Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|039720
Gene name
Locationscaffold_2:316732..317641
Strand+
Gene length (bp)909
Transcript length (bp)909
Coding sequence length (bp)909
Protein length (aa) 303

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13975 gag-asp_proteas gag-polyprotein putative aspartyl protease 2.0E-07 166 253
PF13650 Asp_protease_2 Aspartyl protease 3.7E-07 166 255

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 35 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|039720
MKPVVELPPLPAKYFKEEKKGPSYKQQAKIEEGISIEEMLEKFGETEIKLSQKELLGMAPKLREALKDLLSKRRV
PTGNNNIVVDRNQEEEQLDWTYASLNKLGTVQKIQTEAKNKEGNPVKVWEVKEPLTQYLTAVPAEKRERLVFTIE
KEESQSTETMGELRVIPATINGVREEEALLDSGSQIVTMSREAASECKLAWDPSMAINMQSANGGITRTCGLAKN
VPFLFGTITAYLQVHVIEDAPYRVLLGRPFDVLLESKITNSGTGHQFITITDPNTKEWASLATYAKGELPRTLET
NF*
Coding >AgabiH97|039720
ATGAAACCGGTAGTAGAATTGCCCCCTCTACCAGCTAAGTACTTCAAAGAAGAAAAGAAAGGACCTAGCTACAAG
CAACAAGCAAAGATTGAGGAGGGTATCAGTATCGAAGAAATGTTAGAGAAATTTGGAGAGACTGAGATAAAGCTC
TCGCAAAAAGAGCTTCTAGGAATGGCGCCAAAGCTTCGCGAAGCGCTTAAAGATTTACTCAGTAAAAGAAGAGTA
CCTACCGGCAACAACAATATTGTTGTTGATAGGAACCAAGAAGAAGAACAGCTTGATTGGACCTACGCTAGTCTT
AACAAGCTAGGAACGGTACAAAAGATACAAACTGAAGCTAAGAATAAAGAAGGGAACCCAGTGAAAGTTTGGGAA
GTTAAAGAACCTCTGACGCAGTACTTAACAGCGGTACCAGCCGAAAAGCGAGAGAGATTGGTGTTCACCATAGAA
AAAGAGGAGTCTCAGAGCACCGAGACAATGGGGGAGTTACGTGTAATACCAGCAACTATTAATGGAGTCCGTGAG
GAAGAAGCGTTGTTGGATAGCGGATCTCAGATTGTCACGATGAGTAGAGAGGCCGCTAGTGAATGTAAGCTAGCA
TGGGACCCATCTATGGCGATTAATATGCAAAGCGCTAATGGAGGGATCACCCGAACATGTGGGCTAGCTAAGAAT
GTTCCGTTCCTCTTCGGAACAATCACGGCGTATCTACAGGTGCATGTTATCGAAGATGCACCTTATCGAGTACTA
CTAGGAAGACCGTTTGACGTTCTACTGGAAAGTAAGATAACAAACTCAGGAACAGGGCATCAGTTCATCACCATA
ACTGACCCAAATACCAAAGAATGGGCCTCGCTAGCTACCTATGCAAAAGGAGAGCTACCGAGGACATTGGAAACA
AATTTTTAA
Transcript >AgabiH97|039720
ATGAAACCGGTAGTAGAATTGCCCCCTCTACCAGCTAAGTACTTCAAAGAAGAAAAGAAAGGACCTAGCTACAAG
CAACAAGCAAAGATTGAGGAGGGTATCAGTATCGAAGAAATGTTAGAGAAATTTGGAGAGACTGAGATAAAGCTC
TCGCAAAAAGAGCTTCTAGGAATGGCGCCAAAGCTTCGCGAAGCGCTTAAAGATTTACTCAGTAAAAGAAGAGTA
CCTACCGGCAACAACAATATTGTTGTTGATAGGAACCAAGAAGAAGAACAGCTTGATTGGACCTACGCTAGTCTT
AACAAGCTAGGAACGGTACAAAAGATACAAACTGAAGCTAAGAATAAAGAAGGGAACCCAGTGAAAGTTTGGGAA
GTTAAAGAACCTCTGACGCAGTACTTAACAGCGGTACCAGCCGAAAAGCGAGAGAGATTGGTGTTCACCATAGAA
AAAGAGGAGTCTCAGAGCACCGAGACAATGGGGGAGTTACGTGTAATACCAGCAACTATTAATGGAGTCCGTGAG
GAAGAAGCGTTGTTGGATAGCGGATCTCAGATTGTCACGATGAGTAGAGAGGCCGCTAGTGAATGTAAGCTAGCA
TGGGACCCATCTATGGCGATTAATATGCAAAGCGCTAATGGAGGGATCACCCGAACATGTGGGCTAGCTAAGAAT
GTTCCGTTCCTCTTCGGAACAATCACGGCGTATCTACAGGTGCATGTTATCGAAGATGCACCTTATCGAGTACTA
CTAGGAAGACCGTTTGACGTTCTACTGGAAAGTAAGATAACAAACTCAGGAACAGGGCATCAGTTCATCACCATA
ACTGACCCAAATACCAAAGAATGGGCCTCGCTAGCTACCTATGCAAAAGGAGAGCTACCGAGGACATTGGAAACA
AATTTTTAA
Gene >AgabiH97|039720
ATGAAACCGGTAGTAGAATTGCCCCCTCTACCAGCTAAGTACTTCAAAGAAGAAAAGAAAGGACCTAGCTACAAG
CAACAAGCAAAGATTGAGGAGGGTATCAGTATCGAAGAAATGTTAGAGAAATTTGGAGAGACTGAGATAAAGCTC
TCGCAAAAAGAGCTTCTAGGAATGGCGCCAAAGCTTCGCGAAGCGCTTAAAGATTTACTCAGTAAAAGAAGAGTA
CCTACCGGCAACAACAATATTGTTGTTGATAGGAACCAAGAAGAAGAACAGCTTGATTGGACCTACGCTAGTCTT
AACAAGCTAGGAACGGTACAAAAGATACAAACTGAAGCTAAGAATAAAGAAGGGAACCCAGTGAAAGTTTGGGAA
GTTAAAGAACCTCTGACGCAGTACTTAACAGCGGTACCAGCCGAAAAGCGAGAGAGATTGGTGTTCACCATAGAA
AAAGAGGAGTCTCAGAGCACCGAGACAATGGGGGAGTTACGTGTAATACCAGCAACTATTAATGGAGTCCGTGAG
GAAGAAGCGTTGTTGGATAGCGGATCTCAGATTGTCACGATGAGTAGAGAGGCCGCTAGTGAATGTAAGCTAGCA
TGGGACCCATCTATGGCGATTAATATGCAAAGCGCTAATGGAGGGATCACCCGAACATGTGGGCTAGCTAAGAAT
GTTCCGTTCCTCTTCGGAACAATCACGGCGTATCTACAGGTGCATGTTATCGAAGATGCACCTTATCGAGTACTA
CTAGGAAGACCGTTTGACGTTCTACTGGAAAGTAAGATAACAAACTCAGGAACAGGGCATCAGTTCATCACCATA
ACTGACCCAAATACCAAAGAATGGGCCTCGCTAGCTACCTATGCAAAAGGAGAGCTACCGAGGACATTGGAAACA
AATTTTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail