Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|039600
Gene name
Locationscaffold_2:287262..290873
Strand-
Gene length (bp)3611
Transcript length (bp)2928
Coding sequence length (bp)2928
Protein length (aa) 976

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF17753 Ig_mannosidase Ig-fold domain 1.9E-12 884 972
PF17786 Mannosidase_ig Mannosidase Ig/CBM-like domain 3.7E-10 788 877

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5BCI8|MANBA_EMENI Beta-mannosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mndA PE=3 SV=1 10 971 0.0E+00
sp|Q2UN00|MANBA_ASPOR Beta-mannosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=mndA PE=3 SV=1 8 973 0.0E+00
sp|B8NP78|MANBA_ASPFN Beta-mannosidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=mndA PE=3 SV=1 8 973 0.0E+00
sp|A2QWU9|MANBA_ASPNC Beta-mannosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=mndA PE=3 SV=1 22 971 0.0E+00
sp|A1DMT2|MANBA_NEOFI Beta-mannosidase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=mndA PE=3 SV=1 7 971 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5BCI8|MANBA_EMENI Beta-mannosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mndA PE=3 SV=1 10 971 0.0E+00
sp|Q2UN00|MANBA_ASPOR Beta-mannosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=mndA PE=3 SV=1 8 973 0.0E+00
sp|B8NP78|MANBA_ASPFN Beta-mannosidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=mndA PE=3 SV=1 8 973 0.0E+00
sp|A2QWU9|MANBA_ASPNC Beta-mannosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=mndA PE=3 SV=1 22 971 0.0E+00
sp|A1DMT2|MANBA_NEOFI Beta-mannosidase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=mndA PE=3 SV=1 7 971 0.0E+00
sp|B0Y7S2|MANBA_ASPFC Beta-mannosidase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=mndA PE=3 SV=1 21 972 0.0E+00
sp|A1CTM5|MANBA_ASPCL Beta-mannosidase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=mndA PE=3 SV=1 6 972 0.0E+00
sp|Q0CI48|MANBA_ASPTN Beta-mannosidase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=mndA PE=3 SV=2 10 973 0.0E+00
sp|Q4WMS9|MANBA_ASPFU Beta-mannosidase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=mndA PE=3 SV=1 21 972 4.0E-180
sp|O74168|MANBA_ASPAC Beta-mannosidase A OS=Aspergillus aculeatus GN=mndA PE=1 SV=1 22 971 1.0E-157
sp|Q9UUZ3|MANBA_ASPNG Beta-mannosidase A OS=Aspergillus niger GN=mndA PE=1 SV=1 21 972 7.0E-156
sp|Q95327|MANBA_CAPHI Beta-mannosidase OS=Capra hircus GN=MANBA PE=2 SV=1 30 930 5.0E-95
sp|Q29444|MANBA_BOVIN Beta-mannosidase OS=Bos taurus GN=MANBA PE=1 SV=1 30 930 2.0E-92
sp|Q8K2I4|MANBA_MOUSE Beta-mannosidase OS=Mus musculus GN=Manba PE=1 SV=1 30 938 7.0E-91
sp|O00462|MANBA_HUMAN Beta-mannosidase OS=Homo sapiens GN=MANBA PE=2 SV=3 16 930 2.0E-85
sp|Q4FZV0|MANBA_RAT Beta-mannosidase OS=Rattus norvegicus GN=Manba PE=2 SV=1 30 776 2.0E-83
sp|Q93324|MANBA_CAEEL Probable beta-mannosidase OS=Caenorhabditis elegans GN=C33G3.4 PE=1 SV=1 22 796 2.0E-62
sp|I2C092|MANBB_THIHE Beta-mannosidase B OS=Thielavia heterothallica GN=man9 PE=1 SV=1 41 778 2.0E-56
sp|Q2TXB7|MANBB_ASPOR Beta-mannosidase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=mndB PE=3 SV=3 47 778 2.0E-53
sp|B8NW36|MANBB_ASPFN Beta-mannosidase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=mndB PE=3 SV=1 47 778 3.0E-53
sp|Q5B7W2|MANBB_EMENI Beta-mannosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mndB PE=1 SV=2 33 807 4.0E-53
sp|A1CGA8|MANBB_ASPCL Beta-mannosidase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=mndB PE=3 SV=1 53 807 6.0E-53
sp|Q0CCA0|MANBB_ASPTN Beta-mannosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=mndB PE=3 SV=2 41 907 4.0E-52
sp|B0YBU9|MANBB_ASPFC Beta-mannosidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=mndB PE=3 SV=1 51 807 4.0E-52
sp|A1D911|MANBB_NEOFI Beta-mannosidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=mndB PE=3 SV=1 51 807 1.0E-51
sp|Q4WAH4|MANBB_ASPFU Beta-mannosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=mndB PE=3 SV=1 51 807 2.0E-51
sp|A2QYN2|MANBB_ASPNC Beta-mannosidase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=mndB PE=3 SV=1 51 807 6.0E-50
sp|Q75W54|EBM_ARATH Mannosylglycoprotein endo-beta-mannosidase OS=Arabidopsis thaliana GN=EBM PE=1 SV=3 336 527 6.0E-10
sp|Q5H7P5|EBM_LILLO Mannosylglycoprotein endo-beta-mannosidase OS=Lilium longiflorum GN=EBM PE=1 SV=4 336 527 3.0E-08
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|039600
MLGFRFFALILSSLIGPTLAEVINLASLEWTLNSSNGTISIPSTGPPCQAHIDLLNAGIITEPLLGINDFTQRWI
AEENWTYKADITPFLQSSAFQSSNKTLLVFYGIDTIANITLSGQPVAWVNNQFRRYVFDVTHLLESPVDNELVLA
FESAWTYGLNVTAREDTEFFPSGNGVRTSDNYEYPGVRQWVRKVASDFGWDWGPAFIPSGVYKPAYLVTLSSPSG
SKQTIGTPPISPDINSTASPSPVFIEDASVDIYKLGESFSVAPEEGADWVVNVTFGLQSSVDFSTTSITLSFSEL
NVSQKFNVSNISATPDARGDGTNWVNAVWMLPDSVPQRWFPHNLGTPQLYNLSVTLDMESGGNDTVDSVSFDIRT
GFRTIQLVQNAYTSEEVAGGITPGDNWHFNINGRPFYALGTNIIPFDPFYARTTTDQVKWVLESAVKSGQNMLRI
WGGGTYQPSHPSVAGGVYDFYSLCDEMGILAWSELIFSDSLYPINDFLLESIEPEVRQNVRRVNRHPSNAQWAAG
NEIEGIVTTLVKSKVLDNATHYLDEYVTLFQDFLQPIVTSETRSVPYTDCSTTTGVLSLDPYELRLSNATPGEIY
GNGERYNYDPIQAFNYSTFPVTRFMNEFGFHSMPSFYSWEEVLLSPDDFSFNSTVVASRDHHPAAGSLDFPNPNA
HEGQSQMTLAVEDWLPRPIDSETNPNGTFAQWCYSTQVFQDLAMVAQVAWYRRGAGKGENNLGALVWQLNDIWQG
VSWSSVEYSGRWKVLQYGLTGIFTPLTIYPFWTPQNETLEVLVISDRLESVNGSAQLTWYDWEGRTLNSSTHSFM
VPSLNNSAILQETGLENILPQGQMSTDVWMLLNLTAEVDGRTVTNEQWFTPTSLANVALVDPQISITTSPNLTFT
LSAQGGVGVWTWMDHPSDTVGVFVDTETGTPLNGFFLVPGIDRHVQFEMNDALSRVKDPKPEDFVVRSLWNNTHI
*
Coding >AgabiH97|039600
ATGTTGGGCTTCCGCTTCTTTGCCCTCATTCTATCGTCGCTAATCGGACCTACCCTGGCTGAGGTCATTAATCTT
GCCAGTTTGGAATGGACTCTGAACAGCTCAAATGGAACGATCAGTATACCCTCCACGGGACCACCTTGTCAAGCC
CATATTGATCTGTTAAATGCTGGAATAATCACAGAACCACTACTGGGTATAAATGATTTTACGCAGCGCTGGATT
GCCGAAGAGAACTGGACTTATAAAGCCGACATCACCCCTTTCCTTCAGAGCAGCGCGTTTCAAAGCTCGAACAAA
ACACTGCTTGTTTTCTATGGGATTGATACGATCGCAAACATCACTCTTTCCGGTCAGCCAGTCGCGTGGGTCAAC
AATCAATTTCGTCGCTACGTCTTCGACGTGACGCATCTGCTTGAGTCTCCCGTAGACAATGAACTGGTTCTCGCC
TTCGAGTCTGCATGGACGTATGGTTTGAATGTTACTGCCCGGGAGGATACCGAGTTTTTCCCCAGTGGCAATGGT
GTGAGAACCAGTGACAACTACGAGTACCCTGGCGTTCGTCAATGGGTTCGCAAAGTCGCCTCAGATTTCGGTTGG
GATTGGGGCCCAGCATTCATTCCATCCGGAGTCTATAAACCAGCCTATCTTGTCACACTATCGTCTCCCAGTGGC
AGCAAACAGACCATTGGAACACCGCCAATTTCTCCGGATATCAACAGCACTGCCTCGCCGAGTCCAGTATTCATT
GAAGATGCTTCCGTTGATATATACAAGCTTGGCGAATCTTTTTCTGTAGCACCAGAAGAAGGTGCTGACTGGGTT
GTGAATGTCACTTTTGGTCTGCAGTCCTCTGTGGATTTTTCAACAACCTCGATAACCCTTTCTTTTTCGGAACTC
AACGTTAGTCAAAAATTCAACGTGTCGAATATCAGCGCTACGCCTGATGCTAGGGGTGATGGTACCAATTGGGTC
AATGCAGTATGGATGCTTCCAGACTCCGTGCCGCAAAGATGGTTCCCTCATAATCTCGGAACACCCCAACTTTAC
AATCTATCCGTCACCTTAGACATGGAGTCTGGAGGAAATGATACTGTTGACAGTGTCTCGTTCGATATCCGTACT
GGTTTCCGCACCATACAACTTGTTCAAAACGCGTATACTTCGGAGGAAGTGGCGGGAGGTATTACACCAGGAGAC
AATTGGCATTTCAACATAAATGGGAGGCCATTTTATGCCCTCGGTACCAATATCATCCCTTTCGACCCATTCTAT
GCCAGAACGACGACGGATCAGGTAAAATGGGTTCTCGAAAGTGCTGTTAAAAGCGGACAGAATATGTTGCGTATC
TGGGGCGGAGGCACATATCAACCTTCTCACCCCAGCGTTGCTGGTGGTGTTTACGATTTCTACTCACTCTGTGAT
GAGATGGGTATTTTGGCCTGGTCTGAGCTCATATTCTCCGATTCGTTATATCCGATCAACGACTTCTTATTGGAA
TCGATAGAACCTGAGGTCCGACAGAATGTGAGGAGGGTCAATAGACATCCAAGCAATGCGCAATGGGCTGCTGGG
AACGAGATCGAAGGGATTGTGACGACGCTGGTGAAATCCAAAGTCTTGGACAACGCTACTCATTATTTGGATGAG
TACGTAACGTTGTTCCAGGATTTCCTCCAGCCCATCGTGACCTCTGAGACTCGTTCAGTACCATATACGGATTGC
TCAACGACTACGGGAGTCTTGAGCTTGGATCCGTATGAGCTGCGATTGAGTAATGCCACGCCTGGTGAAATATAC
GGCAATGGAGAACGGTACAACTACGACCCTATCCAAGCTTTCAACTATAGTACCTTTCCGGTAACTCGGTTCATG
AACGAATTCGGGTTTCACTCCATGCCGTCTTTCTATAGCTGGGAGGAAGTGCTACTTTCACCAGATGACTTTTCC
TTCAACTCAACCGTAGTCGCATCCAGAGATCACCACCCAGCTGCTGGCAGCCTTGACTTCCCAAATCCAAACGCA
CATGAAGGTCAAAGTCAAATGACCCTCGCAGTTGAAGACTGGCTTCCCCGCCCAATCGACTCCGAAACCAACCCT
AATGGAACCTTTGCTCAATGGTGTTATAGCACTCAAGTTTTCCAGGATCTTGCTATGGTAGCTCAAGTGGCTTGG
TACAGACGTGGTGCTGGAAAGGGCGAAAACAATTTAGGAGCGCTCGTTTGGCAATTGAATGATATTTGGCAAGGT
GTAAGTTGGTCGAGTGTCGAATATTCTGGGAGGTGGAAGGTTTTGCAGTATGGGTTGACAGGTATATTTACGCCT
CTGACGATTTATCCGTTTTGGACTCCACAAAACGAGACGCTGGAGGTGTTGGTCATATCAGATCGGTTGGAGAGT
GTTAATGGGAGTGCGCAGTTGACTTGGTATGATTGGGAAGGGCGTACTTTGAATTCGTCAACACATTCGTTCATG
GTACCGAGTCTGAATAACTCGGCTATTCTTCAGGAAACTGGGTTGGAGAATATTTTGCCCCAAGGCCAAATGTCG
ACAGATGTCTGGATGTTGCTCAATTTAACGGCGGAGGTAGACGGCCGCACAGTAACAAATGAACAATGGTTCACG
CCAACGTCTCTAGCCAACGTCGCACTCGTAGATCCACAGATATCTATTACAACTTCGCCCAATCTCACTTTCACT
CTCTCCGCTCAAGGTGGAGTTGGAGTATGGACATGGATGGATCATCCTTCGGATACGGTCGGGGTTTTCGTCGAC
ACCGAAACCGGAACACCTTTAAATGGTTTCTTCCTCGTCCCCGGGATTGACAGACATGTACAATTTGAGATGAAT
GACGCTCTTTCTCGGGTCAAAGACCCCAAACCGGAAGATTTCGTAGTTCGATCTCTTTGGAATAATACACACATC
TAG
Transcript >AgabiH97|039600
ATGTTGGGCTTCCGCTTCTTTGCCCTCATTCTATCGTCGCTAATCGGACCTACCCTGGCTGAGGTCATTAATCTT
GCCAGTTTGGAATGGACTCTGAACAGCTCAAATGGAACGATCAGTATACCCTCCACGGGACCACCTTGTCAAGCC
CATATTGATCTGTTAAATGCTGGAATAATCACAGAACCACTACTGGGTATAAATGATTTTACGCAGCGCTGGATT
GCCGAAGAGAACTGGACTTATAAAGCCGACATCACCCCTTTCCTTCAGAGCAGCGCGTTTCAAAGCTCGAACAAA
ACACTGCTTGTTTTCTATGGGATTGATACGATCGCAAACATCACTCTTTCCGGTCAGCCAGTCGCGTGGGTCAAC
AATCAATTTCGTCGCTACGTCTTCGACGTGACGCATCTGCTTGAGTCTCCCGTAGACAATGAACTGGTTCTCGCC
TTCGAGTCTGCATGGACGTATGGTTTGAATGTTACTGCCCGGGAGGATACCGAGTTTTTCCCCAGTGGCAATGGT
GTGAGAACCAGTGACAACTACGAGTACCCTGGCGTTCGTCAATGGGTTCGCAAAGTCGCCTCAGATTTCGGTTGG
GATTGGGGCCCAGCATTCATTCCATCCGGAGTCTATAAACCAGCCTATCTTGTCACACTATCGTCTCCCAGTGGC
AGCAAACAGACCATTGGAACACCGCCAATTTCTCCGGATATCAACAGCACTGCCTCGCCGAGTCCAGTATTCATT
GAAGATGCTTCCGTTGATATATACAAGCTTGGCGAATCTTTTTCTGTAGCACCAGAAGAAGGTGCTGACTGGGTT
GTGAATGTCACTTTTGGTCTGCAGTCCTCTGTGGATTTTTCAACAACCTCGATAACCCTTTCTTTTTCGGAACTC
AACGTTAGTCAAAAATTCAACGTGTCGAATATCAGCGCTACGCCTGATGCTAGGGGTGATGGTACCAATTGGGTC
AATGCAGTATGGATGCTTCCAGACTCCGTGCCGCAAAGATGGTTCCCTCATAATCTCGGAACACCCCAACTTTAC
AATCTATCCGTCACCTTAGACATGGAGTCTGGAGGAAATGATACTGTTGACAGTGTCTCGTTCGATATCCGTACT
GGTTTCCGCACCATACAACTTGTTCAAAACGCGTATACTTCGGAGGAAGTGGCGGGAGGTATTACACCAGGAGAC
AATTGGCATTTCAACATAAATGGGAGGCCATTTTATGCCCTCGGTACCAATATCATCCCTTTCGACCCATTCTAT
GCCAGAACGACGACGGATCAGGTAAAATGGGTTCTCGAAAGTGCTGTTAAAAGCGGACAGAATATGTTGCGTATC
TGGGGCGGAGGCACATATCAACCTTCTCACCCCAGCGTTGCTGGTGGTGTTTACGATTTCTACTCACTCTGTGAT
GAGATGGGTATTTTGGCCTGGTCTGAGCTCATATTCTCCGATTCGTTATATCCGATCAACGACTTCTTATTGGAA
TCGATAGAACCTGAGGTCCGACAGAATGTGAGGAGGGTCAATAGACATCCAAGCAATGCGCAATGGGCTGCTGGG
AACGAGATCGAAGGGATTGTGACGACGCTGGTGAAATCCAAAGTCTTGGACAACGCTACTCATTATTTGGATGAG
TACGTAACGTTGTTCCAGGATTTCCTCCAGCCCATCGTGACCTCTGAGACTCGTTCAGTACCATATACGGATTGC
TCAACGACTACGGGAGTCTTGAGCTTGGATCCGTATGAGCTGCGATTGAGTAATGCCACGCCTGGTGAAATATAC
GGCAATGGAGAACGGTACAACTACGACCCTATCCAAGCTTTCAACTATAGTACCTTTCCGGTAACTCGGTTCATG
AACGAATTCGGGTTTCACTCCATGCCGTCTTTCTATAGCTGGGAGGAAGTGCTACTTTCACCAGATGACTTTTCC
TTCAACTCAACCGTAGTCGCATCCAGAGATCACCACCCAGCTGCTGGCAGCCTTGACTTCCCAAATCCAAACGCA
CATGAAGGTCAAAGTCAAATGACCCTCGCAGTTGAAGACTGGCTTCCCCGCCCAATCGACTCCGAAACCAACCCT
AATGGAACCTTTGCTCAATGGTGTTATAGCACTCAAGTTTTCCAGGATCTTGCTATGGTAGCTCAAGTGGCTTGG
TACAGACGTGGTGCTGGAAAGGGCGAAAACAATTTAGGAGCGCTCGTTTGGCAATTGAATGATATTTGGCAAGGT
GTAAGTTGGTCGAGTGTCGAATATTCTGGGAGGTGGAAGGTTTTGCAGTATGGGTTGACAGGTATATTTACGCCT
CTGACGATTTATCCGTTTTGGACTCCACAAAACGAGACGCTGGAGGTGTTGGTCATATCAGATCGGTTGGAGAGT
GTTAATGGGAGTGCGCAGTTGACTTGGTATGATTGGGAAGGGCGTACTTTGAATTCGTCAACACATTCGTTCATG
GTACCGAGTCTGAATAACTCGGCTATTCTTCAGGAAACTGGGTTGGAGAATATTTTGCCCCAAGGCCAAATGTCG
ACAGATGTCTGGATGTTGCTCAATTTAACGGCGGAGGTAGACGGCCGCACAGTAACAAATGAACAATGGTTCACG
CCAACGTCTCTAGCCAACGTCGCACTCGTAGATCCACAGATATCTATTACAACTTCGCCCAATCTCACTTTCACT
CTCTCCGCTCAAGGTGGAGTTGGAGTATGGACATGGATGGATCATCCTTCGGATACGGTCGGGGTTTTCGTCGAC
ACCGAAACCGGAACACCTTTAAATGGTTTCTTCCTCGTCCCCGGGATTGACAGACATGTACAATTTGAGATGAAT
GACGCTCTTTCTCGGGTCAAAGACCCCAAACCGGAAGATTTCGTAGTTCGATCTCTTTGGAATAATACACACATC
TAG
Gene >AgabiH97|039600
ATGTTGGGCTTCCGCTTCTTTGCCCTCATTCTATCGTCGCTAATCGGACCTACCCTGGCTGAGGTCATTAATCTT
GCCAGTTTGGAATGGACTCTGAACAGCTCAAATGGAACGATCAGTATACCCTCCACGGGACCACCTTGTCAAGCC
CATATTGATCTGTTAAATGCTGGAATAATCACAGAACCACTACTGGGTATAAATGGTACGTCTTTATGGTTTCCT
GGTTCTCCCACTTTTTACTCTTGTACCCAGATTTTACGCAGCGCTGGATTGCCGAAGAGAACTGGACTTATAAAG
CCGACATCACCCCTTTCCTTCAGAGCAGCGCGTTTCAAAGCTCGAACAAAACACTGCTTGTTTTCTATGGGATTG
ATACGATCGCAAACATCGTACGTCACTAATCATTGACAAGGTTCCAGGGTTGTTGTAGACTGTCTTCTTTCTTTC
AGACTCTTTCCGGTCAGCCAGTCGCGTGGGTCAACAATCAATTTCGTCGCTACGTCTTCGACGTGACGCATCTGC
TTGAGTCTCCCGTAGACAATGAACTGGTTCTCGCCTTCGAGTCTGCATGGACGTATGGTTTGAATGTTACTGCCC
GGGAGGATACCGAGTTTTTCCCCAGTGGCAATGGTGTGAGAACCAGTGACAACGTGAGTCCAGCAACCTCTATTT
TCAAATTCCTCTTTACTATATTTGACTTGTAGTACGAGTACCCTGGCGTTCGTCAATGGGTTCGCAAAGTCGCCT
CAGATTTCGGTTGGGATTGGGTATGATCTGTTTTTCTCTTCAGTTTCTCAGTCCGCTTGGTTGAGAACTTTATCG
GTTTAGGGCCCAGCATTCATTCCATCCGGAGTCTATAAACCAGCCTATCTTGTCACACTATCGTCTCCCAGTGGC
AGCAAACAGACCATTGGAACACCGCCAATTTCTCCGGATATCAACAGCACTGCCTCGCCGAGTCCAGTATTCATT
GAAGATGCTTCCGTTGATATATACAAGCTTGGCGAATCTTTTTCTGTAGCACCAGAAGAAGGTGCTGACTGGGTT
GTGAATGTCACTTTTGGTCTGCAGTCCTCTGTGGATTTTTCAACAACCTCGATAACCCTTTCTTTTTCGGAACTC
AACGTTAGTCAAAAATTCAACGTGTCGAATATCAGCGCTACGCCTGATGCTAGGGGTGATGGTACCAATTGGGTC
AATGCAGTATGGATGCTTCCAGACTCCGTGCCGCAAAGATGGTTCCCTCATAATCTCGGAACACCCCAACTTTAC
AATCTATCCGTCACCTTAGACATGGAGTCTGGAGGAAATGATACTGTTGACAGTGTCTCGTTCGATATCCGTACT
GGTTTCCGCACCATACAACTTGTTCAAAACGCGTATACTTCGGAGGAAGTGGCGGGAGGTATTACACCAGGAGAC
AATTGGCATTTCAACATAAATGGGAGGCCATTTTATGCCCTCGGTACCAATATCATCCCTTTCGACCCATTCTAT
GCCAGAACGACGACGGATCAGGTAAAATGGGTTCTCGAAAGTGCTGTTAAAAGCGGACAGAATATGGTGAGCATT
CTTTTTGTTTACGGTGTCATTGACGAAATCCGATTATGTTCGTAGTTGCGTATCTGGGGCGGAGGCACATATCAA
CCTTCTCACCCCAGCGTTGCTGGTGGTGTTTACGATTTCTACTCACTCTGTGATGAGATGGGTATTTTGGCCTGG
TCTGAGCTCATATTCTCCGATTCGTTATATCCGATCAACGACTTCTTATTGGAATCGATAGAACCTGAGGTCCGA
CAGAATGTGAGGAGGGTCAATAGACATCCAAGCAATGCGCAATGGGCTGCTGGGAACGAGATCGAAGGGATTGTG
ACGACGCTGGTGAAATCCAAAGTCTTGGACAACGCTACTCATTATTTGGATGAGGTATGTTGAGATTTATGATCT
GTTCTGCAAGGCTAATTATGGAGTATTCCAGTACGTAACGTTGTTCCAGGATTTCCTCCAGCCCATCGTGACCTC
TGAGACTCGTTCAGTGAGTTATTTGTTTGCTATTTGCTACGTTCAAGTTTGTATGACACTGTTATCTGTTCAGGT
ACCATATACGGATTGCTCAACGACTACGGGAGTCTTGAGCTTGGATCCGTATGAGCTGCGATTGAGTAATGCCAC
GCCTGGTGAAATATACGGCAATGGAGGCACGTTCTATGTCTTTCCTTTGTGATTTAAGGCTCAAGTTCTTGCAAT
TAGAACGGTACAACTACGACCCTATCCAAGCTTTCAACTATAGTACCTTTCCGGTAACTCGGTGAGCAGGTTCTT
GCAACTTTTATTCTCGTTGCTTACTTCGAAACGTCAAGGTTCATGAACGAATTCGGGTACGAGTTAGAATGAGGC
ATCCTTTCCCCCCTGTCCTGAACGAATTAAAACTTTCTAGGTTTCACTCCATGCCGTCTTTCTATAGCTGGGAGG
AAGTGCTACTTTCACCAGATGACTTTTCCTTCAACTCAACCGTAGTCGCATCCAGAGATCACCACCCAGCTGCTG
GCAGCCTTGACTTCCCAAATCCAAACGCACATGAAGGTCAAAGTCAAATGACCCTCGCAGTTGAAGACTGGCTTC
CCCGCCCAATCGACTCCGAAACCAACCCTAATGGAACCTTTGCTCAATGGTGTTATAGCACTCAAGTTTTCCAGG
ATCTTGCTATGGTAGCTCAAGTGGCTTGGTACAGACGTGGTGCTGGAAAGGGCGAAAACAATTTAGGAGCGCTCG
TTTGGCAATTGAATGATATTTGGCAAGGTGTAAGTTGGTCGAGTGTCGAATATTCTGGGAGGTGGAAGGTTTTGC
AGTATGGGTTGACAGGTATATTTACGCCTCTGACGATTTATCCGTTTTGGACTCCACAAAACGAGACGCTGGAGG
TGTTGGTCATATCAGATCGGTTGGAGAGTGTTAATGGGAGTGCGCAGTTGACTTGGTATGATTGGGAAGGGCGTA
CTTTGAATTCGTCAACACATTCGTTCATGGTACCGAGTCTGAATAACTCGGCTATTCTTCAGGAAACTGGGTTGG
AGAATATTTTGCCCCAAGGCCAAATGTCGACAGATGTCTGGATGTTGCTCAATTTAACGGCGGAGGTAGACGGCC
GCACAGTAACAAATGAACAATGGGTGCGTGTACCAAGGAAACAGTCTAAAAGAAAAAAGGATGACTGCTGAACTA
TCATTTGTTTTCCGTTCAGTTCACGCCAACGTCTCTAGCCAACGTCGCACTCGTAGATCCACAGATATCTATTAC
AACTTCGCCCAATCTCACTTTCACTCTCTCCGCTCAAGGTGGAGTTGGAGTATGGACATGGATGGATCATCCTTC
GGATACGGTCGGGGTTTTCGTCGACACCGAAACCGGAACACCTTTAAATGGTTTCTTCCTCGTCCCCGGGATTGA
CAGACATGGTATGTGTCCTATTTTCTGGCTATACTTACTCTCTCGTGATCCTGAATTTGTTTTCAGTACAATTTG
AGATGAATGACGCTCTTTCTCGGGTCAAAGACCCCAAACCGGAAGATTTCGTAGTTCGATCTCTTTGGAATAATA
CACACATCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail