTGCGTTGAA
GGTAAATTCGCGCAGAAACCCTTTCCCACTTCAGAAAGCCGAGGAACACAAGTTCTTGAGTTAATCCATTTGGAT
CTATTCGAACTTCCGGTAATCTCTTATCACCGCCATAAATGGGTATTAACCATATTGGATGACTATTCCAGTACG
GCATTCACCGTAATGCTTGCCCACAAGAGTGATGCACCTCGAGAGATGACGAAAGTCATGACGTTGCTCGCTAAC
TCCACTGATCGAAAGATCAAGAGACTGCGCACTGATCGAGGAGGAGAATATACCAATAGTGCTCTGCAAGAGTAC
TTGTCTACCAACGGCATTAAACATGAGCTTTCTGCCCCTAATGTTCACCAACAAAATGGGCGCGCTGAAAGACTC
AATAGAACGTTGCACGAGAAATCACAAGCCATGCGCAAACATGCATGCCTTCCCGACTCATGGTGGGGCTTCTCT
ATGACGTACGCGGTCTATATTTACAACCGCACGCCTATGCAGCGAATGAAGTGGAAAACTCCGTATGAATTATTC
TACGGAACCAAACCGGACTTATCGAAAATCCGAGTGTTTGGCTGTGGTGCTTATGTATATCTTCCAAAAGAAATA
CGTAAAAACAAGCTCTCTTCACGATCCGAGCTTATGATATTTTTGGGATACCAAGGCCCAAATTATCAATTTATG
AGACACCAAAACGGAAATGTAATTTTCGTTTCTCCCACAGCCCTTTTCGATGAAGCTTTTCTTCCGAAATGCGAT
AAATCGAAACCAGGTAACCTCGAAAAAAGATTGAGTAATACTCCGAGCCGAAGTAATTCCTCGGAATCAGAGAAC
TCCAGAAATGGAGGAGAAGTCGATTTTAATCTCGACCATAATTCCCTTAATGGTCCCTCTACAGATCAACCACCT
ATTAATAGAGCTCCACCAGCAGCACCGCCGCGTCCTCCAACGCCGCCGCAGCCGATAGTGCCACCACGGCAACAA
AGAGCTCCATCACCACCTCCTCGTAATGCAACTCCCGGCCCGTCCAACCAGCCTCCACGGCAGGAACGGCCAACA
TGGAGAAAACGGCGTGATATCACTCCGCCTGATGAATCAGAACATAATGTTAGAAGGTCTAGACGGGAAACTAAA
GTACCGAACCGACCAGATAACGTCTATGGGGATAAACACCCATCGAAAGTTCTGAGAGATTACGAGAGACAACCT
TTCTTGCCGGACTTCGAAGAAAGAATCCAGCAAAGGGTACCTCCAAGATCTGATAGACAGAACGCTCGTATACCA
ACCGACGATCAAGCTGATGAAGCACGTCGCGAAGAAATTCGCAGACACTTCGAACAAGCTAGTCAACGGGCTGAC
GAATACGAACGAGAGCATGGCTCTCAACTTCCTTCCCAATTTGGCGATGCTCCGGTCCCTGGAGAAGCCACTATG
GACGAAGTTCAAGTTCTAATCAGAGAAGGAGGAGTAAGGTTAAATAACTTTCTCTTTGAACTTGCAAATCAGATC
CAAACGCCAGTCCAATTTAAGGACTTAACGCAACTACCTGCAGCAATGCGGAAGAAATGGATTGATGCTTGTTTG
GAGGAATTAGAAGCCTTACAGAAACGTGGTGTTTATGAATTAGTAGATCTCCCGAAAGGTCGAAGAACTATTAAA
AATAGATGGGTCTTTAATGAGAAAAGCGATGGCCGCCTTCGCGCTCGATTAGTCGCAAAAGGATTCTCTCAAATT
GAAGGAATCGACTACAACGAGCTCTTCTCTCCAGTAGTCCGCTATGAAACTGCCCGTCTTCTTCTAGGCATCGCT
GCCCTTGAAGATTGGGATATGTTTAGTGTTGACGTAAAAACTGCCTATTTATATGGCAAACTGGATGAGGAAATC
TATATGACGCAACCCGAAGGATTCACAGCCACCAGCAAAGAAAATAAGGTCTGGAGATTACGCCGAGCATTGTAC
GGCCTTAAGCAAGCCGGGTTAAGTTGGTGGAAACAATTAACCGCCAGCATGACCGAAATCGGTTTTGTCCGATGC
AAATCCGATGCAGGCGTGTATTATTATCGTCATCCAAAGACGCGTGAACTTGTAGTTGCGCTTGTCTATGTTGAT
GATGTAGCCTTCATGGGAAAGAAAAACTCCCAGCTCCTCAAAGAGTTGAAGCTAAAGTTCTCAACCAAATGGGAA
TGTTGTGATCAAGGTGTTATGACGGAATTTCTCGGTATGCAAATATCTCGAGATCGTCAGAACAAGAAAATCTTC
TTGCATCAGCAGAAGTACCTCCAGAAGGTCCTTGATCGATTCGGTATTAAATCCGGATCTGAAGAAACACCGTTA
CCGAAAGGTTACGTGTTCAAAACCTCCGATAAAGTACCAAACAATGGATTCAGAACGAAGTACCAACAGTTGGTC
GGATCATTGATGTACCTCATGATCGGATCACGACCGGATATTGCATTTGCCGTTGTAAAATTAGCACAGCACATG
GTGACTCCAAATAAAGAGCATTATACTGCCGGCATGCACCTTCTTCGGTACCTTAATGGCACTAAAAATATGGTT
CTTGAGTTTGATGGTAACTCGAATCAAGGTGTCATAGCCTATTCCGATTCGGATTGGGCTTCTGATCCAGAAGAC
CGGAAATCAATTACCGGCAACTTTGTTACAATCGCTAACGGAACTATTTCCTGGCTGAGTCGTAAACAAAAGACT
GTTGCACTCTCATCGACGGAAGCCGAATATATGGCTATCTCTGATTGTTCGCGACAATTAGTTTGGGTCTCCTAA
Transcript >AgabiH97|039900
ATGGGCCCCGGTTGGGCAAATGTTGGCACTACCACCAATGCTCTCCCCAAGCTCTCCGGCGCCAAGGACTACGAC
ACTTGGGCCCGTCGCGTCAAGAACGCACTGATCCTTATGCAGCATAAGGACTCCCCCCTGACCGCATGGGACGTT
AGCGGCAGCTCTCAGCCGCTCCCCACCTTGCCTACCGTTCCCTCTGAACTAGCCAAGGAAAATGCTATCAGAATG
ACTCTCAGCCTGCAGGCAACTGCGCTAATCGAGTCCACTCTCCCGGATTACATGATCCGAGAGGAATTCAACAGC
CCTGGAGACCTCTGGGGCAAAATGAAGTTGAATTACGGAGTCCGAGGACCAACTTTCGTCTACGAAAGGCTCCAG
GCCCTCATAAACTTTAAGGTTCAGGACACGCAGGATCCATCTGGACAAATCGCTGAGTTCATCGCGATCTGTTCA
CAGATCACTGCCACTGGGGCGACTCTTCATGACTCGCTCCAGACCATGATGCTCCTCTCCGCTCTTCCGGCTCGT
ATGGAATCTACGATCGGAATCATCCTCGCTTCGGCTGCGAAAGTAGCTGATCTCACTATTGAGAAAGCGAGAGGT
ATTATCACCGCGGCTTGGCGAAACCCTCAGAATCTCGCCGCCGCCAGGTTTAAGCCGTCCGGACAGGCTCCGCGA
TGGCAGAATGCCACGCCTGGAACATCCGGGCAAAATCAGCAGCAGCAGCAGCGTCCTCATGGACAGCAGCAGCAA
CGGCCGCAAGGCCAGCAGCAGAGGCAACAAGCTCCGCAAGGAGCTAAACCTGATAATGATAAAAAGCACAAGAGG
ACTCGTGGCAAAGGCAAGGGAAAGGGTAAAGGAAAAGCCGCAGCGGTCGAGGCCTCGCCTCCCGATTACACTGCA
GCTTCTGCAATCGCGTTTCCTACGATCGCCATTCCTCCGGGCTTCGAAGCTCAACCCTACGACCCTCGTTCTCCC
TCTCTCTCTGCACCGACCACACGGTCTTTAGTGCATCGCATCCGAAATGAGAAAGCAGCTATTACGCCGCCGACT
CCCTTGATTGGTGAGTTGTCTCATACTACATCGCAATCATCTCCTGACGAAATTTCTGTGCACTCTCCCCTTCAC
ACGGAAATCATCATGTTGAATATCCATGATGGAAACGAATGGATTGATGATTGGCGTCACGACGTCGATTACCAA
AACTCGATCGAATCTAACCCGAATTATCTCGAATCGGTTGATCCATCTGCTGATGGAACCTGGCTCGATGATGAA
TCTCGGGAACAATCAATCTCGGTTGATTGTGATCGACCCTTTTGGGCCTTATATGGTATGCCTAATGACAACATC
GAACGCACGGTTCCCTCGAACCAATCCGATGACGTCAAATCCATAACGCGCGATTCTTCTGAATCTGCTGCACGT
GGATGGACAACCAATAATATGGGTAACGACTGGGATAACCAATGGCTGGAACCATTTTCCCGGCCTATGGACTGG
AACGTTGAACCTGCCGGTTCTTCTACCACTTCCTTTCGTGATGCATGGGATAACGCTAACCGCTTTCCCATCGAT
GATACGTCATTCGAAATCCCTTCCAACCTCTCCTGGGGTGAATTAATCGAACGGGGATATTCCATTGACGACATA
AATGTCATACCATTCCCTGTATGGGAATCACCATCGGACGATCGCATCCTCTCGGGTGAACTGTCGTCCAATGCC
TCTGTTAAATTCGGATCTGCCATCGACTATTGGCTGACCGACATTAACAATGGATATTGTGACATGTTTTCGGAT
AACGACGAACTTACACATTCCCCTCCCTCGCACTATTCGTACACATGGTCGTTCGACCTCCGACATCATTACGAT
CTGCCGTTCTCTTTGGACGACGTGATCACGGAAAACGAACTTCCTCACGGACGAACATACAAATGGATCCGCGGC
CGCTATACCGATATTACCTTCATGGAACTCGATATAGATTGGATCGCTCCAACTGGTGCACAACGGACACGAGAC
CCTCGTCTCAACGTCGCTCGGACTGGTAGGGTCACACCTTACCAAACGGCTAAACTCAATGCCCTCCTCGCCTGG
GACAAACGTCTCGGTGCTCGACCTATTGATAGAATCGCTCTAGCGACTCACAATGAGGAAGCAACGAGGCCCGAT
GAAACTCCATCCGAGTATCACACGGTAGCAGAAGAACCGGAAAGACGATCCGGATCGCCTATTGATTATGCGATC
GAGGAATTTGGGAATTCTGTGATAGAAGAGAAGGAAGACGGTGAGATCTCGATCCATTCCGGGCAAGACCTGATG
GATAACGAAGAAGAAATCGACTATGATGCTGAGAACGAAGGGGACTCATACTCGCAAGTATTACCCCTTAACTCG
CGGTCAATTACTAATTCTTCTTTTCAGCGCGGTGATGCCCGCTCCAGTTCAAGAGGAGGACCGATACCTTATGGG
ACCAGCCAATGCCTATCTCAGGCTTGGACCGAGTGCCGGAAGGATCTAGATAGTCCTAATACCTCATGTAACGGT
TCGGATATAAATTATGCGATGGAATTGAGTGTCAGGAACGCTCTTCTCGATAACATCACGCCTGAATTTAAGTCA
TTCATCATGAGCATAAGATCAAACTCTGATTCTTATCCGATTAAGTGGATGCTAGATAGTGGCGCTTCTGCGCAC
TTTACTGGCAGTCTCTCAGACTTTTCTACAGTCGATCGAGGCTTCTTTGGAATGGTACAAACCGCCTCTGGCCAA
TTAAAAATCCAAGGCCGAGGAACAGTACACATCCAACACTTAGTTGTTGATATAAACACAGGAACCAAAGAAGTT
CAAAGGACTAAACTTTGGCCTGTCTTTTACATAAATGGTATGCACATGTGGCTCATCTCTGTCGGACAACTTTTA
CGGTCCGGACTAAGATTAGAAGCCAATGCGAAGCATCTCACCTTTCGAGATGAAAATAATCATGCTGTACTTTCG
GGTATCTCGGGACACTTTCCCAGTATTTCCGCCATCCTTTCCAGGATCATTCAGGAAATCCCCGAAACTGGTGCT
TATGCAACCACAAACACTGATTATTCTACCTGGCATCGTCGATTAGGACATCCGTCCGATCTCGTGTTGAGTAAA
TTCTCTAAAGAATCTTTAGGTGTTCCACCTATTAGTATTCCACGAGATAAACCAGTTTGTAAAGGGTGCGTTGAA
GGTAAATTCGCGCAGAAACCCTTTCCCACTTCAGAAAGCCGAGGAACACAAGTTCTTGAGTTAATCCATTTGGAT
CTATTCGAACTTCCGGTAATCTCTTATCACCGCCATAAATGGGTATTAACCATATTGGATGACTATTCCAGTACG
GCATTCACCGTAATGCTTGCCCACAAGAGTGATGCACCTCGAGAGATGACGAAAGTCATGACGTTGCTCGCTAAC
TCCACTGATCGAAAGATCAAGAGACTGCGCACTGATCGAGGAGGAGAATATACCAATAGTGCTCTGCAAGAGTAC
TTGTCTACCAACGGCATTAAACATGAGCTTTCTGCCCCTAATGTTCACCAACAAAATGGGCGCGCTGAAAGACTC
AATAGAACGTTGCACGAGAAATCACAAGCCATGCGCAAACATGCATGCCTTCCCGACTCATGGTGGGGCTTCTCT
ATGACGTACGCGGTCTATATTTACAACCGCACGCCTATGCAGCGAATGAAGTGGAAAACTCCGTATGAATTATTC
TACGGAACCAAACCGGACTTATCGAAAATCCGAGTGTTTGGCTGTGGTGCTTATGTATATCTTCCAAAAGAAATA
CGTAAAAACAAGCTCTCTTCACGATCCGAGCTTATGATATTTTTGGGATACCAAGGCCCAAATTATCAATTTATG
AGACACCAAAACGGAAATGTAATTTTCGTTTCTCCCACAGCCCTTTTCGATGAAGCTTTTCTTCCGAAATGCGAT
AAATCGAAACCAGGTAACCTCGAAAAAAGATTGAGTAATACTCCGAGCCGAAGTAATTCCTCGGAATCAGAGAAC
TCCAGAAATGGAGGAGAAGTCGATTTTAATCTCGACCATAATTCCCTTAATGGTCCCTCTACAGATCAACCACCT
ATTAATAGAGCTCCACCAGCAGCACCGCCGCGTCCTCCAACGCCGCCGCAGCCGATAGTGCCACCACGGCAACAA
AGAGCTCCATCACCACCTCCTCGTAATGCAACTCCCGGCCCGTCCAACCAGCCTCCACGGCAGGAACGGCCAACA
TGGAGAAAACGGCGTGATATCACTCCGCCTGATGAATCAGAACATAATGTTAGAAGGTCTAGACGGGAAACTAAA
GTACCGAACCGACCAGATAACGTCTATGGGGATAAACACCCATCGAAAGTTCTGAGAGATTACGAGAGACAACCT
TTCTTGCCGGACTTCGAAGAAAGAATCCAGCAAAGGGTACCTCCAAGATCTGATAGACAGAACGCTCGTATACCA
ACCGACGATCAAGCTGATGAAGCACGTCGCGAAGAAATTCGCAGACACTTCGAACAAGCTAGTCAACGGGCTGAC
GAATACGAACGAGAGCATGGCTCTCAACTTCCTTCCCAATTTGGCGATGCTCCGGTCCCTGGAGAAGCCACTATG
GACGAAGTTCAAGTTCTAATCAGAGAAGGAGGAGTAAGGTTAAATAACTTTCTCTTTGAACTTGCAAATCAGATC
CAAACGCCAGTCCAATTTAAGGACTTAACGCAACTACCTGCAGCAATGCGGAAGAAATGGATTGATGCTTGTTTG
GAGGAATTAGAAGCCTTACAGAAACGTGGTGTTTATGAATTAGTAGATCTCCCGAAAGGTCGAAGAACTATTAAA
AATAGATGGGTCTTTAATGAGAAAAGCGATGGCCGCCTTCGCGCTCGATTAGTCGCAAAAGGATTCTCTCAAATT
GAAGGAATCGACTACAACGAGCTCTTCTCTCCAGTAGTCCGCTATGAAACTGCCCGTCTTCTTCTAGGCATCGCT
GCCCTTGAAGATTGGGATATGTTTAGTGTTGACGTAAAAACTGCCTATTTATATGGCAAACTGGATGAGGAAATC
TATATGACGCAACCCGAAGGATTCACAGCCACCAGCAAAGAAAATAAGGTCTGGAGATTACGCCGAGCATTGTAC
GGCCTTAAGCAAGCCGGGTTAAGTTGGTGGAAACAATTAACCGCCAGCATGACCGAAATCGGTTTTGTCCGATGC
AAATCCGATGCAGGCGTGTATTATTATCGTCATCCAAAGACGCGTGAACTTGTAGTTGCGCTTGTCTATGTTGAT
GATGTAGCCTTCATGGGAAAGAAAAACTCCCAGCTCCTCAAAGAGTTGAAGCTAAAGTTCTCAACCAAATGGGAA
TGTTGTGATCAAGGTGTTATGACGGAATTTCTCGGTATGCAAATATCTCGAGATCGTCAGAACAAGAAAATCTTC
TTGCATCAGCAGAAGTACCTCCAGAAGGTCCTTGATCGATTCGGTATTAAATCCGGATCTGAAGAAACACCGTTA
CCGAAAGGTTACGTGTTCAAAACCTCCGATAAAGTACCAAACAATGGATTCAGAACGAAGTACCAACAGTTGGTC
GGATCATTGATGTACCTCATGATCGGATCACGACCGGATATTGCATTTGCCGTTGTAAAATTAGCACAGCACATG
GTGACTCCAAATAAAGAGCATTATACTGCCGGCATGCACCTTCTTCGGTACCTTAATGGCACTAAAAATATGGTT
CTTGAGTTTGATGGTAACTCGAATCAAGGTGTCATAGCCTATTCCGATTCGGATTGGGCTTCTGATCCAGAAGAC
CGGAAATCAATTACCGGCAACTTTGTTACAATCGCTAACGGAACTATTTCCTGGCTGAGTCGTAAACAAAAGACT
GTTGCACTCTCATCGACGGAAGCCGAATATATGGCTATCTCTGATTGTTCGCGACAATTAGTTTGGGTCTCCTAA
Gene >AgabiH97|039900
ATGGGCCCCGGTTGGTGCATCTATGGATGATCGTTTGATCTCTAGACCAACCGCTTTTGGATGGACATTCTCTAG
CCCATTTAGAATAGCCTATAGATAGCATGTCATACCCTAGATCAGAGACTTACTGACCGATCTGGGTTGCAGGGC
AAATGTTGGCACTACCACCAATGCTCTCCCCAAGCTCTCCGGCGCCAAGGACTACGACACTTGGGCCCGTCGCGT
CAAGAACGCACTGATCCTTATGCAGCATAAGGACTCCCCCCTGACCGCATGGGACGTTAGCGGCAGCTCTCAGCC
GCTCCCCACCTTGCCTACCGTTCCCTCTGAACTAGCCAAGGAAAATGCTATCAGAATGACTCTCAGCCTGCAGGC
AACTGCGCTAATCGAGTCCACTCTCCCGGATTACATGATCCGAGAGGAATTCAACAGCCCTGGAGACCTCTGGGG
CAAAATGAAGTTGAATTACGGAGTCCGAGGACCAACTTTCGTCTACGAAAGGCTCCAGGCCCTCATAAACTTTAA
GGTTCAGGACACGCAGGATCCATCTGGACAAATCGCTGAGTTCATCGCGATCTGTTCACAGATCACTGCCACTGG
GGCGACTCTTCATGACTCGCTCCAGACCATGATGCTCCTCTCCGCTCTTCCGGCTCGTATGGAATCTACGATCGG
AATCATCCTCGCTTCGGCTGCGAAAGTAGCTGATCTCACTATTGAGAAAGCGAGAGGTATTATCACCGCGGCTTG
GCGAAACCCTCAGAATCTCGCCGCCGCCAGGTTTAAGCCGTCCGGACAGGCTCCGCGATGGCAGAATGCCACGCC
TGGAACATCCGGGCAAAATCAGCAGCAGCAGCAGCGTCCTCATGGACAGCAGCAGCAACGGCCGCAAGGCCAGCA
GCAGAGGCAACAAGCTCCGCAAGGAGCTAAACCTGATAATGATAAAAAGCACAAGAGGACTCGTGGCAAAGGCAA
GGGAAAGGGTAAAGGAAAAGCCGCAGCGGTCGAGGCCTCGCCTCCCGATTACACTGCAGCTTCTGCAATCGCGTT
TCCTACGATCGCCATTCCTCCGGGCTTCGAAGCTCAACCCTACGACCCTCGTTCTCCCTCTCTCTCTGCACCGAC
CACACGGTCTTTAGTGCATCGCATCCGAAATGAGAAAGCAGCTATTACGCCGCCGACTCCCTTGATTGGTGAGTT
GTCTCATACTACATCGCAATCATCTCCTGACGAAATTTCTGTGCACTCTCCCCTTCACACGGAAATCATCATGTT
GAATATCCATGATGGAAACGAATGGATTGATGATTGGCGTCACGACGTCGATTACCAAAACTCGATCGAATCTAA
CCCGAATTATCTCGAATCGGTTGATCCATCTGCTGATGGAACCTGGCTCGATGATGAATCTCGGGAACAATCAAT
CTCGGTTGATTGTGATCGACCCTTTTGGGCCTTATATGGTATGCCTAATGACAACATCGAACGCACGGTTCCCTC
GAACCAATCCGATGACGTCAAATCCATAACGCGCGATTCTTCTGAATCTGCTGCACGTGGATGGACAACCAATAA
TATGGGTAACGACTGGGATAACCAATGGCTGGAACCATTTTCCCGGCCTATGGACTGGAACGTTGAACCTGCCGG
TTCTTCTACCACTTCCTTTCGTGATGCATGGGATAACGCTAACCGCTTTCCCATCGATGATACGTCATTCGAAAT
CCCTTCCAACCTCTCCTGGGGTGAATTAATCGAACGGGGATATTCCATTGACGACATAAATGTCATACCATTCCC
TGTATGGGAATCACCATCGGACGATCGCATCCTCTCGGGTGAACTGTCGTCCAATGCCTCTGTTAAATTCGGATC
TGCCATCGACTATTGGCTGACCGACATTAACAATGGATATTGTGACATGTTTTCGGATAACGACGAACTTACACA
TTCCCCTCCCTCGCACTATTCGTACACATGGTCGTTCGACCTCCGACATCATTACGATCTGCCGTTCTCTTTGGA
CGACGTGATCACGGAAAACGAACTTCCTCACGGACGAACATACAAATGGATCCGCGGCCGCTATACCGATATTAC
CTTCATGGAACTCGATATAGATTGGATCGCTCCAACTGGTGCACAACGGACACGAGACCCTCGTCTCAACGTCGC
TCGGACTGGTAGGGTCACACCTTACCAAACGGCTAAACTCAATGCCCTCCTCGCCTGGGACAAACGTCTCGGTGC
TCGACCTATTGATAGAATCGCTCTAGCGACTCACAATGAGGAAGCAACGAGGCCCGATGAAACTCCATCCGAGTA
TCACACGGTAGCAGAAGAACCGGAAAGACGATCCGGATCGCCTATTGATTATGCGATCGAGGAATTTGGGAATTC
TGTGATAGAAGAGAAGGAAGACGGTGAGATCTCGATCCATTCCGGGCAAGACCTGATGGATAACGAAGAAGAAAT
CGACTATGATGCTGAGAACGAAGGGGACTCATACTCGCAAGTATTACCCCTTAACTCGCGGTCAATTACTAATTC
TTCTTTTCAGCGCGGTGATGCCCGCTCCAGTTCAAGAGGAGGACCGATACCTTATGGGACCAGCCAATGCCTATC
TCAGGCTTGGACCGAGTGCCGGAAGGATCTAGATAGTCCTAATACCTCATGTAACGGTTCGGATATAAATTATGC
GATGGAATTGAGTGTCAGGAACGCTCTTCTCGATAACATCACGCCTGAATTTAAGTCATTCATCATGAGCATAAG
ATCAAACTCTGATTCTTATCCGATTAAGTGGATGCTAGATAGTGGCGCTTCTGCGCACTTTACTGGCAGTCTCTC
AGACTTTTCTACAGTCGATCGAGGCTTCTTTGGAATGGTACAAACCGCCTCTGGCCAATTAAAAATCCAAGGCCG
AGGAACAGTACACATCCAACACTTAGTTGTTGATATAAACACAGGAACCAAAGAAGTTCAAAGGACTAAACTTTG
GCCTGTCTTTTACATAAATGGTATGCACATGTGGCTCATCTCTGTCGGACAACTTTTACGGTCCGGACTAAGATT
AGAAGCCAATGCGAAGCATCTCACCTTTCGAGATGAAAATAATCATGCTGTACTTTCGGGTATCTCGGGACACTT
TCCCAGTATTTCCGCCATCCTTTCCAGGATCATTCAGGAAATCCCCGAAACTGGTGCTTATGCAACCACAAACAC
TGATTATTCTACCTGGCATCGTCGATTAGGACATCCGTCCGATCTCGTGTTGAGTAAATTCTCTAAAGAATCTTT
AGGTGTTCCACCTATTAGTATTCCACGAGATAAACCAGTTTGTAAAGGGTGCGTTGAAGGTAAATTCGCGCAGAA
ACCCTTTCCCACTTCAGAAAGCCGAGGAACACAAGTTCTTGAGTTAATCCATTTGGATCTATTCGAACTTCCGGT
AATCTCTTATCACCGCCATAAATGGGTATTAACCATATTGGATGACTATTCCAGTACGGCATTCACCGTAATGCT
TGCCCACAAGAGTGATGCACCTCGAGAGATGACGAAAGTCATGACGTTGCTCGCTAACTCCACTGATCGAAAGAT
CAAGAGACTGCGCACTGATCGAGGAGGAGAATATACCAATAGTGCTCTGCAAGAGTACTTGTCTACCAACGGCAT
TAAACATGAGCTTTCTGCCCCTAATGTTCACCAACAAAATGGGCGCGCTGAAAGACTCAATAGAACGTTGCACGA
GAAATCACAAGCCATGCGCAAACATGCATGCCTTCCCGACTCATGGTGGGGCTTCTCTATGACGTACGCGGTCTA
TATTTACAACCGCACGCCTATGCAGCGAATGAAGTGGAAAACTCCGTATGAATTATTCTACGGAACCAAACCGGA
CTTATCGAAAATCCGAGTGTTTGGCTGTGGTGCTTATGTATATCTTCCAAAAGAAATACGTAAAAACAAGCTCTC
TTCACGATCCGAGCTTATGATATTTTTGGGATACCAAGGCCCAAATTATCAATTTATGAGACACCAAAACGGAAA
TGTAATTTTCGTTTCTCCCACAGCCCTTTTCGATGAAGCTTTTCTTCCGAAATGCGATAAATCGAAACCAGGTAA
CCTCGAAAAAAGATTGAGTAATACTCCGAGCCGAAGTAATTCCTCGGAATCAGAGAACTCCAGAAATGGAGGAGA
AGTCGATTTTAATCTCGACCATAATTCCCTTAATGGTCCCTCTACAGATCAACCACCTATTAATAGAGCTCCACC
AGCAGCACCGCCGCGTCCTCCAACGCCGCCGCAGCCGATAGTGCCACCACGGCAACAAAGAGCTCCATCACCACC
TCCTCGTAATGCAACTCCCGGCCCGTCCAACCAGCCTCCACGGCAGGAACGGCCAACATGGAGAAAACGGCGTGA
TATCACTCCGCCTGATGAATCAGAACATAATGTTAGAAGGTCTAGACGGGAAACTAAAGTACCGAACCGACCAGA
TAACGTCTATGGGGATAAACACCCATCGAAAGTTCTGAGAGATTACGAGAGACAACCTTTCTTGCCGGACTTCGA
AGAAAGAATCCAGCAAAGGGTACCTCCAAGATCTGATAGACAGAACGCTCGTATACCAACCGACGATCAAGCTGA
TGAAGCACGTCGCGAAGAAATTCGCAGACACTTCGAACAAGCTAGTCAACGGGCTGACGAATACGAACGAGAGCA
TGGCTCTCAACTTCCTTCCCAATTTGGCGATGCTCCGGTCCCTGGAGAAGCCACTATGGACGAAGTTCAAGTTCT
AATCAGAGAAGGAGGAGTAAGGTTAAATAACTTTCTCTTTGAACTTGCAAATCAGATCCAAACGCCAGTCCAATT
TAAGGACTTAACGCAACTACCTGCAGCAATGCGGAAGAAATGGATTGATGCTTGTTTGGAGGAATTAGAAGCCTT
ACAGAAACGTGGTGTTTATGAATTAGTAGATCTCCCGAAAGGTCGAAGAACTATTAAAAATAGATGGGTCTTTAA
TGAGAAAAGCGATGGCCGCCTTCGCGCTCGATTAGTCGCAAAAGGATTCTCTCAAATTGAAGGAATCGACTACAA
CGAGCTCTTCTCTCCAGTAGTCCGCTATGAAACTGCCCGTCTTCTTCTAGGCATCGCTGCCCTTGAAGATTGGGA
TATGTTTAGTGTTGACGTAAAAACTGCCTATTTATATGGCAAACTGGATGAGGAAATCTATATGACGCAACCCGA
AGGATTCACAGCCACCAGCAAAGAAAATAAGGTCTGGAGATTACGCCGAGCATTGTACGGCCTTAAGCAAGCCGG
GTTAAGTTGGTGGAAACAATTAACCGCCAGCATGACCGAAATCGGTTTTGTCCGATGCAAATCCGATGCAGGCGT
GTATTATTATCGTCATCCAAAGACGCGTGAACTTGTAGTTGCGCTTGTCTATGTTGATGATGTAGCCTTCATGGG
AAAGAAAAACTCCCAGCTCCTCAAAGAGTTGAAGCTAAAGTTCTCAACCAAATGGGAATGTTGTGATCAAGGTGT
TATGACGGAATTTCTCGGTATGCAAATATCTCGAGATCGTCAGAACAAGAAAATCTTCTTGCATCAGCAGAAGTA
CCTCCAGAAGGTCCTTGATCGATTCGGTATTAAATCCGGATCTGAAGAAACACCGTTACCGAAAGGTTACGTGTT
CAAAACCTCCGATAAAGTACCAAACAATGGATTCAGAACGAAGTACCAACAGTTGGTCGGATCATTGATGTACCT
CATGATCGGATCACGACCGGATATTGCATTTGCCGTTGTAAAATTAGCACAGCACATGGTGACTCCAAATAAAGA
GCATTATACTGCCGGCATGCACCTTCTTCGGTACCTTAATGGCACTAAAAATATGGTTCTTGAGTTTGATGGTAA
CTCGAATCAAGGTGTCATAGCCTATTCCGATTCGGATTGGGCTTCTGATCCAGAAGACCGGAAATCAATTACCGG
CAACTTTGTTACAATCGCTAACGGAACTATTTCCTGGCTGAGTCGTAAACAAAAGACTGTTGCACTCTCATCGAC
GGAAGCCGAATATATGGCTATCTCTGATTGTTCGCGACAATTAGTTTGGGTCTCCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail