Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|039500
Gene name
Locationscaffold_2:263563..264228
Strand+
Gene length (bp)665
Transcript length (bp)432
Coding sequence length (bp)432
Protein length (aa) 144

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase 1.2E-33 40 132

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P0CP97|FKBP2_CRYNB FK506-binding protein 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=FPR2 PE=3 SV=1 8 134 1.0E-43
sp|P0CP96|FKBP2_CRYNJ FK506-binding protein 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=FPR2 PE=3 SV=1 8 134 2.0E-43
sp|P0C1J5|FKB2B_RHIO9 FK506-binding protein 2B OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=FKBP3 PE=3 SV=1 4 142 5.0E-43
sp|Q54SR7|FKBP2_DICDI FK506-binding protein 2 OS=Dictyostelium discoideum GN=fkbp2 PE=3 SV=1 23 135 7.0E-39
sp|Q6CGG3|FKBP2_YARLI FK506-binding protein 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=FPR2 PE=3 SV=1 7 143 2.0E-38
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P0CP97|FKBP2_CRYNB FK506-binding protein 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=FPR2 PE=3 SV=1 8 134 1.0E-43
sp|P0CP96|FKBP2_CRYNJ FK506-binding protein 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=FPR2 PE=3 SV=1 8 134 2.0E-43
sp|P0C1J5|FKB2B_RHIO9 FK506-binding protein 2B OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=FKBP3 PE=3 SV=1 4 142 5.0E-43
sp|Q54SR7|FKBP2_DICDI FK506-binding protein 2 OS=Dictyostelium discoideum GN=fkbp2 PE=3 SV=1 23 135 7.0E-39
sp|Q6CGG3|FKBP2_YARLI FK506-binding protein 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=FPR2 PE=3 SV=1 7 143 2.0E-38
sp|Q6FSC1|FKBP2_CANGA FK506-binding protein 2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=FPR2 PE=3 SV=1 10 135 4.0E-38
sp|P32472|FKBP2_YEAST Peptidyl-prolyl cis-trans isomerase FPR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FPR2 PE=1 SV=1 4 132 5.0E-36
sp|Q6CUZ8|FKBP2_KLULA FK506-binding protein 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=FPR2 PE=3 SV=1 4 143 6.0E-36
sp|Q41649|FKB15_VICFA FK506-binding protein 2 OS=Vicia faba GN=FKBP15 PE=1 SV=1 18 135 2.0E-35
sp|Q4IN00|FKBP2_GIBZE FK506-binding protein 2 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=FPR2 PE=3 SV=2 26 143 8.0E-35
sp|Q2UPT7|FKBP2_ASPOR FK506-binding protein 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=fpr2 PE=3 SV=1 11 143 1.0E-34
sp|O60046|FKBP2_NEUCR FK506-binding protein 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=fkr-5 PE=1 SV=1 1 143 2.0E-33
sp|Q38936|FK152_ARATH Peptidyl-prolyl cis-trans isomerase FKBP15-2 OS=Arabidopsis thaliana GN=FKBP15-2 PE=2 SV=2 4 142 4.0E-33
sp|Q38935|FK151_ARATH Peptidyl-prolyl cis-trans isomerase FKBP15-1 OS=Arabidopsis thaliana GN=FKBP15-1 PE=2 SV=2 27 141 2.0E-31
sp|Q4WHX4|FKBP2_ASPFU FK506-binding protein 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=fpr2 PE=3 SV=1 27 143 2.0E-31
sp|Q86ZF2|FKBP2_PODAS FK506-binding protein 2 OS=Podospora anserina GN=FPR2 PE=3 SV=1 24 143 4.0E-31
sp|Q5ATN7|FKBP2_EMENI FK506-binding protein 2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=fkbB PE=3 SV=1 28 141 1.0E-30
sp|P59024|FKB14_MOUSE Peptidyl-prolyl cis-trans isomerase FKBP14 OS=Mus musculus GN=Fkbp14 PE=1 SV=1 1 142 2.0E-30
sp|P0A0W3|FKBP_NEIMC FK506-binding protein OS=Neisseria meningitidis serogroup C GN=fbp PE=3 SV=1 37 132 5.0E-30
sp|P45878|FKBP2_MOUSE Peptidyl-prolyl cis-trans isomerase FKBP2 OS=Mus musculus GN=Fkbp2 PE=1 SV=1 4 132 7.0E-30
sp|P20080|FKB1A_NEUCR FK506-binding protein 1A OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=fkr-2 PE=1 SV=1 38 134 1.0E-29
sp|Q6BP84|FKBP2_DEBHA FK506-binding protein 2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=FPR2 PE=3 SV=2 27 143 1.0E-29
sp|P0A0W2|FKBP_NEIMB FK506-binding protein OS=Neisseria meningitidis serogroup B (strain MC58) GN=fbp PE=1 SV=1 37 132 1.0E-29
sp|P56989|FKBP_NEIMA FK506-binding protein OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=fbp PE=3 SV=1 37 132 1.0E-29
sp|Q32PA9|FKBP2_BOVIN Peptidyl-prolyl cis-trans isomerase FKBP2 OS=Bos taurus GN=FKBP2 PE=2 SV=1 4 132 9.0E-29
sp|P26885|FKBP2_HUMAN Peptidyl-prolyl cis-trans isomerase FKBP2 OS=Homo sapiens GN=FKBP2 PE=1 SV=2 4 132 9.0E-29
sp|Q5R941|FKB14_PONAB Peptidyl-prolyl cis-trans isomerase FKBP14 OS=Pongo abelii GN=FKBP14 PE=2 SV=1 1 142 1.0E-28
sp|Q9NWM8|FKB14_HUMAN Peptidyl-prolyl cis-trans isomerase FKBP14 OS=Homo sapiens GN=FKBP14 PE=1 SV=1 1 142 1.0E-28
sp|Q66H94|FKBP9_RAT Peptidyl-prolyl cis-trans isomerase FKBP9 OS=Rattus norvegicus GN=Fkbp9 PE=2 SV=1 17 134 6.0E-28
sp|Q9Z247|FKBP9_MOUSE Peptidyl-prolyl cis-trans isomerase FKBP9 OS=Mus musculus GN=Fkbp9 PE=1 SV=1 17 134 6.0E-28
sp|Q4WLV6|FKB1A_ASPFU FK506-binding protein 1A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=fpr1A PE=3 SV=1 36 135 8.0E-28
sp|Q6CX30|FKBP_KLULA FK506-binding protein 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=FPR1 PE=3 SV=1 36 132 2.0E-27
sp|O42993|FKBP_SCHPO Peptidyl-prolyl cis-trans isomerase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fkh1 PE=3 SV=1 46 135 2.0E-27
sp|Q96AY3|FKB10_HUMAN Peptidyl-prolyl cis-trans isomerase FKBP10 OS=Homo sapiens GN=FKBP10 PE=1 SV=1 26 132 4.0E-27
sp|Q5RET2|FKBP7_PONAB Peptidyl-prolyl cis-trans isomerase FKBP7 OS=Pongo abelii GN=FKBP7 PE=2 SV=1 1 142 6.0E-27
sp|P20081|FKBP_YEAST FK506-binding protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FPR1 PE=1 SV=2 44 132 7.0E-27
sp|Q2KJC8|FKBP9_BOVIN Peptidyl-prolyl cis-trans isomerase FKBP9 OS=Bos taurus GN=FKBP9 PE=2 SV=1 24 134 1.0E-26
sp|Q61576|FKB10_MOUSE Peptidyl-prolyl cis-trans isomerase FKBP10 OS=Mus musculus GN=Fkbp10 PE=1 SV=2 24 132 2.0E-26
sp|Q6FMA3|FKBP_CANGA FK506-binding protein 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=FPR1 PE=3 SV=1 44 132 3.0E-26
sp|Q554J3|FKBP1_DICDI FK506-binding protein 1 OS=Dictyostelium discoideum GN=fkbp1 PE=3 SV=1 30 132 4.0E-26
sp|Q2HJ89|FKB10_BOVIN Peptidyl-prolyl cis-trans isomerase FKBP10 OS=Bos taurus GN=FKBP10 PE=2 SV=1 26 132 4.0E-26
sp|P62943|FKB1A_RABIT Peptidyl-prolyl cis-trans isomerase FKBP1A OS=Oryctolagus cuniculus GN=FKBP1A PE=1 SV=2 33 134 5.0E-26
sp|P62942|FKB1A_HUMAN Peptidyl-prolyl cis-trans isomerase FKBP1A OS=Homo sapiens GN=FKBP1A PE=1 SV=2 33 134 5.0E-26
sp|O95302|FKBP9_HUMAN Peptidyl-prolyl cis-trans isomerase FKBP9 OS=Homo sapiens GN=FKBP9 PE=1 SV=2 19 134 5.0E-26
sp|P0CP94|FKBP_CRYNJ FK506-binding protein 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=FPR1 PE=3 SV=1 44 132 6.0E-26
sp|P0CP95|FKBP_CRYNB FK506-binding protein 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=FPR1 PE=3 SV=1 44 132 6.0E-26
sp|P18203|FKB1A_BOVIN Peptidyl-prolyl cis-trans isomerase FKBP1A OS=Bos taurus GN=FKBP1A PE=1 SV=2 33 134 1.0E-25
sp|P0C1J4|FKB2A_RHIO9 FK506-binding protein 2A OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=FKBP2 PE=3 SV=1 4 135 2.0E-25
sp|O94746|FKBP_CRYNH FK506-binding protein 1 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=FRR1 PE=3 SV=1 44 132 2.0E-25
sp|P48375|FKB12_DROME 12 kDa FK506-binding protein OS=Drosophila melanogaster GN=FK506-bp2 PE=3 SV=2 36 132 2.0E-25
sp|Q62658|FKB1A_RAT Peptidyl-prolyl cis-trans isomerase FKBP1A OS=Rattus norvegicus GN=Fkbp1a PE=1 SV=3 44 134 3.0E-25
sp|O54998|FKBP7_MOUSE Peptidyl-prolyl cis-trans isomerase FKBP7 OS=Mus musculus GN=Fkbp7 PE=1 SV=1 21 138 4.0E-25
sp|Q6KBA8|FKB1A_EMENI FK506-binding protein 1A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=fprA PE=3 SV=1 36 132 7.0E-25
sp|Q6CF41|FKBP_YARLI FK506-binding protein 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=FPR1 PE=3 SV=1 35 135 1.0E-24
sp|P0C1J3|FKBP1_RHIO9 FK506-binding protein 1 OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=FKBP1 PE=3 SV=1 33 132 2.0E-24
sp|P68106|FKB1B_HUMAN Peptidyl-prolyl cis-trans isomerase FKBP1B OS=Homo sapiens GN=FKBP1B PE=1 SV=2 44 134 2.0E-24
sp|P68107|FKB1B_BOVIN Peptidyl-prolyl cis-trans isomerase FKBP1B OS=Bos taurus GN=FKBP1B PE=1 SV=2 44 134 2.0E-24
sp|Q96AY3|FKB10_HUMAN Peptidyl-prolyl cis-trans isomerase FKBP10 OS=Homo sapiens GN=FKBP10 PE=1 SV=1 30 132 3.0E-24
sp|Q2YDL5|FKB11_BOVIN Peptidyl-prolyl cis-trans isomerase FKBP11 OS=Bos taurus GN=FKBP11 PE=2 SV=1 36 134 3.0E-24
sp|Q43207|FKB70_WHEAT 70 kDa peptidyl-prolyl isomerase OS=Triticum aestivum GN=FKBP70 PE=1 SV=1 44 135 3.0E-24
sp|Q9FJL3|FKB65_ARATH Peptidyl-prolyl cis-trans isomerase FKBP65 OS=Arabidopsis thaliana GN=FKBP65 PE=1 SV=1 44 133 4.0E-24
sp|P26883|FKB1A_MOUSE Peptidyl-prolyl cis-trans isomerase FKBP1A OS=Mus musculus GN=Fkbp1a PE=1 SV=2 44 134 4.0E-24
sp|P28725|FKBP_STRAQ FK506-binding protein OS=Streptomyces anulatus GN=fkbP PE=1 SV=1 25 134 5.0E-24
sp|Q754K8|FKBP_ASHGO FK506-binding protein 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=FPR1 PE=3 SV=1 44 132 6.0E-24
sp|P97534|FKB1B_RAT Peptidyl-prolyl cis-trans isomerase FKBP1B OS=Rattus norvegicus GN=Fkbp1b PE=1 SV=3 51 134 7.0E-24
sp|Q9Z2I2|FKB1B_MOUSE Peptidyl-prolyl cis-trans isomerase FKBP1B OS=Mus musculus GN=Fkbp1b PE=1 SV=3 51 134 8.0E-24
sp|Q61576|FKB10_MOUSE Peptidyl-prolyl cis-trans isomerase FKBP10 OS=Mus musculus GN=Fkbp10 PE=1 SV=2 25 132 1.0E-23
sp|Q9D1M7|FKB11_MOUSE Peptidyl-prolyl cis-trans isomerase FKBP11 OS=Mus musculus GN=Fkbp11 PE=1 SV=1 36 143 1.0E-23
sp|O42123|FKB1A_XENLA Peptidyl-prolyl cis-trans isomerase FKBP1A OS=Xenopus laevis GN=fkbp1a PE=3 SV=3 44 134 1.0E-23
sp|Q2HJ89|FKB10_BOVIN Peptidyl-prolyl cis-trans isomerase FKBP10 OS=Bos taurus GN=FKBP10 PE=2 SV=1 25 132 2.0E-23
sp|Q8HYX6|FKB1B_RABIT Peptidyl-prolyl cis-trans isomerase FKBP1B OS=Oryctolagus cuniculus GN=FKBP1B PE=3 SV=3 44 134 3.0E-23
sp|Q61576|FKB10_MOUSE Peptidyl-prolyl cis-trans isomerase FKBP10 OS=Mus musculus GN=Fkbp10 PE=1 SV=2 35 132 4.0E-23
sp|Q9Y680|FKBP7_HUMAN Peptidyl-prolyl cis-trans isomerase FKBP7 OS=Homo sapiens GN=FKBP7 PE=1 SV=1 21 142 5.0E-23
sp|Q38931|FKB62_ARATH Peptidyl-prolyl cis-trans isomerase FKBP62 OS=Arabidopsis thaliana GN=FKBP62 PE=1 SV=2 44 132 5.0E-23
sp|Q9Z247|FKBP9_MOUSE Peptidyl-prolyl cis-trans isomerase FKBP9 OS=Mus musculus GN=Fkbp9 PE=1 SV=1 25 132 7.0E-23
sp|Q96AY3|FKB10_HUMAN Peptidyl-prolyl cis-trans isomerase FKBP10 OS=Homo sapiens GN=FKBP10 PE=1 SV=1 25 132 9.0E-23
sp|Q9NYL4|FKB11_HUMAN Peptidyl-prolyl cis-trans isomerase FKBP11 OS=Homo sapiens GN=FKBP11 PE=1 SV=1 36 134 9.0E-23
sp|Q66H94|FKBP9_RAT Peptidyl-prolyl cis-trans isomerase FKBP9 OS=Rattus norvegicus GN=Fkbp9 PE=2 SV=1 25 132 1.0E-22
sp|Q6BX45|FKBP_DEBHA FK506-binding protein 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=FPR1 PE=3 SV=1 46 134 1.0E-22
sp|Q2HJ89|FKB10_BOVIN Peptidyl-prolyl cis-trans isomerase FKBP10 OS=Bos taurus GN=FKBP10 PE=2 SV=1 30 132 2.0E-22
sp|Q2KJC8|FKBP9_BOVIN Peptidyl-prolyl cis-trans isomerase FKBP9 OS=Bos taurus GN=FKBP9 PE=2 SV=1 25 132 3.0E-22
sp|Q9FLB3|FK153_ARATH Peptidyl-prolyl cis-trans isomerase FKBP15-3 OS=Arabidopsis thaliana GN=FKBP15-3 PE=2 SV=1 42 134 3.0E-22
sp|O95302|FKBP9_HUMAN Peptidyl-prolyl cis-trans isomerase FKBP9 OS=Homo sapiens GN=FKBP9 PE=1 SV=2 10 132 6.0E-22
sp|Q66H94|FKBP9_RAT Peptidyl-prolyl cis-trans isomerase FKBP9 OS=Rattus norvegicus GN=Fkbp9 PE=2 SV=1 23 134 1.0E-21
sp|Q2KJC8|FKBP9_BOVIN Peptidyl-prolyl cis-trans isomerase FKBP9 OS=Bos taurus GN=FKBP9 PE=2 SV=1 23 134 2.0E-21
sp|O95302|FKBP9_HUMAN Peptidyl-prolyl cis-trans isomerase FKBP9 OS=Homo sapiens GN=FKBP9 PE=1 SV=2 23 134 2.0E-21
sp|Q93ZG9|FKB53_ARATH Peptidyl-prolyl cis-trans isomerase FKBP53 OS=Arabidopsis thaliana GN=FKBP53 PE=1 SV=1 42 134 2.0E-21
sp|Q9Z247|FKBP9_MOUSE Peptidyl-prolyl cis-trans isomerase FKBP9 OS=Mus musculus GN=Fkbp9 PE=1 SV=1 23 134 3.0E-21
sp|Q4W9R2|FKB1B_ASPFU FK506-binding protein 1B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=fpr1B PE=3 SV=1 41 132 2.0E-20
sp|Q9Z247|FKBP9_MOUSE Peptidyl-prolyl cis-trans isomerase FKBP9 OS=Mus musculus GN=Fkbp9 PE=1 SV=1 11 137 4.0E-20
sp|O95302|FKBP9_HUMAN Peptidyl-prolyl cis-trans isomerase FKBP9 OS=Homo sapiens GN=FKBP9 PE=1 SV=2 11 137 4.0E-20
sp|Q9QVC8|FKBP4_RAT Peptidyl-prolyl cis-trans isomerase FKBP4 OS=Rattus norvegicus GN=Fkbp4 PE=1 SV=3 16 131 5.0E-20
sp|P44760|FKBY_HAEIN Probable FKBP-type peptidyl-prolyl cis-trans isomerase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0574 PE=1 SV=1 44 136 9.0E-20
sp|Q66H94|FKBP9_RAT Peptidyl-prolyl cis-trans isomerase FKBP9 OS=Rattus norvegicus GN=Fkbp9 PE=2 SV=1 11 137 1.0E-19
sp|Q2KJC8|FKBP9_BOVIN Peptidyl-prolyl cis-trans isomerase FKBP9 OS=Bos taurus GN=FKBP9 PE=2 SV=1 11 137 1.0E-19
sp|Q61576|FKB10_MOUSE Peptidyl-prolyl cis-trans isomerase FKBP10 OS=Mus musculus GN=Fkbp10 PE=1 SV=2 36 137 1.0E-19
sp|P0CY37|FKB1B_EMENI FK506-binding protein 1B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=FKBP3 PE=3 SV=1 25 129 2.0E-19
sp|P27124|FKBP4_RABIT Peptidyl-prolyl cis-trans isomerase FKBP4 OS=Oryctolagus cuniculus GN=FKBP4 PE=1 SV=3 16 131 2.0E-19
sp|O08437|FKBA_AERHY FKBP-type peptidyl-prolyl cis-trans isomerase FkpA OS=Aeromonas hydrophila GN=fkpA PE=3 SV=1 16 134 2.0E-19
sp|Q9SCY2|FKB13_ARATH Peptidyl-prolyl cis-trans isomerase FKBP13, chloroplastic OS=Arabidopsis thaliana GN=FKBP13 PE=1 SV=2 34 133 2.0E-19
sp|P30416|FKBP4_MOUSE Peptidyl-prolyl cis-trans isomerase FKBP4 OS=Mus musculus GN=Fkbp4 PE=1 SV=5 16 131 3.0E-19
sp|Q9VL78|FKB59_DROME FK506-binding protein 59 OS=Drosophila melanogaster GN=FKBP59 PE=1 SV=1 40 133 4.0E-19
sp|Q02790|FKBP4_HUMAN Peptidyl-prolyl cis-trans isomerase FKBP4 OS=Homo sapiens GN=FKBP4 PE=1 SV=3 16 131 6.0E-19
sp|Q54NB6|FKBP4_DICDI FK506-binding protein 4 OS=Dictyostelium discoideum GN=fkbp4 PE=1 SV=1 44 132 6.0E-19
sp|Q2U316|FKBP_ASPOR FK506-binding protein 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=fpr1 PE=3 SV=1 45 132 2.0E-18
sp|Q2HJ89|FKB10_BOVIN Peptidyl-prolyl cis-trans isomerase FKBP10 OS=Bos taurus GN=FKBP10 PE=2 SV=1 30 137 4.0E-18
sp|Q9TRY0|FKBP4_BOVIN Peptidyl-prolyl cis-trans isomerase FKBP4 OS=Bos taurus GN=FKBP4 PE=1 SV=4 40 131 5.0E-18
sp|Q4HZB8|FKBP_GIBZE FK506-binding protein 1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=FPR1 PE=3 SV=2 44 131 8.0E-18
sp|P65764|FKBA_ECOL6 FKBP-type peptidyl-prolyl cis-trans isomerase FkpA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fkpA PE=3 SV=1 44 138 1.0E-17
sp|P65765|FKBA_ECO57 FKBP-type peptidyl-prolyl cis-trans isomerase FkpA OS=Escherichia coli O157:H7 GN=fkpA PE=3 SV=1 44 138 1.0E-17
sp|Q96AY3|FKB10_HUMAN Peptidyl-prolyl cis-trans isomerase FKBP10 OS=Homo sapiens GN=FKBP10 PE=1 SV=1 25 137 2.0E-17
sp|P45523|FKBA_ECOLI FKBP-type peptidyl-prolyl cis-trans isomerase FkpA OS=Escherichia coli (strain K12) GN=fkpA PE=1 SV=1 44 138 2.0E-17
sp|P28870|FKBP_CANAL FK506-binding protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RBP1 PE=3 SV=2 40 134 3.0E-17
sp|Q09734|MIP_TRYCR Macrophage infectivity potentiator OS=Trypanosoma cruzi GN=MIP PE=1 SV=1 47 137 4.0E-17
sp|P42458|FKBP_CORGL Probable FK506-binding protein OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=Cgl0830 PE=3 SV=1 24 132 5.0E-17
sp|P0A9L4|FKBB_SHIFL FKBP-type 22 kDa peptidyl-prolyl cis-trans isomerase OS=Shigella flexneri GN=fklB PE=3 SV=2 47 132 7.0E-17
sp|P0A9L3|FKBB_ECOLI FKBP-type 22 kDa peptidyl-prolyl cis-trans isomerase OS=Escherichia coli (strain K12) GN=fklB PE=1 SV=2 47 132 7.0E-17
sp|P54397|FKB39_DROME 39 kDa FK506-binding nuclear protein OS=Drosophila melanogaster GN=FK506-bp1 PE=1 SV=2 42 131 7.0E-17
sp|Q64378|FKBP5_MOUSE Peptidyl-prolyl cis-trans isomerase FKBP5 OS=Mus musculus GN=Fkbp5 PE=1 SV=1 46 132 7.0E-17
sp|O46638|FKBP3_RABIT Peptidyl-prolyl cis-trans isomerase FKBP3 OS=Oryctolagus cuniculus GN=FKBP3 PE=2 SV=2 40 134 8.0E-17
sp|P26884|FKBP3_BOVIN Peptidyl-prolyl cis-trans isomerase FKBP3 OS=Bos taurus GN=FKBP3 PE=1 SV=2 40 134 1.0E-16
sp|Q54G21|FKBP5_DICDI FK506-binding protein 5 OS=Dictyostelium discoideum GN=fkbp5 PE=1 SV=1 45 133 2.0E-16
sp|Q62446|FKBP3_MOUSE Peptidyl-prolyl cis-trans isomerase FKBP3 OS=Mus musculus GN=Fkbp3 PE=1 SV=2 40 134 2.0E-16
sp|Q7SCN0|FKBP4_NEUCR FK506-binding protein 4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=fkr-4 PE=3 SV=1 43 132 3.0E-16
sp|Q4INZ9|FKBP4_GIBZE FK506-binding protein 4 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=FPR4 PE=3 SV=1 44 132 3.0E-16
sp|Q9XSI2|FKBP5_SAGOE Peptidyl-prolyl cis-trans isomerase FKBP5 OS=Saguinus oedipus GN=FKBP5 PE=2 SV=2 46 132 3.0E-16
sp|Q00688|FKBP3_HUMAN Peptidyl-prolyl cis-trans isomerase FKBP3 OS=Homo sapiens GN=FKBP3 PE=1 SV=1 40 134 4.0E-16
sp|Q9M2S7|FK201_ARATH Peptidyl-prolyl cis-trans isomerase FKBP20-1 OS=Arabidopsis thaliana GN=FKBP20-1 PE=1 SV=1 49 136 5.0E-16
sp|Q9XSH5|FKBP5_SAIBB Peptidyl-prolyl cis-trans isomerase FKBP5 OS=Saimiri boliviensis boliviensis GN=FKBP5 PE=1 SV=1 46 132 5.0E-16
sp|Q13451|FKBP5_HUMAN Peptidyl-prolyl cis-trans isomerase FKBP5 OS=Homo sapiens GN=FKBP5 PE=1 SV=2 46 132 6.0E-16
sp|Q5RF88|FKBP5_PONAB Peptidyl-prolyl cis-trans isomerase FKBP5 OS=Pongo abelii GN=FKBP5 PE=2 SV=1 46 132 7.0E-16
sp|Q9XT11|FKBP5_AOTNA Peptidyl-prolyl cis-trans isomerase FKBP5 OS=Aotus nancymaae GN=FKBP5 PE=2 SV=2 46 132 7.0E-16
sp|Q4WMV5|FKBP4_ASPFU FK506-binding protein 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=fpr4 PE=3 SV=2 43 132 9.0E-16
sp|Q9SCY3|PNSL4_ARATH Photosynthetic NDH subunit of lumenal location 4, chloroplastic OS=Arabidopsis thaliana GN=PNSL4 PE=1 SV=1 41 141 3.0E-15
sp|P0C1J7|FKBP5_RHIO9 FK506-binding protein 5 OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=FKBP5 PE=3 SV=1 49 138 3.0E-15
sp|Q26486|FKBP4_SPOFR 46 kDa FK506-binding nuclear protein OS=Spodoptera frugiperda GN=FKBP46 PE=2 SV=1 43 131 4.0E-15
sp|Q6M981|FKB1B_NEUCR FK506-binding protein 1B OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=fkr-3 PE=3 SV=2 44 134 8.0E-15
sp|Q2UN37|FKBP4_ASPOR FK506-binding protein 4 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=fpr4 PE=3 SV=1 43 132 8.0E-15
sp|P0C1B0|FKBP4_EMENI FK506-binding protein 4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=fpr4 PE=3 SV=2 43 132 1.0E-14
sp|Q95L05|FKBP5_CHLAE Peptidyl-prolyl cis-trans isomerase FKBP5 OS=Chlorocebus aethiops GN=FKBP5 PE=2 SV=1 46 132 1.0E-14
sp|Q6C4C9|FKBP3_YARLI FK506-binding protein 3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=FPR3 PE=3 SV=1 43 134 1.0E-14
sp|F4J9Q6|FKB43_ARATH Peptidyl-prolyl cis-trans isomerase FKBP43 OS=Arabidopsis thaliana GN=FKBP43 PE=2 SV=1 43 134 2.0E-14
sp|P0C1J6|FKBP4_RHIO9 FK506-binding protein 4 OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=FKBP4 PE=3 SV=1 23 134 3.0E-14
sp|Q5T1M5|FKB15_HUMAN FK506-binding protein 15 OS=Homo sapiens GN=FKBP15 PE=1 SV=2 44 131 8.0E-14
sp|Q4PIN7|FKBP4_USTMA FK506-binding protein 4 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=FPR4 PE=3 SV=1 44 134 9.0E-14
sp|Q54N80|FKBP3_DICDI FK506-binding protein 3 OS=Dictyostelium discoideum GN=fkbp3 PE=2 SV=1 6 138 1.0E-13
sp|P0CP98|FKBP4_CRYNJ FK506-binding protein 4 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=FPR4 PE=3 SV=1 43 135 3.0E-13
sp|P0CP99|FKBP4_CRYNB FK506-binding protein 4 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=FPR4 PE=3 SV=1 43 135 3.0E-13
sp|P57599|FKBA_BUCAI FKBP-type peptidyl-prolyl cis-trans isomerase FkpA OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=fkpA PE=3 SV=1 49 137 1.0E-12
sp|Q6P9Q6|FKB15_MOUSE FK506-binding protein 15 OS=Mus musculus GN=Fkbp15 PE=1 SV=2 44 131 1.0E-12
sp|Q6FKH7|FKBP3_CANGA FK506-binding protein 3 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=FPR3 PE=3 SV=1 43 134 2.0E-12
sp|O74191|FKBP4_SCHPO FK506-binding protein 39 kDa OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fkbp39 PE=1 SV=1 43 132 2.0E-12
sp|Q89A61|FKBA_BUCBP FKBP-type peptidyl-prolyl cis-trans isomerase FkpA OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=fkpA PE=3 SV=1 44 134 4.0E-12
sp|Q06205|FKBP4_YEAST FK506-binding protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FPR4 PE=1 SV=1 43 134 6.0E-12
sp|P38911|FKBP3_YEAST FK506-binding nuclear protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FPR3 PE=1 SV=2 42 134 7.0E-12
sp|Q756V1|FKBP3_ASHGO FK506-binding protein 3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=FPR3 PE=3 SV=2 43 134 2.0E-11
sp|P26623|MIP_CHLTR Peptidyl-prolyl cis-trans isomerase Mip OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=mip PE=3 SV=3 51 132 2.0E-11
sp|Q59VR3|FKBP3_CANAL FK506-binding protein 3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=FPR3 PE=3 SV=1 43 134 2.0E-11
sp|O04287|FKB12_VICFA Peptidyl-prolyl cis-trans isomerase FKBP12 OS=Vicia faba GN=FKBP12 PE=1 SV=1 46 132 2.0E-11
sp|Q8K943|FKBA_BUCAP FKBP-type peptidyl-prolyl cis-trans isomerase FkpA OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=fkpA PE=3 SV=1 49 134 4.0E-11
sp|Q9PJK1|MIP_CHLMU Peptidyl-prolyl cis-trans isomerase Mip OS=Chlamydia muridarum (strain MoPn / Nigg) GN=mip PE=3 SV=2 51 132 4.0E-11
sp|Q6FK71|FKBP4_CANGA FK506-binding protein 4 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=FPR4 PE=3 SV=1 42 134 5.0E-11
sp|Q6BSE7|FKBP3_DEBHA FK506-binding protein 3 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=FPR3 PE=3 SV=1 20 134 9.0E-11
sp|Q6CWE8|FKBP3_KLULA FK506-binding protein 3 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=FPR3 PE=3 SV=1 37 134 1.0E-10
sp|P53605|MIP_LEGLO Outer membrane protein MIP OS=Legionella longbeachae GN=mip PE=3 SV=1 47 134 2.0E-10
sp|Q9Z7P3|MIP_CHLPN Peptidyl-prolyl cis-trans isomerase Mip OS=Chlamydia pneumoniae GN=mip PE=3 SV=1 42 132 2.0E-10
sp|P51752|MIP_COXBU Peptidyl-prolyl cis-trans isomerase Mip OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=mip PE=1 SV=2 47 134 2.0E-10
sp|Q8LGG0|FKB12_ARATH Peptidyl-prolyl cis-trans isomerase FKBP12 OS=Arabidopsis thaliana GN=FKBP12 PE=1 SV=2 42 132 7.0E-10
sp|Q9JYI8|FKBA_NEIMB Probable FKBP-type peptidyl-prolyl cis-trans isomerase FkpA OS=Neisseria meningitidis serogroup B (strain MC58) GN=fkpA PE=1 SV=1 47 134 7.0E-10
sp|P30417|FKBZ_PSEAE Probable FKBP-type 25 kDa peptidyl-prolyl cis-trans isomerase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=fkl PE=3 SV=2 41 134 8.0E-10
sp|Q70YI1|MIP_LEGPN Outer membrane protein MIP OS=Legionella pneumophila GN=mip PE=1 SV=1 47 134 8.0E-09
sp|A5IGB8|MIP_LEGPC Outer membrane protein MIP OS=Legionella pneumophila (strain Corby) GN=mip PE=3 SV=1 47 134 8.0E-09
sp|P31106|MIP_TATMI Outer membrane protein MIP OS=Tatlockia micdadei GN=mip PE=3 SV=1 47 134 9.0E-09
sp|O75344|FKBP6_HUMAN Inactive peptidyl-prolyl cis-trans isomerase FKBP6 OS=Homo sapiens GN=FKBP6 PE=1 SV=1 48 132 9.0E-09
sp|Q5ZXE0|MIP_LEGPH Outer membrane protein MIP OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=mip PE=1 SV=2 47 134 1.0E-08
sp|D3ZQF4|FKBP6_RAT Inactive peptidyl-prolyl cis-trans isomerase FKBP6 OS=Rattus norvegicus GN=Fkbp6 PE=3 SV=1 48 134 1.0E-08
sp|Q10175|FKBPH_SCHPO Probable peptidyl-prolyl cis-trans isomerase C27F1.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC27F1.06c PE=1 SV=1 43 135 1.0E-08
sp|Q9SR70|FK164_ARATH Peptidyl-prolyl cis-trans isomerase FKBP16-4, chloroplastic OS=Arabidopsis thaliana GN=FKBP16-4 PE=1 SV=1 42 138 1.0E-08
sp|F6PHZ6|FKBP6_HORSE Inactive peptidyl-prolyl cis-trans isomerase FKBP6 OS=Equus caballus GN=FKBP6 PE=1 SV=2 48 134 2.0E-08
sp|O22870|FK163_ARATH Peptidyl-prolyl cis-trans isomerase FKBP16-3, chloroplastic OS=Arabidopsis thaliana GN=FKBP16-3 PE=1 SV=2 46 142 2.0E-08
sp|Q91XW8|FKBP6_MOUSE Inactive peptidyl-prolyl cis-trans isomerase FKBP6 OS=Mus musculus GN=Fkbp6 PE=1 SV=1 48 132 2.0E-08
sp|A6QQ71|FKBP6_BOVIN Inactive peptidyl-prolyl cis-trans isomerase FKBP6 OS=Bos taurus GN=FKBP6 PE=2 SV=1 48 134 2.0E-08
sp|Q75LS8|FKB9L_HUMAN Putative FK506-binding protein 9-like protein OS=Homo sapiens GN=FKBP9P1 PE=5 SV=1 90 137 3.0E-08
sp|Q54Y27|FKBP6_DICDI FK506-binding protein 6 OS=Dictyostelium discoideum GN=fkbp6 PE=3 SV=1 49 133 2.0E-07
sp|Q43207|FKB70_WHEAT 70 kDa peptidyl-prolyl isomerase OS=Triticum aestivum GN=FKBP70 PE=1 SV=1 41 134 5.0E-07
sp|Q0WRJ7|FK202_ARATH Peptidyl-prolyl cis-trans isomerase FKBP20-2, chloroplastic OS=Arabidopsis thaliana GN=FKBP20-2 PE=1 SV=1 44 134 9.0E-07
sp|Q9FJL3|FKB65_ARATH Peptidyl-prolyl cis-trans isomerase FKBP65 OS=Arabidopsis thaliana GN=FKBP65 PE=1 SV=1 29 134 1.0E-06
sp|Q57726|FKBP1_METJA Putative FKBP-type peptidyl-prolyl cis-trans isomerase MJ0278 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0278 PE=3 SV=1 41 111 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003755 peptidyl-prolyl cis-trans isomerase activity Yes
GO:0140096 catalytic activity, acting on a protein No
GO:0003674 molecular_function No
GO:0016853 isomerase activity No
GO:0003824 catalytic activity No
GO:0016859 cis-trans isomerase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|039500
MQFFNWLLCLILTVVLPVLAKKKAPKELVIDTTYKPEKCTNKAQSGDSIKVHYTGTLYDTGSKFDSSLDRNSPLG
LKLGAGQVIKGWEKGLQGMCLNEKRKLTIPPDMAYGKSGFGSVIPPESTLVFDVELVGLTPGPNHQEL*
Coding >AgabiH97|039500
ATGCAATTCTTCAACTGGCTTCTCTGCCTCATCCTCACCGTCGTTCTCCCCGTTCTCGCAAAGAAAAAGGCTCCA
AAAGAGTTGGTTATTGACACGACATACAAACCCGAGAAATGTACGAACAAAGCTCAGTCTGGAGACTCCATTAAA
GTTCACTACACTGGAACTTTGTATGACACTGGAAGCAAATTTGATTCAAGCCTTGACAGGAATAGTCCTCTCGGC
CTTAAACTTGGTGCCGGCCAGGTCATCAAGGGCTGGGAAAAAGGTCTACAAGGCATGTGTCTCAACGAGAAACGG
AAACTTACTATTCCTCCGGACATGGCCTATGGGAAATCTGGATTCGGTTCTGTCATTCCCCCCGAATCTACTCTT
GTCTTCGACGTAGAACTCGTCGGTCTGACGCCTGGCCCAAACCATCAAGAGCTTTAA
Transcript >AgabiH97|039500
ATGCAATTCTTCAACTGGCTTCTCTGCCTCATCCTCACCGTCGTTCTCCCCGTTCTCGCAAAGAAAAAGGCTCCA
AAAGAGTTGGTTATTGACACGACATACAAACCCGAGAAATGTACGAACAAAGCTCAGTCTGGAGACTCCATTAAA
GTTCACTACACTGGAACTTTGTATGACACTGGAAGCAAATTTGATTCAAGCCTTGACAGGAATAGTCCTCTCGGC
CTTAAACTTGGTGCCGGCCAGGTCATCAAGGGCTGGGAAAAAGGTCTACAAGGCATGTGTCTCAACGAGAAACGG
AAACTTACTATTCCTCCGGACATGGCCTATGGGAAATCTGGATTCGGTTCTGTCATTCCCCCCGAATCTACTCTT
GTCTTCGACGTAGAACTCGTCGGTCTGACGCCTGGCCCAAACCATCAAGAGCTTTAA
Gene >AgabiH97|039500
ATGCAATTCTTCAACTGGCTTCTCTGCCTCATCCTCACCGTCGTTCTCCCCGTTCTCGCAAAGAAAAAGGCTCCA
AAAGAGTTGGTTATTGACACGACATACAAACCCGAGAAATGTACGAACAAAGCTCAGTCTGGAGACTCCATTAAA
GTTCACTACGTGCGTCTACATTTACTTTCCCTTGTAATGCATGCATGTGACTGATTCTGTACATCTTGCAGACTG
GAACTTTGTATGACACTGGAAGCAAATTTGATTCAAGGTACGGCTATCCTTTCGTTTCGGAAGGGAAATGGAAAC
ACTGACGATTATGATAGCCTTGACAGGAATAGTCCTCTCGGCCTTAAACGTGGGTTTCCTTTCGTATATCCATAA
CATATCATCACCTCATTCGTTTCTATACTCCAGTTGGTGCCGGCCAGGTCATCAAGGGCTGGGAAAAAGGTCTAC
AAGGCATGTGTCTCAACGAGAAACGGAAACTTACTATTCCTCCGGACATGGCCTATGGTAATATCTAATCCGAAT
AATTTCATTTTGTATTTTATGCTCAACCAACTCGCTTAGGGAAATCTGGATTCGGTTCTGTCATTCCCCCCGAAT
CTACTCTTGTCTTCGACGTAGAACTCGTCGGTCTGACGCCTGGCCCAAACCATCAAGAGCTTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail