Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|039490
Gene name
Locationscaffold_2:261239..262162
Strand-
Gene length (bp)923
Transcript length (bp)615
Coding sequence length (bp)615
Protein length (aa) 205

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04420 CHD5 CHD5-like protein 5.7E-55 6 164

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A8N7T9|GET1_COPC7 Protein GET1 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=GET1 PE=3 SV=1 3 175 1.0E-60
sp|B0D1L7|GET1_LACBS Protein GET1 OS=Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) GN=GET1 PE=3 SV=1 3 175 2.0E-51
sp|P0CS59|GET1_CRYNB Protein GET1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=GET1 PE=3 SV=1 1 180 3.0E-40
sp|P0CS58|GET1_CRYNJ Protein GET1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=GET1 PE=3 SV=1 1 180 4.0E-40
sp|A7EF54|GET1_SCLS1 Protein get1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=get1 PE=3 SV=2 1 167 1.0E-36
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A8N7T9|GET1_COPC7 Protein GET1 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=GET1 PE=3 SV=1 3 175 1.0E-60
sp|B0D1L7|GET1_LACBS Protein GET1 OS=Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) GN=GET1 PE=3 SV=1 3 175 2.0E-51
sp|P0CS59|GET1_CRYNB Protein GET1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=GET1 PE=3 SV=1 1 180 3.0E-40
sp|P0CS58|GET1_CRYNJ Protein GET1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=GET1 PE=3 SV=1 1 180 4.0E-40
sp|A7EF54|GET1_SCLS1 Protein get1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=get1 PE=3 SV=2 1 167 1.0E-36
sp|A6RUY7|GET1_BOTFB Protein get1 OS=Botryotinia fuckeliana (strain B05.10) GN=get1 PE=3 SV=2 1 167 1.0E-35
sp|A1CXY5|GET1_NEOFI Protein get1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=get1 PE=3 SV=1 1 179 1.0E-35
sp|Q4WNN2|GET1_ASPFU Protein get1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=get1 PE=3 SV=1 1 179 3.0E-35
sp|B0Y5H9|GET1_ASPFC Protein get1 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=get1 PE=3 SV=1 1 179 3.0E-35
sp|B2B0S1|GET1_PODAN Protein GET1 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=GET1 PE=3 SV=1 1 179 1.0E-34
sp|A1CGU5|GET1_ASPCL Protein get1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=get1 PE=3 SV=1 1 189 1.0E-33
sp|B6Q234|GET1_TALMQ Protein get1 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=get1 PE=3 SV=1 17 178 7.0E-33
sp|Q7S0A1|GET1_NEUCR Protein get-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=get-1 PE=3 SV=1 1 178 4.0E-32
sp|C6H7W0|GET1_AJECH Protein GET1 OS=Ajellomyces capsulatus (strain H143) GN=GET1 PE=3 SV=1 1 184 6.0E-32
sp|B8LUE3|GET1_TALSN Protein get1 OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=get1 PE=3 SV=1 17 174 2.0E-31
sp|Q0UTI3|GET1_PHANO Protein GET1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=GET1 PE=3 SV=1 1 177 2.0E-31
sp|A2QHQ3|GET1_ASPNC Protein get1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=get1 PE=3 SV=1 1 179 4.0E-31
sp|C0NIJ2|GET1_AJECG Protein GET1 OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=GET1 PE=3 SV=1 1 184 1.0E-30
sp|A6RH42|GET1_AJECN Protein GET1 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=GET1 PE=3 SV=1 1 184 5.0E-30
sp|A4RHX3|GET1_MAGO7 Protein GET1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=GET1 PE=3 SV=2 1 193 7.0E-30
sp|Q5B538|GET1_EMENI Protein get1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=get1 PE=3 SV=2 1 186 9.0E-30
sp|B2W1P8|GET1_PYRTR Protein get1 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=get1 PE=3 SV=1 1 177 1.0E-29
sp|Q0CL45|GET1_ASPTN Protein get1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=get1 PE=3 SV=2 1 174 3.0E-28
sp|Q2UG70|GET1_ASPOR Protein get1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=get1 PE=3 SV=1 1 187 4.0E-28
sp|B8NA66|GET1_ASPFN Protein get1 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=get1 PE=3 SV=2 1 187 4.0E-28
sp|Q2GNR9|GET1_CHAGB Protein GET1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=GET1 PE=3 SV=1 1 178 2.0E-27
sp|B9WA88|GET1_CANDC Golgi to ER traffic protein 1 OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=GET1 PE=3 SV=1 3 167 4.0E-27
sp|C4YJ00|GET1_CANAW Golgi to ER traffic protein 1 OS=Candida albicans (strain WO-1) GN=GET1 PE=3 SV=1 3 167 4.0E-27
sp|B6HS10|GET1_PENRW Protein get1 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=get1 PE=3 SV=1 1 181 7.0E-27
sp|C5M5F1|GET1_CANTT Golgi to ER traffic protein 1 OS=Candida tropicalis (strain ATCC MYA-3404 / T1) GN=GET1 PE=3 SV=1 3 168 9.0E-27
sp|C5FEL7|GET1_ARTOC Protein GET1 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=GET1 PE=3 SV=1 1 176 1.0E-26
sp|Q5ACW6|GET1_CANAL Golgi to ER traffic protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GET1 PE=3 SV=1 3 167 1.0E-26
sp|C1H0T6|GET1_PARBA Protein GET1 OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=GET1 PE=3 SV=1 1 178 3.0E-26
sp|C5JW43|GET1_AJEDS Protein GET1 OS=Ajellomyces dermatitidis (strain SLH14081) GN=GET1 PE=3 SV=1 1 178 3.0E-26
sp|C5G729|GET1_AJEDR Protein GET1 OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=GET1 PE=3 SV=1 1 178 3.0E-26
sp|C0S9J4|GET1_PARBP Protein GET1 OS=Paracoccidioides brasiliensis (strain Pb03) GN=GET1 PE=3 SV=1 1 178 6.0E-26
sp|C1GC25|GET1_PARBD Protein GET1 OS=Paracoccidioides brasiliensis (strain Pb18) GN=GET1 PE=3 SV=1 1 178 6.0E-26
sp|C4JT27|GET1_UNCRE Protein GET1 OS=Uncinocarpus reesii (strain UAMH 1704) GN=GET1 PE=3 SV=1 1 178 8.0E-26
sp|A8PTK5|GET1_MALGO Protein GET1 OS=Malassezia globosa (strain ATCC MYA-4612 / CBS 7966) GN=GET1 PE=3 SV=1 33 179 9.0E-26
sp|C5P8K5|GET1_COCP7 Protein GET1 OS=Coccidioides posadasii (strain C735) GN=GET1 PE=3 SV=1 1 177 2.0E-25
sp|Q1DZS0|GET1_COCIM Protein GET1 OS=Coccidioides immitis (strain RS) GN=GET1 PE=3 SV=2 1 177 5.0E-25
sp|A3LMX9|GET1_PICST Golgi to ER traffic protein 1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=GET1 PE=3 SV=2 3 167 2.0E-21
sp|Q6C555|GET1_YARLI Golgi to ER traffic protein 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=GET1 PE=3 SV=1 15 169 5.0E-19
sp|Q9HGM2|GET1_SCHPO Protein get1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=get1 PE=1 SV=1 1 164 6.0E-19
sp|A5DFM9|GET1_PICGU Golgi to ER traffic protein 1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=GET1 PE=3 SV=3 3 166 1.0E-17
sp|A5DV09|GET1_LODEL Golgi to ER traffic protein 1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=GET1 PE=3 SV=1 3 167 6.0E-17
sp|Q6BYU3|GET1_DEBHA Golgi to ER traffic protein 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=GET1 PE=3 SV=1 3 184 3.0E-15
sp|C4R7S7|GET1_PICPG Golgi to ER traffic protein 1 OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=GET1 PE=3 SV=1 18 159 7.0E-15
sp|B6JZY9|GET1_SCHJY Protein get1 OS=Schizosaccharomyces japonicus (strain yFS275 / FY16936) GN=get1 PE=3 SV=1 23 167 8.0E-14
sp|C4XXV8|GET1_CLAL4 Golgi to ER traffic protein 1 OS=Clavispora lusitaniae (strain ATCC 42720) GN=GET1 PE=3 SV=1 3 167 2.0E-13
sp|Q3SZ26|WRB_BOVIN Tail-anchored protein insertion receptor WRB OS=Bos taurus GN=WRB PE=2 SV=1 30 169 5.0E-11
sp|O00258|WRB_HUMAN Tail-anchored protein insertion receptor WRB OS=Homo sapiens GN=WRB PE=1 SV=2 30 169 1.0E-10
sp|Q5R6K7|WRB_PONAB Tail-anchored protein insertion receptor WRB OS=Pongo abelii GN=WRB PE=2 SV=1 30 169 1.0E-10
sp|Q6P6S5|WRB_RAT Tail-anchored protein insertion receptor WRB OS=Rattus norvegicus GN=Wrb PE=2 SV=1 44 169 3.0E-10
sp|Q8K0D7|WRB_MOUSE Tail-anchored protein insertion receptor WRB OS=Mus musculus GN=Wrb PE=1 SV=1 44 169 5.0E-10
sp|Q6DRM0|WRB_DANRE Tail-anchored protein insertion receptor WRB OS=Danio rerio GN=wrb PE=2 SV=1 34 174 7.0E-10
[Show less]

GO

GO Term Description Terminal node
GO:0071816 tail-anchored membrane protein insertion into ER membrane Yes
GO:0070727 cellular macromolecule localization No
GO:0051641 cellular localization No
GO:0051179 localization No
GO:0033036 macromolecule localization No
GO:0051234 establishment of localization No
GO:0045184 establishment of protein localization No
GO:0045048 protein insertion into ER membrane No
GO:0008150 biological_process No
GO:0009987 cellular process No
GO:0008104 protein localization No
GO:0072657 protein localization to membrane No
GO:0090150 establishment of protein localization to membrane No
GO:0051668 localization within membrane No
GO:0051205 protein insertion into membrane No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

Domain # Start End Length
1 4 26 22
2 102 124 22
3 139 161 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|039490
MPSLILTAFLIVLVAQVVSWIGESVLCDFAYALYLRTINNSLVRQQSKLKTELLKTKQELAKTSAQDQFAKWAKL
RRSVDKMLSDLEKLNSKLSSGKTTFTIAFRVFLWIFVNIPQYGIAWRYRSKAVFWLPQGWFNPIVTWWLAFPFAP
KGSVSVMTWTWACKYVLQIGNEAVKVIILPVFFPAQILRWSNVYVFVDYYNCQM*
Coding >AgabiH97|039490
ATGCCTTCGTTAATTCTTACCGCATTCCTAATTGTCTTGGTGGCGCAAGTGGTGTCGTGGATAGGCGAGAGTGTG
CTATGCGACTTTGCGTATGCTCTATATCTCCGAACAATAAATAATTCTCTTGTTCGTCAACAGAGTAAATTGAAG
ACTGAGCTTTTAAAAACGAAACAAGAACTCGCGAAAACGAGTGCACAGGATCAATTTGCGAAATGGGCGAAATTG
AGACGGAGTGTGGATAAAATGCTATCAGACCTCGAGAAACTCAACTCGAAACTCTCTTCAGGAAAAACAACGTTC
ACGATTGCATTTCGAGTCTTCCTCTGGATATTCGTTAATATTCCTCAATATGGTATCGCATGGAGATATCGTTCT
AAGGCAGTCTTTTGGCTTCCTCAAGGATGGTTTAATCCGATTGTGACTTGGTGGTTGGCTTTTCCGTTTGCACCC
AAGGGTTCAGTTAGTGTTATGACTTGGACTTGGGCGTGTAAATATGTTTTGCAGATTGGTAATGAGGCTGTGAAG
GTTATTATTTTGCCAGTGTTTTTCCCAGCGCAAATTCTGCGATGGAGTAATGTATATGTTTTCGTAGATTATTAC
AACTGTCAGATGTAA
Transcript >AgabiH97|039490
ATGCCTTCGTTAATTCTTACCGCATTCCTAATTGTCTTGGTGGCGCAAGTGGTGTCGTGGATAGGCGAGAGTGTG
CTATGCGACTTTGCGTATGCTCTATATCTCCGAACAATAAATAATTCTCTTGTTCGTCAACAGAGTAAATTGAAG
ACTGAGCTTTTAAAAACGAAACAAGAACTCGCGAAAACGAGTGCACAGGATCAATTTGCGAAATGGGCGAAATTG
AGACGGAGTGTGGATAAAATGCTATCAGACCTCGAGAAACTCAACTCGAAACTCTCTTCAGGAAAAACAACGTTC
ACGATTGCATTTCGAGTCTTCCTCTGGATATTCGTTAATATTCCTCAATATGGTATCGCATGGAGATATCGTTCT
AAGGCAGTCTTTTGGCTTCCTCAAGGATGGTTTAATCCGATTGTGACTTGGTGGTTGGCTTTTCCGTTTGCACCC
AAGGGTTCAGTTAGTGTTATGACTTGGACTTGGGCGTGTAAATATGTTTTGCAGATTGGTAATGAGGCTGTGAAG
GTTATTATTTTGCCAGTGTTTTTCCCAGCGCAAATTCTGCGATGGAGTAATGTATATGTTTTCGTAGATTATTAC
AACTGTCAGATGTAA
Gene >AgabiH97|039490
ATGCCTTCGTTAATTCTTACCGCATTCCTAATTGTCTTGGTGGCGCAAGTGGTGTCGTGGATAGGCGAGAGTGTG
CTATGCGACTTTGTGCGTTTCCTTTCCGCTTATACTGCCTCAACCCGGAGTCCTGACCCGAACGTGGCATTCGCA
AAGGCGTATGCTCTATATCTCCGAACAATAAATAATTCTCTTGTTCGTCAACAGAGTAAATTGAAGACTGAGCTT
TTAAAAACGAAACAAGAACTCGCGAAAACGAGTGCACAGGATCAATTTGCGAAATGGGCGAAATTGAGACGGAGT
GTGGATAAAATGCTATCAGACCTCGAGAAACTCAGTATGTCTTACCTTCAGCCAACCCTTCACAGTTCTCAACTA
TTCTCTTTTTCCAGACTCGAAACTCTCTTCAGGAAAAACAACGTTCACGATTGCATTTCGAGTCTTCCTCTGGAT
ATTCGTTAATATTCCTCAATATGGTATCGCATGGAGATATCGTTCTAAGGCAGTCTTTTGGCTTCCTCAAGGATG
GTTTAATCCGATTGTGACTTGGTGGTTGGCTTTTCCGTTTGCACCCAAGGGTTCAGTTAGTGTTATGACTTGGAC
TTGGGCGTGTAAATATGTTTTGCAGATTGGTAATGAGGCTGTGAAGGTTATTATTTGTGAGTTGCTCTTTCCTTC
GTCTGTGTCGTATGCTTTTGTGACTCAATGTCTGATTAATGTATTTAGTGCCAGTGTTTTTCCCAGCGCAAGTTA
ATGCAGGCGAAAAGCAAAAGGAGAAAGTAGAGAAGGGAGAACCTATCCCTGTTGCCGCGCTCGACTAGATTCTGT
AGGTGCCTGTCATCTTTTCCGGAAACACAATTCTGAAGTCGATAAGGCGATGGAGTAATGTATATGTTTTCGTAG
ATTATTACAACTGTCAGATGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail