Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|039690
Gene name
Locationscaffold_2:309660..312396
Strand+
Gene length (bp)2736
Transcript length (bp)2736
Coding sequence length (bp)2736
Protein length (aa) 912

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF17917 RT_RNaseH RNase H-like domain found in reverse transcriptase 1.4E-38 508 610
PF17919 RT_RNaseH_2 RNase H-like domain found in reverse transcriptase 1.5E-37 480 576
PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase) 7.7E-19 255 414
PF17921 Integrase_H2C2 Integrase zinc binding domain 3.0E-19 724 780
PF00665 rve Integrase core domain 6.4E-11 798 894
PF08284 RVP_2 Retroviral aspartyl protease 1.5E-08 34 133
PF13975 gag-asp_proteas gag-polyprotein putative aspartyl protease 5.3E-07 27 117
PF13650 Asp_protease_2 Aspartyl protease 4.0E-06 25 115

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P0CT40|TF29_SCHPO Transposon Tf2-9 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-9 PE=3 SV=1 30 911 4.0E-130
sp|P0CT37|TF24_SCHPO Transposon Tf2-4 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-4 PE=3 SV=1 30 911 4.0E-130
sp|P0CT35|TF22_SCHPO Transposon Tf2-2 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-2 PE=3 SV=1 30 911 4.0E-130
sp|P0CT34|TF21_SCHPO Transposon Tf2-1 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-1 PE=3 SV=1 30 911 4.0E-130
sp|P0CT39|TF26_SCHPO Transposon Tf2-6 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-6 PE=3 SV=1 30 911 4.0E-130
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P0CT40|TF29_SCHPO Transposon Tf2-9 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-9 PE=3 SV=1 30 911 4.0E-130
sp|P0CT37|TF24_SCHPO Transposon Tf2-4 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-4 PE=3 SV=1 30 911 4.0E-130
sp|P0CT35|TF22_SCHPO Transposon Tf2-2 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-2 PE=3 SV=1 30 911 4.0E-130
sp|P0CT34|TF21_SCHPO Transposon Tf2-1 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-1 PE=3 SV=1 30 911 4.0E-130
sp|P0CT39|TF26_SCHPO Transposon Tf2-6 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-6 PE=3 SV=1 30 911 4.0E-130
sp|P0CT38|TF25_SCHPO Transposon Tf2-5 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-5 PE=3 SV=1 30 911 4.0E-130
sp|P0CT36|TF23_SCHPO Transposon Tf2-3 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-3 PE=1 SV=1 30 911 4.0E-130
sp|P0CT41|TF212_SCHPO Transposon Tf2-12 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-12 PE=3 SV=1 30 911 4.0E-130
sp|P0CT43|TF28_SCHPO Transposon Tf2-8 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-8 PE=3 SV=1 30 911 1.0E-129
sp|P0CT42|TF27_SCHPO Transposon Tf2-7 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-7 PE=3 SV=1 30 911 1.0E-129
sp|Q9UR07|TF211_SCHPO Transposon Tf2-11 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=Tf2-11 PE=3 SV=1 30 911 2.0E-129
sp|Q7LHG5|YI31B_YEAST Transposon Ty3-I Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY3B-I PE=3 SV=2 218 911 5.0E-117
sp|Q99315|YG31B_YEAST Transposon Ty3-G Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY3B-G PE=1 SV=3 218 911 2.0E-116
sp|P04323|POL3_DROME Retrovirus-related Pol polyprotein from transposon 17.6 OS=Drosophila melanogaster GN=pol PE=3 SV=1 191 907 8.0E-84
sp|P20825|POL2_DROME Retrovirus-related Pol polyprotein from transposon 297 OS=Drosophila melanogaster GN=pol PE=3 SV=1 108 872 9.0E-83
sp|Q8I7P9|POL5_DROME Retrovirus-related Pol polyprotein from transposon opus OS=Drosophila melanogaster GN=pol PE=3 SV=1 208 631 7.0E-68
sp|P10401|POLY_DROME Retrovirus-related Pol polyprotein from transposon gypsy OS=Drosophila melanogaster GN=pol PE=3 SV=1 191 630 5.0E-61
sp|P10394|POL4_DROME Retrovirus-related Pol polyprotein from transposon 412 OS=Drosophila melanogaster GN=POL PE=3 SV=1 213 631 9.0E-56
sp|P09523|POL_FMVD Enzymatic polyprotein OS=Figwort mosaic virus (strain DxS) GN=ORF V PE=3 SV=1 213 630 1.0E-41
sp|P03555|POL_CAMVC Enzymatic polyprotein OS=Cauliflower mosaic virus (strain CM-1841) GN=ORF V PE=3 SV=1 19 630 4.0E-41
sp|P05400|POL_CERV Enzymatic polyprotein OS=Carnation etched ring virus GN=ORF V PE=3 SV=1 211 628 5.0E-41
sp|Q00962|POL_CAMVN Enzymatic polyprotein OS=Cauliflower mosaic virus (strain NY8153) GN=ORF V PE=3 SV=1 213 630 2.0E-40
sp|Q02964|POL_CAMVE Enzymatic polyprotein OS=Cauliflower mosaic virus (strain BBC) GN=ORF V PE=3 SV=1 213 630 3.0E-40
sp|P03554|POL_CAMVS Enzymatic polyprotein OS=Cauliflower mosaic virus (strain Strasbourg) GN=ORF V PE=3 SV=1 19 630 4.0E-40
sp|P03556|POL_CAMVD Enzymatic polyprotein OS=Cauliflower mosaic virus (strain D/H) GN=ORF V PE=3 SV=1 213 630 1.0E-38
sp|A6NKG5|RTL1_HUMAN Retrotransposon-like protein 1 OS=Homo sapiens GN=RTL1 PE=3 SV=3 30 625 8.0E-34
sp|P19199|POL_COYMV Polyprotein P3 OS=Commelina yellow mottle virus PE=3 SV=2 220 632 6.0E-33
sp|Q6XKE6|POLG_PVCV2 Genome polyprotein OS=Petunia vein clearing virus (isolate Hohn) PE=3 SV=1 185 630 6.0E-32
sp|Q91DM0|POLG_PVCV1 Genome polyprotein OS=Petunia vein clearing virus (isolate Shepherd) PE=3 SV=1 185 630 7.0E-32
sp|Q89703|POL_CSVMV Putative enzymatic polyprotein OS=Cassava vein mosaic virus GN=ORF 3 PE=3 SV=1 222 636 3.0E-30
sp|Q7M732|RTL1_MOUSE Retrotransposon-like protein 1 OS=Mus musculus GN=Rtl1 PE=2 SV=1 30 625 2.0E-29
sp|Q52QI2|RTL1_BOVIN Retrotransposon-like protein 1 OS=Bos taurus GN=RTL1 PE=2 SV=2 30 624 7.0E-29
sp|Q09575|YRD6_CAEEL Uncharacterized protein K02A2.6 OS=Caenorhabditis elegans GN=K02A2.6 PE=3 SV=1 709 903 6.0E-26
sp|P27502|POL_RTBVP Polyprotein P3 OS=Rice tungro bacilliform virus (isolate Philippines) PE=1 SV=1 33 667 5.0E-24
sp|P15629|POL_SOCMV Enzymatic polyprotein OS=Soybean chlorotic mottle virus GN=ORF V PE=3 SV=2 201 637 3.0E-23
sp|O92815|POL_WDSV Gag-Pol polyprotein OS=Walleye dermal sarcoma virus GN=gag-pol PE=1 SV=2 246 584 7.0E-23
sp|Q7TD08|POL_CYLCV Enzymatic polyprotein OS=Cestrum yellow leaf curling virus GN=ORF V PE=3 SV=1 241 630 9.0E-23
sp|P21414|POL_GALV Pol polyprotein OS=Gibbon ape leukemia virus GN=pol PE=3 SV=1 36 664 1.0E-22
sp|P10272|POL_BAEVM Pol polyprotein OS=Baboon endogenous virus (strain M7) GN=pol PE=3 SV=1 213 543 2.0E-22
sp|Q2F7J3|POL_XMRV3 Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP35) GN=gag-pol PE=1 SV=1 211 560 2.0E-22
sp|A1Z651|POL_XMRV6 Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP62) GN=gag-pol PE=1 SV=1 211 560 2.0E-22
sp|Q2F7J0|POL_XMRV4 Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP42) GN=gag-pol PE=3 SV=1 211 560 2.0E-22
sp|P26808|POL_MLVFP Pol polyprotein OS=Friend murine leukemia virus (isolate PVC-211) GN=pol PE=3 SV=1 209 560 5.0E-22
sp|P03355|POL_MLVMS Gag-Pol polyprotein OS=Moloney murine leukemia virus (isolate Shinnick) GN=gag-pol PE=1 SV=4 211 560 5.0E-22
sp|P26809|POL_MLVFF Pol polyprotein OS=Friend murine leukemia virus (isolate FB29) GN=pol PE=3 SV=1 211 560 5.0E-22
sp|P31792|POL_FENV1 Pol polyprotein (Fragment) OS=Feline endogenous virus ECE1 GN=pol PE=3 SV=1 213 543 9.0E-22
sp|P26810|POL_MLVF5 Pol polyprotein OS=Friend murine leukemia virus (isolate 57) GN=pol PE=3 SV=1 211 560 2.0E-21
sp|P03356|POL_MLVAV Pol polyprotein OS=AKV murine leukemia virus GN=pol PE=3 SV=2 211 611 2.0E-21
sp|P11227|POL_MLVRD Pol polyprotein OS=Radiation murine leukemia virus GN=pol PE=3 SV=1 211 560 2.0E-21
sp|P14350|POL_FOAMV Pro-Pol polyprotein OS=Human spumaretrovirus GN=pol PE=1 SV=2 199 564 1.0E-20
sp|P23074|POL_SFV1 Pro-Pol polyprotein OS=Simian foamy virus type 1 GN=pol PE=1 SV=3 707 911 2.0E-20
sp|Q87040|POL_SFVCP Pro-Pol polyprotein OS=Simian foamy virus (isolate chimpanzee) GN=pol PE=3 SV=1 715 911 6.0E-20
sp|O93209|POL_FFV Pro-Pol polyprotein OS=Feline foamy virus GN=pol PE=3 SV=1 681 911 6.0E-20
sp|Q9TTC1|POL_KORV Pro-Pol polyprotein OS=Koala retrovirus GN=pro-pol PE=3 SV=1 211 565 3.0E-19
sp|P27401|POL_SFV3L Pro-Pol polyprotein OS=Simian foamy virus type 3 (strain LK3) GN=pol PE=3 SV=2 716 911 3.0E-19
sp|O93209|POL_FFV Pro-Pol polyprotein OS=Feline foamy virus GN=pol PE=3 SV=1 199 564 8.0E-19
sp|P10394|POL4_DROME Retrovirus-related Pol polyprotein from transposon 412 OS=Drosophila melanogaster GN=POL PE=3 SV=1 651 911 1.0E-18
sp|P31843|RRPO_OENBE RNA-directed DNA polymerase homolog OS=Oenothera berteroana PE=4 SV=1 261 357 1.0E-18
sp|P14350|POL_FOAMV Pro-Pol polyprotein OS=Human spumaretrovirus GN=pol PE=1 SV=2 715 911 2.0E-18
sp|Q87040|POL_SFVCP Pro-Pol polyprotein OS=Simian foamy virus (isolate chimpanzee) GN=pol PE=3 SV=1 198 564 2.0E-18
sp|Q09575|YRD6_CAEEL Uncharacterized protein K02A2.6 OS=Caenorhabditis elegans GN=K02A2.6 PE=3 SV=1 248 459 3.0E-18
sp|P92523|M860_ARATH Uncharacterized mitochondrial protein AtMg00860 OS=Arabidopsis thaliana GN=AtMg00860 PE=4 SV=1 387 529 2.0E-16
sp|P23074|POL_SFV1 Pro-Pol polyprotein OS=Simian foamy virus type 1 GN=pol PE=1 SV=3 199 564 1.0E-15
sp|Q9TTC1|POL_KORV Pro-Pol polyprotein OS=Koala retrovirus GN=pro-pol PE=3 SV=1 690 911 1.0E-15
sp|P27401|POL_SFV3L Pro-Pol polyprotein OS=Simian foamy virus type 3 (strain LK3) GN=pol PE=3 SV=2 19 564 1.0E-15
sp|P10272|POL_BAEVM Pol polyprotein OS=Baboon endogenous virus (strain M7) GN=pol PE=3 SV=1 688 911 2.0E-14
sp|P31792|POL_FENV1 Pol polyprotein (Fragment) OS=Feline endogenous virus ECE1 GN=pol PE=3 SV=1 688 911 7.0E-14
sp|P21414|POL_GALV Pol polyprotein OS=Gibbon ape leukemia virus GN=pol PE=3 SV=1 727 911 1.0E-12
sp|Q5DTZ0|NYNRI_MOUSE Protein NYNRIN OS=Mus musculus GN=Nynrin PE=2 SV=2 707 885 1.0E-12
sp|Q8K259|GIN1_MOUSE Gypsy retrotransposon integrase-like protein 1 OS=Mus musculus GN=Gin1 PE=2 SV=2 714 883 3.0E-12
sp|Q66H30|GIN1_RAT Gypsy retrotransposon integrase-like protein 1 OS=Rattus norvegicus GN=GIN1 PE=2 SV=1 714 883 4.0E-12
sp|A4FUB7|GIN1_BOVIN Gypsy retrotransposon integrase-like protein 1 OS=Bos taurus GN=GIN1 PE=2 SV=1 731 911 4.0E-12
sp|Q9NXP7|GIN1_HUMAN Gypsy retrotransposon integrase-like protein 1 OS=Homo sapiens GN=GIN1 PE=2 SV=3 714 911 1.0E-11
sp|Q5RBK0|GIN1_PONAB Gypsy retrotransposon integrase-like protein 1 OS=Pongo abelii GN=GIN1 PE=2 SV=1 714 886 2.0E-11
sp|Q9P2P1|NYNRI_HUMAN Protein NYNRIN OS=Homo sapiens GN=NYNRIN PE=2 SV=3 418 543 2.0E-11
sp|P03360|POL_AVIRE Pol polyprotein (Fragment) OS=Avian reticuloendotheliosis virus GN=pol PE=3 SV=1 716 908 3.0E-11
sp|Q4R6I1|GIN1_MACFA Gypsy retrotransposon integrase-like protein 1 OS=Macaca fascicularis GN=GIN1 PE=2 SV=1 714 886 4.0E-11
sp|P31795|POL_MLVRK Pol polyprotein (Fragment) OS=Radiation murine leukemia virus (strain Kaplan) GN=pol PE=3 SV=1 795 911 3.0E-10
sp|P08361|POL_MLVCB Gag-Pol polyprotein (Fragment) OS=Cas-Br-E murine leukemia virus GN=gag-pol PE=3 SV=1 804 911 6.0E-10
sp|A1Z651|POL_XMRV6 Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP62) GN=gag-pol PE=1 SV=1 819 911 7.0E-10
sp|P11227|POL_MLVRD Pol polyprotein OS=Radiation murine leukemia virus GN=pol PE=3 SV=1 795 911 7.0E-10
sp|Q2F7J0|POL_XMRV4 Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP42) GN=gag-pol PE=3 SV=1 819 911 8.0E-10
sp|P03356|POL_MLVAV Pol polyprotein OS=AKV murine leukemia virus GN=pol PE=3 SV=2 795 911 9.0E-10
sp|Q2F7J3|POL_XMRV3 Gag-Pol polyprotein OS=Xenotropic MuLV-related virus (isolate VP35) GN=gag-pol PE=1 SV=1 819 911 1.0E-09
sp|Q9P2P1|NYNRI_HUMAN Protein NYNRIN OS=Homo sapiens GN=NYNRIN PE=2 SV=3 707 885 2.0E-09
sp|P26808|POL_MLVFP Pol polyprotein OS=Friend murine leukemia virus (isolate PVC-211) GN=pol PE=3 SV=1 795 911 3.0E-09
sp|P03355|POL_MLVMS Gag-Pol polyprotein OS=Moloney murine leukemia virus (isolate Shinnick) GN=gag-pol PE=1 SV=4 819 911 3.0E-09
sp|P26810|POL_MLVF5 Pol polyprotein OS=Friend murine leukemia virus (isolate 57) GN=pol PE=3 SV=1 795 911 3.0E-09
sp|Q5DTZ0|NYNRI_MOUSE Protein NYNRIN OS=Mus musculus GN=Nynrin PE=2 SV=2 418 543 4.0E-09
sp|P26809|POL_MLVFF Pol polyprotein OS=Friend murine leukemia virus (isolate FB29) GN=pol PE=3 SV=1 795 911 5.0E-09
sp|Q86TG7|PEG10_HUMAN Retrotransposon-derived protein PEG10 OS=Homo sapiens GN=PEG10 PE=1 SV=2 8 307 7.0E-09
sp|P07572|POL_MPMV Pol polyprotein OS=Mason-Pfizer monkey virus GN=pol PE=3 SV=1 222 500 2.0E-08
sp|P31623|POL_JSRV Pol polyprotein OS=Sheep pulmonary adenomatosis virus GN=pol PE=3 SV=1 222 533 2.0E-08
sp|P04025|POL_SRV1 Pol polyprotein OS=Simian retrovirus SRV-1 GN=pol PE=3 SV=1 222 467 4.0E-08
sp|P03359|POL_WMSV Pol polyprotein (Fragment) OS=Woolly monkey sarcoma virus GN=pol PE=3 SV=1 796 911 1.0E-07
sp|O92815|POL_WDSV Gag-Pol polyprotein OS=Walleye dermal sarcoma virus GN=gag-pol PE=1 SV=2 712 909 2.0E-07
sp|P03365|POL_MMTVB Pol polyprotein OS=Mouse mammary tumor virus (strain BR6) GN=pol PE=3 SV=2 222 470 2.0E-07
sp|P11283|POL_MMTVC Gag-Pro-Pol polyprotein OS=Mouse mammary tumor virus (strain C3H) GN=gag-pro-pol PE=1 SV=2 222 470 2.0E-07
sp|P03364|POL_SMRVH Pol polyprotein OS=Squirrel monkey retrovirus GN=pol PE=3 SV=2 231 470 4.0E-07
sp|Q4U0X6|POL_HTL3P Gag-Pro-Pol polyprotein OS=Human T-cell leukemia virus 3 (strain Pyl43) GN=gag-pro-pol PE=3 SV=4 210 533 5.0E-07
sp|P51517|POL_SRV2 Pol polyprotein OS=Simian retrovirus SRV-2 GN=pol PE=3 SV=1 222 470 5.0E-07
sp|Q7TN75|PEG10_MOUSE Retrotransposon-derived protein PEG10 OS=Mus musculus GN=Peg10 PE=1 SV=2 8 139 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0015074 DNA integration Yes
GO:0008150 biological_process No
GO:0006259 DNA metabolic process No
GO:0044238 primary metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0009987 cellular process No
GO:0071704 organic substance metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0008152 metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0044237 cellular metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear localization signal 0.6724 0.4694 0.2003 0.1091 0.1742 0.0156 0.185 0.1656 0.0438 0.0038

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Orthologs

Orthofinder run ID1
Orthogroup62
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|203700
Agaricus bisporus var bisporus H39 AgabiH39|543800
Agaricus bisporus var bisporus H39 AgabiH39|541900
Agaricus bisporus var bisporus H39 AgabiH39|484000
Agaricus bisporus var bisporus H39 AgabiH39|482700
Agaricus bisporus var bisporus H39 AgabiH39|465600
Agaricus bisporus var bisporus H39 AgabiH39|458400
Agaricus bisporus var bisporus H39 AgabiH39|442600
Agaricus bisporus var bisporus H39 AgabiH39|440000
Agaricus bisporus var bisporus H39 AgabiH39|431100
Agaricus bisporus var bisporus H39 AgabiH39|423100
Agaricus bisporus var bisporus H39 AgabiH39|407200
Agaricus bisporus var bisporus H39 AgabiH39|397400
Agaricus bisporus var bisporus H39 AgabiH39|367300
Agaricus bisporus var bisporus H39 AgabiH39|471500
Agaricus bisporus var bisporus H39 AgabiH39|365700
Agaricus bisporus var bisporus H39 AgabiH39|366200
Agaricus bisporus var bisporus H39 AgabiH39|220000
Agaricus bisporus var bisporus H39 AgabiH39|223400
Agaricus bisporus var bisporus H39 AgabiH39|231200
Agaricus bisporus var bisporus H39 AgabiH39|240600
Agaricus bisporus var bisporus H39 AgabiH39|225300
Agaricus bisporus var bisporus H39 AgabiH39|303300
Agaricus bisporus var bisporus H39 AgabiH39|310900
Agaricus bisporus var bisporus H39 AgabiH39|337900
Agaricus bisporus var bisporus H39 AgabiH39|363700
Agaricus bisporus var bisporus H39 AgabiH39|364000
Agaricus bisporus var bisporus H39 AgabiH39|288000
Agaricus bisporus var bisporus H97 AgabiH97|048890
Agaricus bisporus var bisporus H97 AgabiH97|078540
Agaricus bisporus var bisporus H97 AgabiH97|051180
Agaricus bisporus var bisporus H97 AgabiH97|059850
Agaricus bisporus var bisporus H97 AgabiH97|059860
Agaricus bisporus var bisporus H97 AgabiH97|059920
Agaricus bisporus var bisporus H97 AgabiH97|060470
Agaricus bisporus var bisporus H97 AgabiH97|076080
Agaricus bisporus var bisporus H97 AgabiH97|078600
Agaricus bisporus var bisporus H97 AgabiH97|108240
Agaricus bisporus var bisporus H97 AgabiH97|082340
Agaricus bisporus var bisporus H97 AgabiH97|084900
Agaricus bisporus var bisporus H97 AgabiH97|107880
Agaricus bisporus var bisporus H97 AgabiH97|108080
Agaricus bisporus var bisporus H97 AgabiH97|110130
Agaricus bisporus var bisporus H97 AgabiH97|117630
Agaricus bisporus var bisporus H97 AgabiH97|118430
Agaricus bisporus var bisporus H97 AgabiH97|048870
Agaricus bisporus var bisporus H97 AgabiH97|082290
Agaricus bisporus var bisporus H97 AgabiH97|048860
Agaricus bisporus var bisporus H97 AgabiH97|013380
Agaricus bisporus var bisporus H97 AgabiH97|044800
Agaricus bisporus var bisporus H97 AgabiH97|012380
Agaricus bisporus var bisporus H97 AgabiH97|012440
Agaricus bisporus var bisporus H97 AgabiH97|012730
Agaricus bisporus var bisporus H97 AgabiH97|012750
Agaricus bisporus var bisporus H97 AgabiH97|012780
Agaricus bisporus var bisporus H97 AgabiH97|013210
Agaricus bisporus var bisporus H97 AgabiH97|119550
Agaricus bisporus var bisporus H97 AgabiH97|013410
Agaricus bisporus var bisporus H97 AgabiH97|044810
Agaricus bisporus var bisporus H97 AgabiH97|016500
Agaricus bisporus var bisporus H97 AgabiH97|020610
Agaricus bisporus var bisporus H97 AgabiH97|025620
Agaricus bisporus var bisporus H97 AgabiH97|025630
Agaricus bisporus var bisporus H97 AgabiH97|032380
Agaricus bisporus var bisporus H97 AgabiH97|039690 (this protein)
Agaricus bisporus var bisporus H97 AgabiH97|039850
Agaricus bisporus var bisporus H97 AgabiH97|040720
Agaricus bisporus var bisporus H97 AgabiH97|041140
Agaricus bisporus var bisporus H97 AgabiH97|016510
Agaricus bisporus var bisporus H97 AgabiH97|119560

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|039690
MNNRYVVPQKRLGVQELEVKPLLTTTNGKKLKVSAMVDSGCTHTCIDEGLVKKKKIPTKKLERLITCRNSDGTIA
GKKDITKFAKIDLNINGHNEQLDAVVTPLQSSDLFLGHDWLTNHNPEINWKQGMIKFNRCPTSCSFPHTDISFEP
CIRRLQSNEDTEEKEPDPTNPEDLPAYMKPFAHLFNRKNFDKLPERTEWDHEINFTENAPTEISSKVYSMTPLER
EELDKFLDENLATNRIRPSKSPYAAPCFFVPKKDGSLRLCQDYRKLNEITIKDKTPLPLISEVLDQLRDAKVFNK
LDIIWGYNNVRIREGDEWKAAFLTNRGLFEPTVMFFGMSNSPATFSRMMATIFREMIQDGSLANYMDDFIIPAKD
DEELEARTLRFLKIAEKHNLSFKRTKCEFNVSSTTVLGTVIGNGKATMEEEKVKAIRDWAVPTTVKQVESFLGFA
NFYRRFIKNFSTIAQPLNELKSKKGEKWYWNDEQQQAFEQIKQAIASEPVLALPKDKGQFRVEVDASNYGTGAVL
SQEQEDKWHPVAFMSKTLSEAERNYEIYDKELLAIIKALKLWRHYLLDAKEQFEIWTDHENLKYFREPQKLNARQ
ARWYLMLQEYDFLLRHIPGKTNTKADILSRLIKPDTSNDNRGVEMFKEKMFIRRLEESIPIYDVTLLHNRRFEII
ADETLLEKIRKCERRETRVIEEMKKQPEKVWENNGIIYRQGRIYVPDNQEIRDFILHDHHNSPDAGHPGTYRMLE
SVKRTFWWPTIKTDIRRYVRGCDMCQKNKTIRRPDHIPLNPLSIPDKPWEEISIDMIGPLPKSMEKDAIIVIVDR
FSKMIHLVPTTTSLTSMDLAEIYKEEVWRHHGIPKQIISDRGPQFASKFMESLCKALGIERNLSTAYHPQTDGQT
ERMNQEIETYL*
Coding >AgabiH97|039690
ATGAACAATCGATACGTTGTCCCTCAAAAACGTCTAGGAGTGCAAGAACTGGAAGTAAAACCCCTCCTCACTACA
ACAAACGGAAAGAAACTCAAAGTCTCAGCCATGGTCGACTCGGGATGCACACACACATGTATCGATGAAGGATTA
GTAAAGAAGAAGAAGATCCCGACGAAGAAATTGGAACGGCTGATCACATGCAGGAACTCAGATGGAACAATAGCA
GGAAAGAAGGATATCACCAAATTTGCGAAGATAGATCTAAACATCAACGGTCATAACGAGCAACTGGACGCGGTT
GTCACTCCATTACAATCATCCGACCTCTTTCTAGGTCATGATTGGTTAACAAACCACAACCCCGAAATCAATTGG
AAACAAGGAATGATCAAATTCAACCGGTGCCCCACATCATGTTCTTTTCCCCATACCGACATCTCTTTCGAACCA
TGTATACGACGATTACAGTCAAACGAAGACACTGAAGAAAAAGAACCGGATCCAACAAACCCTGAGGACTTACCA
GCATATATGAAACCCTTTGCCCATCTTTTCAACAGAAAGAACTTCGACAAACTACCTGAACGAACGGAATGGGAT
CACGAAATTAACTTCACGGAAAACGCACCAACGGAGATATCATCAAAAGTTTATAGCATGACACCACTGGAGAGA
GAAGAACTGGACAAATTCTTGGATGAAAATCTGGCTACCAATCGAATCCGACCATCGAAATCACCCTATGCAGCA
CCATGTTTTTTTGTCCCCAAGAAAGACGGTTCACTACGGTTATGTCAGGATTATAGGAAACTGAATGAAATCACG
ATCAAAGACAAGACGCCACTACCCCTCATCAGTGAAGTATTAGATCAACTCAGAGACGCCAAGGTTTTCAACAAA
TTGGACATTATCTGGGGGTATAACAACGTTCGGATACGAGAAGGAGATGAATGGAAAGCAGCGTTCTTGACGAAT
CGCGGATTATTTGAACCAACGGTCATGTTCTTTGGAATGAGTAATTCCCCCGCCACCTTCTCACGTATGATGGCG
ACAATCTTTCGAGAAATGATACAAGACGGATCTTTAGCCAACTACATGGACGATTTCATCATTCCAGCAAAGGAC
GATGAAGAATTGGAAGCACGGACTTTACGTTTTCTCAAAATCGCGGAGAAACACAATTTATCATTTAAACGGACG
AAATGCGAGTTCAATGTCTCATCAACAACGGTGTTAGGAACGGTTATCGGGAACGGAAAGGCAACAATGGAAGAA
GAAAAGGTCAAGGCAATACGAGATTGGGCAGTCCCTACCACGGTCAAACAAGTCGAAAGTTTTTTAGGTTTTGCC
AACTTCTATCGACGATTTATCAAGAATTTCAGCACCATCGCGCAACCACTAAACGAGCTGAAGTCTAAGAAGGGG
GAGAAATGGTATTGGAACGATGAACAACAACAAGCTTTCGAACAAATCAAACAGGCTATCGCCAGCGAACCGGTC
CTAGCGTTACCCAAGGACAAAGGACAATTCAGGGTTGAAGTAGACGCATCAAACTATGGAACAGGAGCAGTACTA
TCACAGGAACAGGAAGACAAATGGCACCCAGTCGCATTCATGTCGAAAACATTATCTGAAGCTGAACGAAACTAC
GAGATCTACGACAAGGAACTACTAGCTATCATAAAAGCTTTGAAACTATGGCGACACTACCTATTGGACGCAAAG
GAGCAATTTGAGATATGGACAGATCATGAGAACCTCAAATATTTCCGAGAACCTCAAAAGCTCAACGCTCGACAA
GCAAGATGGTACCTCATGCTACAGGAATACGATTTCCTTCTACGACACATTCCTGGGAAGACAAACACCAAAGCA
GATATCCTGTCAAGACTAATCAAACCTGACACATCTAACGACAACCGAGGAGTAGAAATGTTCAAGGAGAAAATG
TTCATCCGAAGACTTGAAGAATCCATCCCCATCTATGACGTCACCTTACTCCATAATCGAAGATTCGAAATCATA
GCCGATGAAACCCTACTTGAGAAGATTAGGAAATGTGAAAGACGAGAAACCAGAGTAATAGAAGAGATGAAGAAG
CAGCCAGAAAAAGTATGGGAGAACAATGGAATCATTTACCGACAAGGAAGGATCTATGTTCCGGATAACCAGGAG
ATCAGAGATTTCATTCTTCACGATCATCATAATTCTCCCGACGCCGGACATCCTGGAACGTACCGAATGCTAGAA
TCAGTTAAACGGACCTTTTGGTGGCCCACGATCAAAACGGATATCAGGAGATATGTCAGAGGATGCGACATGTGC
CAGAAGAACAAAACCATTCGACGACCCGATCACATCCCGCTTAATCCATTATCTATCCCCGACAAACCTTGGGAA
GAAATATCTATAGACATGATCGGACCACTACCGAAGTCAATGGAGAAGGATGCTATTATTGTTATCGTTGACAGA
TTCTCCAAAATGATCCACCTCGTTCCCACTACCACGTCGCTCACATCCATGGATCTTGCGGAAATCTATAAGGAA
GAAGTCTGGCGACATCATGGAATTCCGAAACAGATTATTAGCGACAGAGGACCACAGTTTGCATCGAAATTTATG
GAATCCCTATGCAAAGCTCTAGGCATTGAACGGAACCTTTCTACGGCGTATCACCCACAGACAGACGGTCAAACA
GAGCGGATGAATCAGGAAATTGAAACCTACCTTTGA
Transcript >AgabiH97|039690
ATGAACAATCGATACGTTGTCCCTCAAAAACGTCTAGGAGTGCAAGAACTGGAAGTAAAACCCCTCCTCACTACA
ACAAACGGAAAGAAACTCAAAGTCTCAGCCATGGTCGACTCGGGATGCACACACACATGTATCGATGAAGGATTA
GTAAAGAAGAAGAAGATCCCGACGAAGAAATTGGAACGGCTGATCACATGCAGGAACTCAGATGGAACAATAGCA
GGAAAGAAGGATATCACCAAATTTGCGAAGATAGATCTAAACATCAACGGTCATAACGAGCAACTGGACGCGGTT
GTCACTCCATTACAATCATCCGACCTCTTTCTAGGTCATGATTGGTTAACAAACCACAACCCCGAAATCAATTGG
AAACAAGGAATGATCAAATTCAACCGGTGCCCCACATCATGTTCTTTTCCCCATACCGACATCTCTTTCGAACCA
TGTATACGACGATTACAGTCAAACGAAGACACTGAAGAAAAAGAACCGGATCCAACAAACCCTGAGGACTTACCA
GCATATATGAAACCCTTTGCCCATCTTTTCAACAGAAAGAACTTCGACAAACTACCTGAACGAACGGAATGGGAT
CACGAAATTAACTTCACGGAAAACGCACCAACGGAGATATCATCAAAAGTTTATAGCATGACACCACTGGAGAGA
GAAGAACTGGACAAATTCTTGGATGAAAATCTGGCTACCAATCGAATCCGACCATCGAAATCACCCTATGCAGCA
CCATGTTTTTTTGTCCCCAAGAAAGACGGTTCACTACGGTTATGTCAGGATTATAGGAAACTGAATGAAATCACG
ATCAAAGACAAGACGCCACTACCCCTCATCAGTGAAGTATTAGATCAACTCAGAGACGCCAAGGTTTTCAACAAA
TTGGACATTATCTGGGGGTATAACAACGTTCGGATACGAGAAGGAGATGAATGGAAAGCAGCGTTCTTGACGAAT
CGCGGATTATTTGAACCAACGGTCATGTTCTTTGGAATGAGTAATTCCCCCGCCACCTTCTCACGTATGATGGCG
ACAATCTTTCGAGAAATGATACAAGACGGATCTTTAGCCAACTACATGGACGATTTCATCATTCCAGCAAAGGAC
GATGAAGAATTGGAAGCACGGACTTTACGTTTTCTCAAAATCGCGGAGAAACACAATTTATCATTTAAACGGACG
AAATGCGAGTTCAATGTCTCATCAACAACGGTGTTAGGAACGGTTATCGGGAACGGAAAGGCAACAATGGAAGAA
GAAAAGGTCAAGGCAATACGAGATTGGGCAGTCCCTACCACGGTCAAACAAGTCGAAAGTTTTTTAGGTTTTGCC
AACTTCTATCGACGATTTATCAAGAATTTCAGCACCATCGCGCAACCACTAAACGAGCTGAAGTCTAAGAAGGGG
GAGAAATGGTATTGGAACGATGAACAACAACAAGCTTTCGAACAAATCAAACAGGCTATCGCCAGCGAACCGGTC
CTAGCGTTACCCAAGGACAAAGGACAATTCAGGGTTGAAGTAGACGCATCAAACTATGGAACAGGAGCAGTACTA
TCACAGGAACAGGAAGACAAATGGCACCCAGTCGCATTCATGTCGAAAACATTATCTGAAGCTGAACGAAACTAC
GAGATCTACGACAAGGAACTACTAGCTATCATAAAAGCTTTGAAACTATGGCGACACTACCTATTGGACGCAAAG
GAGCAATTTGAGATATGGACAGATCATGAGAACCTCAAATATTTCCGAGAACCTCAAAAGCTCAACGCTCGACAA
GCAAGATGGTACCTCATGCTACAGGAATACGATTTCCTTCTACGACACATTCCTGGGAAGACAAACACCAAAGCA
GATATCCTGTCAAGACTAATCAAACCTGACACATCTAACGACAACCGAGGAGTAGAAATGTTCAAGGAGAAAATG
TTCATCCGAAGACTTGAAGAATCCATCCCCATCTATGACGTCACCTTACTCCATAATCGAAGATTCGAAATCATA
GCCGATGAAACCCTACTTGAGAAGATTAGGAAATGTGAAAGACGAGAAACCAGAGTAATAGAAGAGATGAAGAAG
CAGCCAGAAAAAGTATGGGAGAACAATGGAATCATTTACCGACAAGGAAGGATCTATGTTCCGGATAACCAGGAG
ATCAGAGATTTCATTCTTCACGATCATCATAATTCTCCCGACGCCGGACATCCTGGAACGTACCGAATGCTAGAA
TCAGTTAAACGGACCTTTTGGTGGCCCACGATCAAAACGGATATCAGGAGATATGTCAGAGGATGCGACATGTGC
CAGAAGAACAAAACCATTCGACGACCCGATCACATCCCGCTTAATCCATTATCTATCCCCGACAAACCTTGGGAA
GAAATATCTATAGACATGATCGGACCACTACCGAAGTCAATGGAGAAGGATGCTATTATTGTTATCGTTGACAGA
TTCTCCAAAATGATCCACCTCGTTCCCACTACCACGTCGCTCACATCCATGGATCTTGCGGAAATCTATAAGGAA
GAAGTCTGGCGACATCATGGAATTCCGAAACAGATTATTAGCGACAGAGGACCACAGTTTGCATCGAAATTTATG
GAATCCCTATGCAAAGCTCTAGGCATTGAACGGAACCTTTCTACGGCGTATCACCCACAGACAGACGGTCAAACA
GAGCGGATGAATCAGGAAATTGAAACCTACCTTTGA
Gene >AgabiH97|039690
ATGAACAATCGATACGTTGTCCCTCAAAAACGTCTAGGAGTGCAAGAACTGGAAGTAAAACCCCTCCTCACTACA
ACAAACGGAAAGAAACTCAAAGTCTCAGCCATGGTCGACTCGGGATGCACACACACATGTATCGATGAAGGATTA
GTAAAGAAGAAGAAGATCCCGACGAAGAAATTGGAACGGCTGATCACATGCAGGAACTCAGATGGAACAATAGCA
GGAAAGAAGGATATCACCAAATTTGCGAAGATAGATCTAAACATCAACGGTCATAACGAGCAACTGGACGCGGTT
GTCACTCCATTACAATCATCCGACCTCTTTCTAGGTCATGATTGGTTAACAAACCACAACCCCGAAATCAATTGG
AAACAAGGAATGATCAAATTCAACCGGTGCCCCACATCATGTTCTTTTCCCCATACCGACATCTCTTTCGAACCA
TGTATACGACGATTACAGTCAAACGAAGACACTGAAGAAAAAGAACCGGATCCAACAAACCCTGAGGACTTACCA
GCATATATGAAACCCTTTGCCCATCTTTTCAACAGAAAGAACTTCGACAAACTACCTGAACGAACGGAATGGGAT
CACGAAATTAACTTCACGGAAAACGCACCAACGGAGATATCATCAAAAGTTTATAGCATGACACCACTGGAGAGA
GAAGAACTGGACAAATTCTTGGATGAAAATCTGGCTACCAATCGAATCCGACCATCGAAATCACCCTATGCAGCA
CCATGTTTTTTTGTCCCCAAGAAAGACGGTTCACTACGGTTATGTCAGGATTATAGGAAACTGAATGAAATCACG
ATCAAAGACAAGACGCCACTACCCCTCATCAGTGAAGTATTAGATCAACTCAGAGACGCCAAGGTTTTCAACAAA
TTGGACATTATCTGGGGGTATAACAACGTTCGGATACGAGAAGGAGATGAATGGAAAGCAGCGTTCTTGACGAAT
CGCGGATTATTTGAACCAACGGTCATGTTCTTTGGAATGAGTAATTCCCCCGCCACCTTCTCACGTATGATGGCG
ACAATCTTTCGAGAAATGATACAAGACGGATCTTTAGCCAACTACATGGACGATTTCATCATTCCAGCAAAGGAC
GATGAAGAATTGGAAGCACGGACTTTACGTTTTCTCAAAATCGCGGAGAAACACAATTTATCATTTAAACGGACG
AAATGCGAGTTCAATGTCTCATCAACAACGGTGTTAGGAACGGTTATCGGGAACGGAAAGGCAACAATGGAAGAA
GAAAAGGTCAAGGCAATACGAGATTGGGCAGTCCCTACCACGGTCAAACAAGTCGAAAGTTTTTTAGGTTTTGCC
AACTTCTATCGACGATTTATCAAGAATTTCAGCACCATCGCGCAACCACTAAACGAGCTGAAGTCTAAGAAGGGG
GAGAAATGGTATTGGAACGATGAACAACAACAAGCTTTCGAACAAATCAAACAGGCTATCGCCAGCGAACCGGTC
CTAGCGTTACCCAAGGACAAAGGACAATTCAGGGTTGAAGTAGACGCATCAAACTATGGAACAGGAGCAGTACTA
TCACAGGAACAGGAAGACAAATGGCACCCAGTCGCATTCATGTCGAAAACATTATCTGAAGCTGAACGAAACTAC
GAGATCTACGACAAGGAACTACTAGCTATCATAAAAGCTTTGAAACTATGGCGACACTACCTATTGGACGCAAAG
GAGCAATTTGAGATATGGACAGATCATGAGAACCTCAAATATTTCCGAGAACCTCAAAAGCTCAACGCTCGACAA
GCAAGATGGTACCTCATGCTACAGGAATACGATTTCCTTCTACGACACATTCCTGGGAAGACAAACACCAAAGCA
GATATCCTGTCAAGACTAATCAAACCTGACACATCTAACGACAACCGAGGAGTAGAAATGTTCAAGGAGAAAATG
TTCATCCGAAGACTTGAAGAATCCATCCCCATCTATGACGTCACCTTACTCCATAATCGAAGATTCGAAATCATA
GCCGATGAAACCCTACTTGAGAAGATTAGGAAATGTGAAAGACGAGAAACCAGAGTAATAGAAGAGATGAAGAAG
CAGCCAGAAAAAGTATGGGAGAACAATGGAATCATTTACCGACAAGGAAGGATCTATGTTCCGGATAACCAGGAG
ATCAGAGATTTCATTCTTCACGATCATCATAATTCTCCCGACGCCGGACATCCTGGAACGTACCGAATGCTAGAA
TCAGTTAAACGGACCTTTTGGTGGCCCACGATCAAAACGGATATCAGGAGATATGTCAGAGGATGCGACATGTGC
CAGAAGAACAAAACCATTCGACGACCCGATCACATCCCGCTTAATCCATTATCTATCCCCGACAAACCTTGGGAA
GAAATATCTATAGACATGATCGGACCACTACCGAAGTCAATGGAGAAGGATGCTATTATTGTTATCGTTGACAGA
TTCTCCAAAATGATCCACCTCGTTCCCACTACCACGTCGCTCACATCCATGGATCTTGCGGAAATCTATAAGGAA
GAAGTCTGGCGACATCATGGAATTCCGAAACAGATTATTAGCGACAGAGGACCACAGTTTGCATCGAAATTTATG
GAATCCCTATGCAAAGCTCTAGGCATTGAACGGAACCTTTCTACGGCGTATCACCCACAGACAGACGGTCAAACA
GAGCGGATGAATCAGGAAATTGAAACCTACCTTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail