Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|039850
Gene name
Locationscaffold_2:342126..344373
Strand-
Gene length (bp)2247
Transcript length (bp)2247
Coding sequence length (bp)2247
Protein length (aa) 749

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF17917 RT_RNaseH RNase H-like domain found in reverse transcriptase 1.0E-38 508 610
PF17919 RT_RNaseH_2 RNase H-like domain found in reverse transcriptase 1.1E-37 480 576
PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase) 3.0E-19 255 414
PF08284 RVP_2 Retroviral aspartyl protease 4.4E-09 34 132
PF13975 gag-asp_proteas gag-polyprotein putative aspartyl protease 6.6E-08 26 117
PF13650 Asp_protease_2 Aspartyl protease 2.1E-06 25 115

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P0CT38|TF25_SCHPO Transposon Tf2-5 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-5 PE=3 SV=1 30 640 4.0E-90
sp|P0CT39|TF26_SCHPO Transposon Tf2-6 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-6 PE=3 SV=1 30 640 4.0E-90
sp|P0CT41|TF212_SCHPO Transposon Tf2-12 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-12 PE=3 SV=1 30 640 4.0E-90
sp|P0CT36|TF23_SCHPO Transposon Tf2-3 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-3 PE=1 SV=1 30 640 4.0E-90
sp|P0CT40|TF29_SCHPO Transposon Tf2-9 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-9 PE=3 SV=1 30 640 5.0E-90
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P0CT38|TF25_SCHPO Transposon Tf2-5 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-5 PE=3 SV=1 30 640 4.0E-90
sp|P0CT39|TF26_SCHPO Transposon Tf2-6 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-6 PE=3 SV=1 30 640 4.0E-90
sp|P0CT41|TF212_SCHPO Transposon Tf2-12 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-12 PE=3 SV=1 30 640 4.0E-90
sp|P0CT36|TF23_SCHPO Transposon Tf2-3 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-3 PE=1 SV=1 30 640 4.0E-90
sp|P0CT40|TF29_SCHPO Transposon Tf2-9 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-9 PE=3 SV=1 30 640 5.0E-90
sp|P0CT34|TF21_SCHPO Transposon Tf2-1 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-1 PE=3 SV=1 30 640 5.0E-90
sp|P0CT35|TF22_SCHPO Transposon Tf2-2 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-2 PE=3 SV=1 30 640 5.0E-90
sp|P0CT37|TF24_SCHPO Transposon Tf2-4 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-4 PE=3 SV=1 30 640 5.0E-90
sp|P0CT43|TF28_SCHPO Transposon Tf2-8 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-8 PE=3 SV=1 30 640 1.0E-89
sp|P0CT42|TF27_SCHPO Transposon Tf2-7 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-7 PE=3 SV=1 30 640 1.0E-89
sp|Q9UR07|TF211_SCHPO Transposon Tf2-11 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-11 PE=3 SV=1 30 640 3.0E-89
sp|Q7LHG5|YI31B_YEAST Transposon Ty3-I Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY3B-I PE=3 SV=2 218 734 1.0E-80
sp|P04323|POL3_DROME Retrovirus-related Pol polyprotein from transposon 17.6 OS=Drosophila melanogaster GN=pol PE=3 SV=1 191 631 2.0E-80
sp|Q99315|YG31B_YEAST Transposon Ty3-G Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY3B-G PE=1 SV=3 218 734 4.0E-80
sp|P20825|POL2_DROME Retrovirus-related Pol polyprotein from transposon 297 OS=Drosophila melanogaster GN=pol PE=3 SV=1 188 631 6.0E-79
sp|Q8I7P9|POL5_DROME Retrovirus-related Pol polyprotein from transposon opus OS=Drosophila melanogaster GN=pol PE=3 SV=1 208 631 4.0E-68
sp|P10401|POLY_DROME Retrovirus-related Pol polyprotein from transposon gypsy OS=Drosophila melanogaster GN=pol PE=3 SV=1 104 630 2.0E-62
sp|P10394|POL4_DROME Retrovirus-related Pol polyprotein from transposon 412 OS=Drosophila melanogaster GN=POL PE=3 SV=1 213 631 8.0E-57
sp|P09523|POL_FMVD Enzymatic polyprotein OS=Figwort mosaic virus (strain DxS) GN=ORF V PE=3 SV=1 213 630 2.0E-42
sp|P03555|POL_CAMVC Enzymatic polyprotein OS=Cauliflower mosaic virus (strain CM-1841) GN=ORF V PE=3 SV=1 29 630 1.0E-41
sp|P05400|POL_CERV Enzymatic polyprotein OS=Carnation etched ring virus GN=ORF V PE=3 SV=1 211 628 1.0E-41
sp|Q00962|POL_CAMVN Enzymatic polyprotein OS=Cauliflower mosaic virus (strain NY8153) GN=ORF V PE=3 SV=1 213 630 2.0E-41
sp|Q02964|POL_CAMVE Enzymatic polyprotein OS=Cauliflower mosaic virus (strain BBC) GN=ORF V PE=3 SV=1 213 630 2.0E-41
sp|P03554|POL_CAMVS Enzymatic polyprotein OS=Cauliflower mosaic virus (strain Strasbourg) GN=ORF V PE=3 SV=1 29 630 4.0E-41
sp|P03556|POL_CAMVD Enzymatic polyprotein OS=Cauliflower mosaic virus (strain D/H) GN=ORF V PE=3 SV=1 213 630 8.0E-40
sp|P19199|POL_COYMV Polyprotein P3 OS=Commelina yellow mottle virus PE=3 SV=2 220 632 4.0E-34
sp|A6NKG5|RTL1_HUMAN Retrotransposon-like protein 1 OS=Homo sapiens GN=RTL1 PE=3 SV=3 30 625 9.0E-33
sp|Q91DM0|POLG_PVCV1 Genome polyprotein OS=Petunia vein clearing virus (isolate Shepherd) PE=3 SV=1 185 630 5.0E-32
sp|Q6XKE6|POLG_PVCV2 Genome polyprotein OS=Petunia vein clearing virus (isolate Hohn) PE=3 SV=1 185 630 5.0E-32
sp|Q89703|POL_CSVMV Putative enzymatic polyprotein OS=Cassava vein mosaic virus GN=ORF 3 PE=3 SV=1 222 636 2.0E-30
sp|Q52QI2|RTL1_BOVIN Retrotransposon-like protein 1 OS=Bos taurus GN=RTL1 PE=2 SV=2 30 624 2.0E-28
sp|Q7M732|RTL1_MOUSE Retrotransposon-like protein 1 OS=Mus musculus GN=Rtl1 PE=2 SV=1 30 625 3.0E-28
sp|P27502|POL_RTBVP Polyprotein P3 OS=Rice tungro bacilliform virus (isolate Philippines) PE=1 SV=1 33 667 2.0E-25
sp|P15629|POL_SOCMV Enzymatic polyprotein OS=Soybean chlorotic mottle virus GN=ORF V PE=3 SV=2 201 637 1.0E-23
sp|Q7TD08|POL_CYLCV Enzymatic polyprotein OS=Cestrum yellow leaf curling virus GN=ORF V PE=3 SV=1 241 630 5.0E-23
sp|A1Z651|POL_XMRV6 Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP62) GN=gag-pol PE=1 SV=1 211 560 7.0E-23
sp|Q2F7J3|POL_XMRV3 Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP35) GN=gag-pol PE=1 SV=1 211 560 7.0E-23
sp|Q2F7J0|POL_XMRV4 Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP42) GN=gag-pol PE=3 SV=1 211 560 8.0E-23
sp|P21414|POL_GALV Pol polyprotein OS=Gibbon ape leukemia virus GN=pol PE=3 SV=1 36 565 1.0E-22
sp|P10272|POL_BAEVM Pol polyprotein OS=Baboon endogenous virus (strain M7) GN=pol PE=3 SV=1 213 611 1.0E-22
sp|P26808|POL_MLVFP Pol polyprotein OS=Friend murine leukemia virus (isolate PVC-211) GN=pol PE=3 SV=1 209 560 1.0E-22
sp|P03355|POL_MLVMS Gag-Pol polyprotein OS=Moloney murine leukemia virus (isolate Shinnick) GN=gag-pol PE=1 SV=4 211 560 2.0E-22
sp|O92815|POL_WDSV Gag-Pol polyprotein OS=Walleye dermal sarcoma virus GN=gag-pol PE=1 SV=2 246 584 2.0E-22
sp|P26809|POL_MLVFF Pol polyprotein OS=Friend murine leukemia virus (isolate FB29) GN=pol PE=3 SV=1 211 560 2.0E-22
sp|P31792|POL_FENV1 Pol polyprotein (Fragment) OS=Feline endogenous virus ECE1 GN=pol PE=3 SV=1 213 550 3.0E-22
sp|P26810|POL_MLVF5 Pol polyprotein OS=Friend murine leukemia virus (isolate 57) GN=pol PE=3 SV=1 211 560 4.0E-22
sp|P03356|POL_MLVAV Pol polyprotein OS=AKV murine leukemia virus GN=pol PE=3 SV=2 211 611 7.0E-22
sp|P11227|POL_MLVRD Pol polyprotein OS=Radiation murine leukemia virus GN=pol PE=3 SV=1 211 560 9.0E-22
sp|Q9TTC1|POL_KORV Pro-Pol polyprotein OS=Koala retrovirus GN=pro-pol PE=3 SV=1 168 565 1.0E-19
sp|O93209|POL_FFV Pro-Pol polyprotein OS=Feline foamy virus GN=pol PE=3 SV=1 199 564 1.0E-19
sp|P14350|POL_FOAMV Pro-Pol polyprotein OS=Human spumaretrovirus GN=pol PE=1 SV=2 198 564 2.0E-19
sp|P31843|RRPO_OENBE RNA-directed DNA polymerase homolog OS=Oenothera berteroana PE=4 SV=1 261 357 9.0E-19
sp|Q09575|YRD6_CAEEL Uncharacterized protein K02A2.6 OS=Caenorhabditis elegans GN=K02A2.6 PE=3 SV=1 248 459 1.0E-18
sp|Q87040|POL_SFVCP Pro-Pol polyprotein OS=Simian foamy virus (isolate chimpanzee) GN=pol PE=3 SV=1 198 564 2.0E-18
sp|P92523|M860_ARATH Uncharacterized mitochondrial protein AtMg00860 OS=Arabidopsis thaliana GN=AtMg00860 PE=4 SV=1 387 529 2.0E-16
sp|P27401|POL_SFV3L Pro-Pol polyprotein OS=Simian foamy virus type 3 (strain LK3) GN=pol PE=3 SV=2 19 564 2.0E-15
sp|P23074|POL_SFV1 Pro-Pol polyprotein OS=Simian foamy virus type 1 GN=pol PE=1 SV=3 198 564 2.0E-14
sp|Q9P2P1|NYNRI_HUMAN Protein NYNRIN OS=Homo sapiens GN=NYNRIN PE=2 SV=3 418 543 2.0E-11
sp|Q5DTZ0|NYNRI_MOUSE Protein NYNRIN OS=Mus musculus GN=Nynrin PE=2 SV=2 418 543 3.0E-09
sp|P31623|POL_JSRV Pol polyprotein OS=Sheep pulmonary adenomatosis virus GN=pol PE=3 SV=1 222 533 1.0E-08
sp|Q86TG7|PEG10_HUMAN Retrotransposon-derived protein PEG10 OS=Homo sapiens GN=PEG10 PE=1 SV=2 8 309 2.0E-08
sp|P07572|POL_MPMV Pol polyprotein OS=Mason-Pfizer monkey virus GN=pol PE=3 SV=1 222 498 4.0E-08
sp|P03365|POL_MMTVB Pol polyprotein OS=Mouse mammary tumor virus (strain BR6) GN=pol PE=3 SV=2 222 470 9.0E-08
sp|P04025|POL_SRV1 Pol polyprotein OS=Simian retrovirus SRV-1 GN=pol PE=3 SV=1 222 467 1.0E-07
sp|P11283|POL_MMTVC Gag-Pro-Pol polyprotein OS=Mouse mammary tumor virus (strain C3H) GN=gag-pro-pol PE=1 SV=2 222 470 1.0E-07
sp|P03364|POL_SMRVH Pol polyprotein OS=Squirrel monkey retrovirus GN=pol PE=3 SV=2 231 470 2.0E-07
sp|P51517|POL_SRV2 Pol polyprotein OS=Simian retrovirus SRV-2 GN=pol PE=3 SV=1 222 470 4.0E-07
sp|Q4U0X6|POL_HTL3P Gag-Pro-Pol polyprotein OS=Human T-cell leukemia virus 3 (strain Pyl43) GN=gag-pro-pol PE=3 SV=4 210 533 4.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 64 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|039850
MNNRYVVPQKRLGVQELEVKPILTTTNGKKLKVSAMVDSGCTHTCINEGLVKKKKIPTKKLERLITCRNSDGTIA
GKKDITKFAKIDININGHNEQLDAVVTPLQSSDLFLGHDWLTNHNPEINWKQGIIKFNRCPTSCSFPHTDISFKP
RIRRLQSNEDTEEKEPDPTNPEDLPAYMKPFAHLFNKKNFDKLPERTEWDHEVNFTENAPTEISSKVYSMTPLER
EELDKFLNENLATNRIRPSKSPYAAPCFFVPKKDGSLRLCQDYRKLNEITIKDKTPLPLISEVLDQLRDAKVFNK
LDIIWGYNNVRIREGDEWKAAFLTNRGLFEPTVMFFGMSNSPATFSRMMATIFREMIQDGSLANYMDDFIIPAKN
DEELEARTLRFLKIAEKHNLSFKRTKCEFNVSSTTVLGTVIGNGKATMEEEKVKAIRDWAVPTTVKQVESFLGFA
NFYRRFIKNFSTIAQPLNELKSKKGEKWYWNDEQQQAFEQIKQAIASEPVLALPKDKGQFRVEVDASNYGTGAVL
SQEQEDKWHPVAFMSKTLSEAERNYEIYDKELLAIIKALKLWRHYLLDAKEQFEIWTDHENLKYFREPQKLNARQ
ARWYLMLQEYDFLLRHIPGKTNTKADILSRLIKPDTSNDNRGVEMFKEKMFIRRLEESIPIYDITLLHNRRFEII
ADETLLEKIRKCERRETRVIEEMKKQPEKVWENNGIIYRQGRIYVPDNQEIRDFILHDHHNSPTPDILERTEC*
Coding >AgabiH97|039850
ATGAACAATCGATACGTTGTCCCTCAAAAACGTCTAGGAGTGCAAGAACTGGAAGTAAAACCCATCCTCACTACA
ACAAACGGAAAGAAACTCAAAGTCTCAGCCATGGTCGACTCGGGGTGCACACACACATGTATCAACGAAGGACTA
GTAAAGAAGAAGAAGATCCCGACGAAGAAACTGGAACGGCTGATCACATGCAGGAATTCAGATGGAACGATAGCA
GGAAAGAAGGATATCACTAAATTCGCGAAAATAGACATAAACATCAACGGTCATAACGAACAACTGGACGCGGTC
GTCACTCCCTTACAATCATCCGATCTCTTTCTAGGTCATGATTGGTTAACGAACCACAACCCCGAGATCAATTGG
AAACAAGGAATTATCAAATTCAACCGGTGCCCCACATCATGTTCTTTTCCCCATACCGACATCTCTTTCAAACCA
CGTATACGACGATTACAATCAAACGAAGACACTGAGGAAAAAGAACCGGATCCAACGAACCCTGAAGACTTACCA
GCATACATGAAACCCTTCGCCCATCTTTTCAACAAAAAGAACTTCGACAAGCTACCTGAACGAACGGAATGGGAT
CACGAAGTTAACTTCACGGAAAACGCACCAACGGAGATATCATCAAAGGTTTATAGCATGACACCACTGGAGAGA
GAAGAACTGGACAAATTCTTGAATGAAAACCTGGCTACCAATCGAATCCGACCATCGAAATCACCCTATGCAGCA
CCATGTTTTTTCGTTCCCAAGAAAGACGGTTCACTACGGTTATGTCAGGATTATAGGAAACTGAATGAAATCACG
ATCAAAGACAAGACGCCACTACCCCTCATCAGTGAAGTATTAGATCAACTCAGAGACGCCAAGGTTTTCAACAAA
TTGGACATTATCTGGGGGTATAACAACGTTCGGATACGAGAAGGAGATGAATGGAAAGCAGCGTTCTTGACGAAT
CGCGGATTATTTGAACCAACGGTCATGTTCTTTGGAATGAGTAATTCCCCCGCCACCTTCTCACGTATGATGGCG
ACAATCTTTCGAGAAATGATACAAGACGGATCTTTAGCCAACTACATGGATGATTTCATCATTCCAGCAAAGAAC
GATGAGGAATTGGAAGCACGGACTTTACGTTTTCTCAAAATCGCGGAGAAACACAATTTATCATTTAAACGGACG
AAATGCGAGTTCAATGTCTCATCAACAACGGTGTTAGGAACGGTTATCGGGAACGGAAAGGCAACAATGGAAGAA
GAAAAGGTCAAGGCAATACGAGATTGGGCAGTCCCTACCACGGTCAAACAAGTCGAAAGCTTTTTAGGTTTTGCC
AACTTCTATCGACGATTTATCAAGAATTTCAGCACCATCGCGCAACCACTAAACGAGCTGAAGTCTAAGAAGGGG
GAGAAATGGTATTGGAACGATGAACAACAACAAGCTTTCGAACAAATCAAACAGGCTATCGCCAGCGAACCGGTC
CTAGCGTTACCCAAGGACAAAGGACAATTCAGGGTTGAAGTAGACGCATCAAACTATGGAACAGGAGCAGTACTA
TCACAGGAACAAGAAGACAAATGGCACCCGGTCGCCTTCATGTCGAAAACATTATCTGAAGCCGAACGAAACTAC
GAGATCTACGACAAGGAACTACTAGCCATCATAAAAGCCTTGAAACTATGGAGACACTACCTATTGGATGCAAAG
GAGCAATTTGAGATATGGACTGATCACGAGAACCTCAAATATTTCCGAGAACCTCAAAAGCTCAATGCTCGACAG
GCAAGATGGTACCTCATGCTACAGGAATACGATTTCCTCCTACGACACATTCCTGGGAAGACGAACACCAAAGCA
GACATCCTGTCAAGACTAATCAAACCTGACACATCTAACGACAATCGAGGAGTAGAAATGTTCAAGGAGAAAATG
TTCATCCGAAGACTTGAAGAATCCATTCCCATCTATGACATCACCTTACTCCACAATCGAAGATTCGAAATCATA
GCCGATGAAACCTTACTTGAGAAGATTAGGAAATGTGAAAGACGAGAAACCAGAGTAATAGAAGAGATGAAGAAG
CAGCCAGAAAAAGTATGGGAGAACAATGGAATCATTTACCGACAAGGAAGGATCTATGTTCCGGATAATCAGGAG
ATCAGAGATTTCATTCTTCACGATCATCATAATTCCCCGACGCCGGACATCCTGGAACGTACCGAATGCTAG
Transcript >AgabiH97|039850
ATGAACAATCGATACGTTGTCCCTCAAAAACGTCTAGGAGTGCAAGAACTGGAAGTAAAACCCATCCTCACTACA
ACAAACGGAAAGAAACTCAAAGTCTCAGCCATGGTCGACTCGGGGTGCACACACACATGTATCAACGAAGGACTA
GTAAAGAAGAAGAAGATCCCGACGAAGAAACTGGAACGGCTGATCACATGCAGGAATTCAGATGGAACGATAGCA
GGAAAGAAGGATATCACTAAATTCGCGAAAATAGACATAAACATCAACGGTCATAACGAACAACTGGACGCGGTC
GTCACTCCCTTACAATCATCCGATCTCTTTCTAGGTCATGATTGGTTAACGAACCACAACCCCGAGATCAATTGG
AAACAAGGAATTATCAAATTCAACCGGTGCCCCACATCATGTTCTTTTCCCCATACCGACATCTCTTTCAAACCA
CGTATACGACGATTACAATCAAACGAAGACACTGAGGAAAAAGAACCGGATCCAACGAACCCTGAAGACTTACCA
GCATACATGAAACCCTTCGCCCATCTTTTCAACAAAAAGAACTTCGACAAGCTACCTGAACGAACGGAATGGGAT
CACGAAGTTAACTTCACGGAAAACGCACCAACGGAGATATCATCAAAGGTTTATAGCATGACACCACTGGAGAGA
GAAGAACTGGACAAATTCTTGAATGAAAACCTGGCTACCAATCGAATCCGACCATCGAAATCACCCTATGCAGCA
CCATGTTTTTTCGTTCCCAAGAAAGACGGTTCACTACGGTTATGTCAGGATTATAGGAAACTGAATGAAATCACG
ATCAAAGACAAGACGCCACTACCCCTCATCAGTGAAGTATTAGATCAACTCAGAGACGCCAAGGTTTTCAACAAA
TTGGACATTATCTGGGGGTATAACAACGTTCGGATACGAGAAGGAGATGAATGGAAAGCAGCGTTCTTGACGAAT
CGCGGATTATTTGAACCAACGGTCATGTTCTTTGGAATGAGTAATTCCCCCGCCACCTTCTCACGTATGATGGCG
ACAATCTTTCGAGAAATGATACAAGACGGATCTTTAGCCAACTACATGGATGATTTCATCATTCCAGCAAAGAAC
GATGAGGAATTGGAAGCACGGACTTTACGTTTTCTCAAAATCGCGGAGAAACACAATTTATCATTTAAACGGACG
AAATGCGAGTTCAATGTCTCATCAACAACGGTGTTAGGAACGGTTATCGGGAACGGAAAGGCAACAATGGAAGAA
GAAAAGGTCAAGGCAATACGAGATTGGGCAGTCCCTACCACGGTCAAACAAGTCGAAAGCTTTTTAGGTTTTGCC
AACTTCTATCGACGATTTATCAAGAATTTCAGCACCATCGCGCAACCACTAAACGAGCTGAAGTCTAAGAAGGGG
GAGAAATGGTATTGGAACGATGAACAACAACAAGCTTTCGAACAAATCAAACAGGCTATCGCCAGCGAACCGGTC
CTAGCGTTACCCAAGGACAAAGGACAATTCAGGGTTGAAGTAGACGCATCAAACTATGGAACAGGAGCAGTACTA
TCACAGGAACAAGAAGACAAATGGCACCCGGTCGCCTTCATGTCGAAAACATTATCTGAAGCCGAACGAAACTAC
GAGATCTACGACAAGGAACTACTAGCCATCATAAAAGCCTTGAAACTATGGAGACACTACCTATTGGATGCAAAG
GAGCAATTTGAGATATGGACTGATCACGAGAACCTCAAATATTTCCGAGAACCTCAAAAGCTCAATGCTCGACAG
GCAAGATGGTACCTCATGCTACAGGAATACGATTTCCTCCTACGACACATTCCTGGGAAGACGAACACCAAAGCA
GACATCCTGTCAAGACTAATCAAACCTGACACATCTAACGACAATCGAGGAGTAGAAATGTTCAAGGAGAAAATG
TTCATCCGAAGACTTGAAGAATCCATTCCCATCTATGACATCACCTTACTCCACAATCGAAGATTCGAAATCATA
GCCGATGAAACCTTACTTGAGAAGATTAGGAAATGTGAAAGACGAGAAACCAGAGTAATAGAAGAGATGAAGAAG
CAGCCAGAAAAAGTATGGGAGAACAATGGAATCATTTACCGACAAGGAAGGATCTATGTTCCGGATAATCAGGAG
ATCAGAGATTTCATTCTTCACGATCATCATAATTCCCCGACGCCGGACATCCTGGAACGTACCGAATGCTAG
Gene >AgabiH97|039850
ATGAACAATCGATACGTTGTCCCTCAAAAACGTCTAGGAGTGCAAGAACTGGAAGTAAAACCCATCCTCACTACA
ACAAACGGAAAGAAACTCAAAGTCTCAGCCATGGTCGACTCGGGGTGCACACACACATGTATCAACGAAGGACTA
GTAAAGAAGAAGAAGATCCCGACGAAGAAACTGGAACGGCTGATCACATGCAGGAATTCAGATGGAACGATAGCA
GGAAAGAAGGATATCACTAAATTCGCGAAAATAGACATAAACATCAACGGTCATAACGAACAACTGGACGCGGTC
GTCACTCCCTTACAATCATCCGATCTCTTTCTAGGTCATGATTGGTTAACGAACCACAACCCCGAGATCAATTGG
AAACAAGGAATTATCAAATTCAACCGGTGCCCCACATCATGTTCTTTTCCCCATACCGACATCTCTTTCAAACCA
CGTATACGACGATTACAATCAAACGAAGACACTGAGGAAAAAGAACCGGATCCAACGAACCCTGAAGACTTACCA
GCATACATGAAACCCTTCGCCCATCTTTTCAACAAAAAGAACTTCGACAAGCTACCTGAACGAACGGAATGGGAT
CACGAAGTTAACTTCACGGAAAACGCACCAACGGAGATATCATCAAAGGTTTATAGCATGACACCACTGGAGAGA
GAAGAACTGGACAAATTCTTGAATGAAAACCTGGCTACCAATCGAATCCGACCATCGAAATCACCCTATGCAGCA
CCATGTTTTTTCGTTCCCAAGAAAGACGGTTCACTACGGTTATGTCAGGATTATAGGAAACTGAATGAAATCACG
ATCAAAGACAAGACGCCACTACCCCTCATCAGTGAAGTATTAGATCAACTCAGAGACGCCAAGGTTTTCAACAAA
TTGGACATTATCTGGGGGTATAACAACGTTCGGATACGAGAAGGAGATGAATGGAAAGCAGCGTTCTTGACGAAT
CGCGGATTATTTGAACCAACGGTCATGTTCTTTGGAATGAGTAATTCCCCCGCCACCTTCTCACGTATGATGGCG
ACAATCTTTCGAGAAATGATACAAGACGGATCTTTAGCCAACTACATGGATGATTTCATCATTCCAGCAAAGAAC
GATGAGGAATTGGAAGCACGGACTTTACGTTTTCTCAAAATCGCGGAGAAACACAATTTATCATTTAAACGGACG
AAATGCGAGTTCAATGTCTCATCAACAACGGTGTTAGGAACGGTTATCGGGAACGGAAAGGCAACAATGGAAGAA
GAAAAGGTCAAGGCAATACGAGATTGGGCAGTCCCTACCACGGTCAAACAAGTCGAAAGCTTTTTAGGTTTTGCC
AACTTCTATCGACGATTTATCAAGAATTTCAGCACCATCGCGCAACCACTAAACGAGCTGAAGTCTAAGAAGGGG
GAGAAATGGTATTGGAACGATGAACAACAACAAGCTTTCGAACAAATCAAACAGGCTATCGCCAGCGAACCGGTC
CTAGCGTTACCCAAGGACAAAGGACAATTCAGGGTTGAAGTAGACGCATCAAACTATGGAACAGGAGCAGTACTA
TCACAGGAACAAGAAGACAAATGGCACCCGGTCGCCTTCATGTCGAAAACATTATCTGAAGCCGAACGAAACTAC
GAGATCTACGACAAGGAACTACTAGCCATCATAAAAGCCTTGAAACTATGGAGACACTACCTATTGGATGCAAAG
GAGCAATTTGAGATATGGACTGATCACGAGAACCTCAAATATTTCCGAGAACCTCAAAAGCTCAATGCTCGACAG
GCAAGATGGTACCTCATGCTACAGGAATACGATTTCCTCCTACGACACATTCCTGGGAAGACGAACACCAAAGCA
GACATCCTGTCAAGACTAATCAAACCTGACACATCTAACGACAATCGAGGAGTAGAAATGTTCAAGGAGAAAATG
TTCATCCGAAGACTTGAAGAATCCATTCCCATCTATGACATCACCTTACTCCACAATCGAAGATTCGAAATCATA
GCCGATGAAACCTTACTTGAGAAGATTAGGAAATGTGAAAGACGAGAAACCAGAGTAATAGAAGAGATGAAGAAG
CAGCCAGAAAAAGTATGGGAGAACAATGGAATCATTTACCGACAAGGAAGGATCTATGTTCCGGATAATCAGGAG
ATCAGAGATTTCATTCTTCACGATCATCATAATTCCCCGACGCCGGACATCCTGGAACGTACCGAATGCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail