Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|039780
Gene name
Locationscaffold_2:333956..334541
Strand+
Gene length (bp)585
Transcript length (bp)585
Coding sequence length (bp)585
Protein length (aa) 195

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16073 SAT Starter unit:ACP transacylase in aflatoxin biosynthesis 2.7E-10 10 144

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UUG0|FAS1_SCHPO Fatty acid synthase subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fas1 PE=1 SV=1 7 193 3.0E-37
sp|P07149|FAS1_YEAST Fatty acid synthase subunit beta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FAS1 PE=1 SV=2 7 191 5.0E-35
sp|P34229|FAS1_YARLI Fatty acid synthase subunit beta OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=FAS1 PE=3 SV=2 7 191 2.0E-34
sp|P34731|FAS1_CANAX Fatty acid synthase subunit beta OS=Candida albicans GN=FAS1 PE=3 SV=1 7 191 1.0E-33
sp|Q92215|TOXC_COCCA Putative fatty acid synthase subunit TOXC OS=Cochliobolus carbonum GN=TOXC PE=3 SV=1 7 191 5.0E-26
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UUG0|FAS1_SCHPO Fatty acid synthase subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fas1 PE=1 SV=1 7 193 3.0E-37
sp|P07149|FAS1_YEAST Fatty acid synthase subunit beta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FAS1 PE=1 SV=2 7 191 5.0E-35
sp|P34229|FAS1_YARLI Fatty acid synthase subunit beta OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=FAS1 PE=3 SV=2 7 191 2.0E-34
sp|P34731|FAS1_CANAX Fatty acid synthase subunit beta OS=Candida albicans GN=FAS1 PE=3 SV=1 7 191 1.0E-33
sp|Q92215|TOXC_COCCA Putative fatty acid synthase subunit TOXC OS=Cochliobolus carbonum GN=TOXC PE=3 SV=1 7 191 5.0E-26
sp|Q00706|STCK_EMENI Putative sterigmatocystin biosynthesis fatty acid synthase subunit beta OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcK PE=3 SV=2 11 190 7.0E-19
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|039780
MPLATLRAFLSAVVISASETFNDFTETPRKALHWLFYCGLHGQQAFPPVTVEPSLVLDTLDGGEGTPSPVLSVAG
LPLKDLEVHIKKTSSHLPANSQHSVSLYYGPRAFIVTGPARALHGIVTNLRKVRAPNGADQSKVSFMQRKPAFSV
RFLVVGVPYHSPYLKSMTDAVMDEELDEWWEPSDSKVPVYNANV*
Coding >AgabiH97|039780
ATGCCACTGGCCACTCTCAGGGCATTTCTCTCTGCGGTCGTCATCAGCGCATCGGAGACTTTCAATGACTTCACT
GAGACCCCGCGCAAGGCCCTTCATTGGCTTTTCTACTGCGGTCTTCATGGCCAACAAGCATTCCCTCCCGTCACC
GTTGAACCCAGCCTCGTCCTGGACACCCTGGATGGTGGAGAAGGTACCCCATCCCCTGTGTTGTCTGTCGCCGGT
CTTCCCCTCAAGGATCTTGAGGTTCATATCAAGAAGACCAGCTCGCACCTCCCTGCCAACTCTCAGCACAGTGTC
TCCTTATACTACGGGCCACGCGCATTCATCGTGACTGGGCCGGCTCGCGCTTTACATGGTATAGTGACCAATCTT
CGAAAGGTCAGGGCGCCCAATGGCGCCGACCAGAGCAAAGTTTCTTTTATGCAGCGCAAGCCCGCCTTCTCAGTC
CGTTTCTTGGTCGTTGGTGTTCCATACCACAGCCCGTACCTCAAGAGCATGACTGACGCCGTCATGGACGAGGAA
TTGGATGAATGGTGGGAACCCTCCGATTCGAAGGTCCCTGTATACAACGCGAACGTTTAG
Transcript >AgabiH97|039780
ATGCCACTGGCCACTCTCAGGGCATTTCTCTCTGCGGTCGTCATCAGCGCATCGGAGACTTTCAATGACTTCACT
GAGACCCCGCGCAAGGCCCTTCATTGGCTTTTCTACTGCGGTCTTCATGGCCAACAAGCATTCCCTCCCGTCACC
GTTGAACCCAGCCTCGTCCTGGACACCCTGGATGGTGGAGAAGGTACCCCATCCCCTGTGTTGTCTGTCGCCGGT
CTTCCCCTCAAGGATCTTGAGGTTCATATCAAGAAGACCAGCTCGCACCTCCCTGCCAACTCTCAGCACAGTGTC
TCCTTATACTACGGGCCACGCGCATTCATCGTGACTGGGCCGGCTCGCGCTTTACATGGTATAGTGACCAATCTT
CGAAAGGTCAGGGCGCCCAATGGCGCCGACCAGAGCAAAGTTTCTTTTATGCAGCGCAAGCCCGCCTTCTCAGTC
CGTTTCTTGGTCGTTGGTGTTCCATACCACAGCCCGTACCTCAAGAGCATGACTGACGCCGTCATGGACGAGGAA
TTGGATGAATGGTGGGAACCCTCCGATTCGAAGGTCCCTGTATACAACGCGAACGTTTAG
Gene >AgabiH97|039780
ATGCCACTGGCCACTCTCAGGGCATTTCTCTCTGCGGTCGTCATCAGCGCATCGGAGACTTTCAATGACTTCACT
GAGACCCCGCGCAAGGCCCTTCATTGGCTTTTCTACTGCGGTCTTCATGGCCAACAAGCATTCCCTCCCGTCACC
GTTGAACCCAGCCTCGTCCTGGACACCCTGGATGGTGGAGAAGGTACCCCATCCCCTGTGTTGTCTGTCGCCGGT
CTTCCCCTCAAGGATCTTGAGGTTCATATCAAGAAGACCAGCTCGCACCTCCCTGCCAACTCTCAGCACAGTGTC
TCCTTATACTACGGGCCACGCGCATTCATCGTGACTGGGCCGGCTCGCGCTTTACATGGTATAGTGACCAATCTT
CGAAAGGTCAGGGCGCCCAATGGCGCCGACCAGAGCAAAGTTTCTTTTATGCAGCGCAAGCCCGCCTTCTCAGTC
CGTTTCTTGGTCGTTGGTGTTCCATACCACAGCCCGTACCTCAAGAGCATGACTGACGCCGTCATGGACGAGGAA
TTGGATGAATGGTGGGAACCCTCCGATTCGAAGGTCCCTGTATACAACGCGAACGTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail