Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|039240
Gene name
Locationscaffold_2:179419..184681
Strand-
Gene length (bp)5262
Transcript length (bp)5262
Coding sequence length (bp)5262
Protein length (aa) 1754

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07727 RVT_2 Reverse transcriptase (RNA-dependent DNA polymerase) 2.4E-67 1320 1555
PF00665 rve Integrase core domain 1.9E-10 801 896
PF14223 Retrotran_gag_2 gag-polypeptide of LTR copia-type 2.1E-08 113 223
PF13976 gag_pre-integrs GAG-pre-integrase domain 8.4E-07 741 785

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P10978|POLX_TOBAC Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum PE=2 SV=1 1279 1753 5.0E-102
sp|P04146|COPIA_DROME Copia protein OS=Drosophila melanogaster GN=GIP PE=1 SV=3 1298 1753 4.0E-79
sp|P10978|POLX_TOBAC Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum PE=2 SV=1 541 1135 4.0E-49
sp|P04146|COPIA_DROME Copia protein OS=Drosophila melanogaster GN=GIP PE=1 SV=3 596 1025 2.0E-40
sp|P25600|YCH4_YEAST Putative transposon Ty5-1 protein YCL074W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY5A PE=5 SV=2 1394 1702 5.0E-39
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P10978|POLX_TOBAC Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum PE=2 SV=1 1279 1753 5.0E-102
sp|P04146|COPIA_DROME Copia protein OS=Drosophila melanogaster GN=GIP PE=1 SV=3 1298 1753 4.0E-79
sp|P10978|POLX_TOBAC Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum PE=2 SV=1 541 1135 4.0E-49
sp|P04146|COPIA_DROME Copia protein OS=Drosophila melanogaster GN=GIP PE=1 SV=3 596 1025 2.0E-40
sp|P25600|YCH4_YEAST Putative transposon Ty5-1 protein YCL074W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY5A PE=5 SV=2 1394 1702 5.0E-39
sp|P92519|M810_ARATH Uncharacterized mitochondrial protein AtMg00810 OS=Arabidopsis thaliana GN=AtMg00810 PE=4 SV=1 1479 1706 2.0E-29
sp|P0C2I3|YD15B_YEAST Transposon Ty1-DR6 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR6 PE=3 SV=1 1300 1713 1.0E-26
sp|P0C2I7|YL14B_YEAST Transposon Ty1-LR4 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR4 PE=5 SV=1 1300 1713 1.0E-26
sp|Q07163|TY1AB_YEASX Transposon TyH3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae GN=TY1B PE=1 SV=2 1300 1713 1.0E-26
sp|Q12490|YB11B_YEAST Transposon Ty1-BL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-BL PE=1 SV=1 1300 1712 2.0E-26
sp|Q12141|YG11B_YEAST Transposon Ty1-GR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR1 PE=3 SV=1 1300 1712 2.0E-26
sp|Q04214|YM13B_YEAST Transposon Ty1-MR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-MR1 PE=1 SV=2 1300 1712 4.0E-26
sp|P47100|YJ12B_YEAST Transposon Ty1-JR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-JR2 PE=3 SV=3 1300 1712 4.0E-26
sp|P0C2I2|YD14B_YEAST Transposon Ty1-DR5 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR5 PE=3 SV=1 1300 1713 5.0E-26
sp|P0C2I5|YL12B_YEAST Transposon Ty1-LR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR2 PE=3 SV=1 1300 1713 5.0E-26
sp|Q03434|YM12B_YEAST Transposon Ty1-ML2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ML2 PE=3 SV=2 1300 1713 6.0E-26
sp|P0C2J0|YP13B_YEAST Transposon Ty1-PR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR2 PE=3 SV=1 1300 1713 6.0E-26
sp|Q03612|YE11B_YEAST Transposon Ty1-ER1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ER1 PE=3 SV=1 1300 1713 6.0E-26
sp|Q12414|YP11B_YEAST Transposon Ty1-PL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PL PE=3 SV=1 1300 1713 6.0E-26
sp|Q12273|YO11B_YEAST Transposon Ty1-OL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-OL PE=3 SV=1 1300 1713 7.0E-26
sp|Q12269|YG12B_YEAST Transposon Ty1-GR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR2 PE=3 SV=3 1300 1713 7.0E-26
sp|Q04711|YM11B_YEAST Transposon Ty1-ML1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ML1 PE=3 SV=2 1300 1713 8.0E-26
sp|Q12316|YG13B_YEAST Transposon Ty1-GR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR3 PE=3 SV=3 1300 1712 1.0E-25
sp|Q92393|YO12B_YEAST Transposon Ty1-OR Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-OR PE=3 SV=1 1300 1712 1.0E-25
sp|P0C2J3|YL21B_YEAST Transposon Ty2-LR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-LR1 PE=3 SV=1 1304 1713 2.0E-25
sp|Q12193|YB12B_YEAST Transposon Ty1-BR Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-BR PE=3 SV=1 1300 1712 2.0E-25
sp|P25384|YC21B_YEAST Transposon Ty2-C Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-C PE=3 SV=2 1304 1713 2.0E-25
sp|P0CX64|YG22B_YEAST Transposon Ty2-GR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-GR2 PE=3 SV=1 1304 1713 3.0E-25
sp|P47098|YJ11B_YEAST Transposon Ty1-JR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-JR1 PE=3 SV=3 1300 1713 3.0E-25
sp|Q12112|YN11B_YEAST Transposon Ty1-NL1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-NL1 PE=3 SV=1 1300 1712 3.0E-25
sp|Q12337|YG21B_YEAST Transposon Ty2-GR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-GR1 PE=5 SV=2 1304 1713 3.0E-25
sp|P0CX63|YF21B_YEAST Transposon Ty2-F Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-F PE=3 SV=1 1304 1713 3.0E-25
sp|Q99231|YD12B_YEAST Transposon Ty1-DR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR3 PE=1 SV=2 1300 1713 3.0E-25
sp|Q12501|YO22B_YEAST Transposon Ty2-OR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-OR2 PE=1 SV=1 1304 1713 4.0E-25
sp|Q03855|YD11B_YEAST Transposon Ty1-DR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR1 PE=3 SV=2 1300 1713 4.0E-25
sp|O13535|YH11B_YEAST Transposon Ty1-H Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-H PE=3 SV=1 1330 1713 6.0E-25
sp|Q12113|YO21B_YEAST Transposon Ty2-OR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-OR1 PE=3 SV=1 1304 1713 6.0E-25
sp|Q12472|YD21B_YEAST Transposon Ty2-DR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR1 PE=1 SV=3 1288 1713 6.0E-25
sp|Q03494|YD22B_YEAST Transposon Ty2-DR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR2 PE=3 SV=2 1304 1713 6.0E-25
sp|P0C2J1|YP14B_YEAST Transposon Ty1-PR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR3 PE=1 SV=1 1300 1713 7.0E-25
sp|P0C2I9|YP12B_YEAST Transposon Ty1-PR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR1 PE=3 SV=1 1300 1713 7.0E-25
sp|Q12491|YB21B_YEAST Transposon Ty2-B Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-B PE=3 SV=1 1288 1713 8.0E-25
sp|P0C2I6|YL13B_YEAST Transposon Ty1-LR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR3 PE=3 SV=1 1300 1713 8.0E-25
sp|O13527|YA11B_YEAST Truncated transposon Ty1-A Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-A PE=3 SV=3 1300 1713 9.0E-25
sp|Q04670|YM14B_YEAST Transposon Ty1-MR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-MR2 PE=3 SV=2 1330 1713 1.0E-24
sp|Q07791|YD23B_YEAST Transposon Ty2-DR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR3 PE=3 SV=1 1304 1713 1.0E-24
sp|Q03619|YE12B_YEAST Transposon Ty1-ER2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ER2 PE=3 SV=1 1330 1713 2.0E-24
sp|Q99337|YN12B_YEAST Transposon Ty1-NL2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-NL2 PE=3 SV=1 1300 1713 2.0E-24
sp|Q12088|YL11B_YEAST Transposon Ty1-LR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR1 PE=3 SV=1 1330 1713 6.0E-24
sp|P47024|YJ41B_YEAST Transposon Ty4-J Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY4B-J PE=3 SV=3 1311 1713 4.0E-22
sp|P0C2J7|YH41B_YEAST Transposon Ty4-H Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY4B-H PE=3 SV=1 1311 1713 5.0E-22
sp|Q07793|YD13B_YEAST Transposon Ty1-DR4 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR4 PE=3 SV=2 1300 1636 1.0E-19
sp|P0C2J5|YL22B_YEAST Transposon Ty2-LR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-LR2 PE=5 SV=1 1304 1559 2.0E-14
sp|P92520|M820_ARATH Uncharacterized mitochondrial protein AtMg00820 OS=Arabidopsis thaliana GN=AtMg00820 PE=4 SV=1 1303 1384 2.0E-10
sp|P92512|M710_ARATH Uncharacterized mitochondrial protein AtMg00710 OS=Arabidopsis thaliana GN=AtMg00710 PE=4 SV=1 907 992 4.0E-08
sp|Q12501|YO22B_YEAST Transposon Ty2-OR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-OR2 PE=1 SV=1 568 941 6.0E-08
sp|P0C2J7|YH41B_YEAST Transposon Ty4-H Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY4B-H PE=3 SV=1 737 941 1.0E-07
sp|A0A0B7P3V8|YP41B_YEAST Transposon Ty4-P Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY4B-P PE=5 SV=2 737 941 1.0E-07
sp|Q12337|YG21B_YEAST Transposon Ty2-GR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-GR1 PE=5 SV=2 741 990 1.0E-07
sp|P0C2J5|YL22B_YEAST Transposon Ty2-LR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-LR2 PE=5 SV=1 741 941 1.0E-07
sp|Q07791|YD23B_YEAST Transposon Ty2-DR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR3 PE=3 SV=1 741 941 1.0E-07
sp|Q12491|YB21B_YEAST Transposon Ty2-B Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-B PE=3 SV=1 741 941 1.0E-07
sp|Q12113|YO21B_YEAST Transposon Ty2-OR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-OR1 PE=3 SV=1 741 941 1.0E-07
sp|Q12472|YD21B_YEAST Transposon Ty2-DR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR1 PE=1 SV=3 741 941 1.0E-07
sp|Q03494|YD22B_YEAST Transposon Ty2-DR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR2 PE=3 SV=2 741 941 1.0E-07
sp|P0CX63|YF21B_YEAST Transposon Ty2-F Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-F PE=3 SV=1 741 941 1.0E-07
sp|P0CX64|YG22B_YEAST Transposon Ty2-GR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-GR2 PE=3 SV=1 741 941 1.0E-07
sp|P25384|YC21B_YEAST Transposon Ty2-C Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-C PE=3 SV=2 741 941 1.0E-07
sp|P0C2J3|YL21B_YEAST Transposon Ty2-LR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-LR1 PE=3 SV=1 741 941 1.0E-07
sp|P47024|YJ41B_YEAST Transposon Ty4-J Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY4B-J PE=3 SV=3 737 941 2.0E-07
sp|P93290|M240_ARATH Uncharacterized mitochondrial protein AtMg00240 OS=Arabidopsis thaliana GN=AtMg00240 PE=4 SV=1 1586 1663 7.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0015074 DNA integration Yes
GO:0008150 biological_process No
GO:0006259 DNA metabolic process No
GO:0044238 primary metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0009987 cellular process No
GO:0071704 organic substance metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0008152 metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0044237 cellular metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|039240
MSHVMALLPSVAMLTGAENYTTWRNAMSDILTLLPAEGFPFSGLDVCENKWTIQLRNIPGRAADGNTISLTQEQI
DENDVIDNARKERERLSRTAIAMINARTTNGLIPIRFENAHDLWKMLKDTYGIASPSAIYSMFQQTGNFRISGAK
EPSAEIAQLEQIYSQLTSNNVEIPPLIQAMTLLGSIPEQWKIASSFLAAKGDVKDVTFHAVRSAILQEYNQRQTA
NNSQAHRFSGVKQGNQKPAWRPYKGQQQQQQRPYNNGPHQNQSQMRPQGQQQQQQRSGPPPKKNRRGKKNHQQVN
EISNRNTAQCIDYTAQDATMFASASVVRDVPAQHVGERSLLTRISHDPRPRPYERLTPDRFETAKLRAVLQYDER
LKNRENLGLIPLTDEQLRRKLLRIELTKELKKDEQEQSLMTAFRNDGETSTIPKGERREAFLRQQEVQDEYRHMN
EIFRAHFAAEESKQTSEMEMDDAVSKTISEDAPTSFDSETVSLGGSDADQTEMISPFTCVPRSNLDDLTANFIQT
GNVPYNSNVDRDICRTPAVDNNNTFCFASISEEEGDSQSQKSISLESHHCSGKPCETCGMIPVNNNYPIRWLLDS
GASGHFTNDLDDFIEYDIGDFGSMGTAEAGKILHITAYGSVMIEHEVTDEDTGNTLKKRTTIPNVKYVEGLMGRI
LSPILFSEGNDWTMVGRAAYTNMYKHDLPVLTAQRIPTQADRLHYVLTRVVKIAETSYKTARLITYDIWHQRFGH
ISETALSKVPKATEPKVEIPSKTGTVCPGCALGKQTQKPFYPNPKRAKKLAELTHSDLLELPITSYHKFKWVITF
LDDYSSNCSIFLLKQKSEATQTIKDFVTGTELMSNTKCLRFHTDNGGEYMSEELARFFREKGIIHETTAPYAHQQ
NGRAERLNRTLLEKAQAMRLHACLPDSYWEFAIRTAVHVYNRTPMRRLNWKTPTELREGIKPKIDHLRVFGCGAY
VFIPEEKRQNKLTPRSEYMTFIGYIESGYIFLRHRHNRALFVSPTAIFDEGIFPLCPNGGIGRITIPREPETSTD
DLTSNSDNNAPEPSEQGSVPSFDLDPSLYDPNEPAVPPRPTNPTPPRSESPRSRSPSNEEASDDDDHLSYEDFDP
SQKKEVHFRPTPPPNTPSDLSEDEVQPPTNEKGKMPERRRLEHEIVLPETFPPRRSTRTRQPPLRPDNIYGERSN
PTDIERQKVNDWPRPSTVKESQRPTIPLPKRVRGPRWNKGQDAEVPRPATGNPLPNTPETEEQQLHRLASEGGKD
FINLLLANAITPVTYKDLDNIPQDDQKAWIEACIDELRALKKRGVYEIVDLPEGRKTVKNRWVFNIKSDGRKRAR
LVAKGFSQIEGIDFNELFSPVVRYETARLIFGVAALEDWEIESVDVKAAYLYGKLEEEIYMEQPEGFRKDNDKRV
WRLHRALYGLKQSGLAWWRELTASMKDLGFKRCSSDAGVYYYSDPQTKQLIIALVYVDDVAIIGKKTALFINLKR
KIMNKWECRDLGETKEFLGINIQRDRKNRRIFLNQENYLEKILEKFDVTSKPTKTPLKSGFTFVPFNRSASPAFR
QKYQQLVGSLMYLMIGTRPDIAYATVKLSQQCANPAQEHYDQGLYVLRYLLGSRHYRLKFHGASNEALVAYSDSD
WAQDPTNRKSVTGNYVTIAKGCVSWLSRKQKTVASSSTEAEYMALSDCSKQLVWMSQLLKEIGFDLPSPYLNADN
EGSIFWASNPVQERRSKHIDIRYHVVRE*
Coding >AgabiH97|039240
ATGTCTCACGTTATGGCACTTCTTCCTTCGGTTGCAATGCTTACCGGTGCAGAAAACTATACTACCTGGAGGAAC
GCGATGTCCGATATTTTGACATTACTCCCCGCAGAAGGATTCCCTTTCAGTGGCCTTGACGTTTGTGAAAACAAA
TGGACAATCCAATTAAGAAACATCCCTGGCCGAGCAGCAGATGGCAATACAATCTCTCTCACCCAGGAGCAGATC
GATGAAAACGATGTCATTGATAACGCTAGGAAGGAAAGAGAACGTCTTTCCAGAACCGCTATAGCCATGATCAAT
GCTCGTACCACCAACGGTCTCATCCCCATTAGGTTCGAGAACGCTCACGATCTCTGGAAGATGCTCAAGGACACT
TATGGTATAGCCAGTCCATCGGCTATCTACTCCATGTTTCAACAAACCGGGAATTTCCGTATCTCGGGTGCTAAA
GAACCCTCAGCTGAGATCGCCCAATTGGAGCAGATCTATAGTCAGCTGACTAGTAATAATGTCGAGATTCCACCT
CTCATTCAAGCAATGACGTTGCTCGGATCAATTCCTGAGCAATGGAAAATTGCTTCTTCATTCCTTGCCGCTAAG
GGTGACGTCAAAGATGTCACCTTTCATGCAGTCCGCTCCGCTATTCTTCAAGAATACAATCAGCGTCAGACTGCT
AATAATTCTCAAGCGCATCGATTCTCTGGCGTCAAACAAGGCAATCAAAAGCCTGCTTGGCGACCATATAAAGGG
CAGCAGCAGCAGCAGCAGAGGCCATATAACAATGGCCCTCACCAAAACCAATCGCAGATGCGCCCGCAAGGGCAG
CAACAACAACAACAGCGAAGTGGTCCGCCCCCAAAGAAGAATCGTCGTGGGAAGAAAAACCACCAGCAGGTGAAT
GAAATTTCCAATAGAAATACAGCTCAATGTATTGATTATACTGCACAGGATGCGACCATGTTCGCCTCCGCCAGT
GTCGTTCGAGATGTCCCTGCTCAACATGTAGGAGAACGATCACTATTAACACGGATTTCTCATGATCCACGCCCT
AGACCCTACGAACGCCTCACCCCAGACCGGTTCGAAACTGCCAAACTCCGCGCCGTACTCCAGTATGACGAACGC
CTGAAGAACCGAGAAAATCTCGGCCTCATCCCGCTCACCGACGAACAACTCCGTCGGAAGCTCCTCCGCATCGAG
CTCACCAAGGAGCTCAAAAAGGATGAGCAGGAGCAGAGTCTTATGACAGCGTTCAGGAACGATGGAGAAACTTCT
ACTATCCCCAAGGGGGAAAGACGAGAAGCTTTCCTGAGGCAGCAAGAGGTCCAAGACGAGTACCGGCACATGAAC
GAAATATTCCGGGCACACTTCGCAGCAGAAGAGTCGAAGCAGACCTCCGAAATGGAAATGGACGACGCAGTCTCC
AAGACTATTTCAGAAGATGCCCCAACATCGTTCGATTCGGAGACCGTATCCCTGGGCGGATCTGATGCAGATCAG
ACCGAGATGATTTCGCCGTTTACGTGCGTACCTCGATCTAATCTTGATGACTTAACAGCTAATTTTATCCAGACC
GGAAATGTCCCCTACAATTCAAATGTAGATAGGGATATTTGTAGAACTCCGGCTGTAGATAATAATAATACTTTT
TGCTTCGCTTCTATATCTGAGGAAGAAGGTGATAGCCAATCACAAAAAAGCATAAGTTTAGAAAGTCATCATTGC
TCTGGCAAGCCGTGTGAAACATGCGGAATGATTCCTGTAAATAATAATTACCCAATCAGATGGCTCCTCGATTCG
GGAGCATCAGGTCACTTCACAAACGACCTTGATGACTTCATCGAGTACGATATCGGCGACTTCGGATCAATGGGA
ACTGCCGAAGCAGGAAAGATCCTTCATATCACTGCTTATGGTTCAGTCATGATCGAGCATGAGGTAACTGATGAA
GATACTGGTAATACTCTGAAAAAGAGAACTACAATCCCGAACGTTAAATACGTTGAAGGATTGATGGGCCGCATC
TTGTCCCCTATCCTCTTCTCAGAGGGTAATGATTGGACGATGGTCGGCCGGGCGGCATACACGAATATGTACAAG
CATGATTTACCTGTCCTCACAGCCCAGAGGATCCCAACACAAGCGGACCGTTTACACTACGTGCTAACACGAGTA
GTGAAGATAGCAGAAACTTCATATAAAACGGCAAGGTTAATCACTTACGACATTTGGCATCAAAGATTCGGACAT
ATTTCGGAAACTGCGCTTAGCAAAGTACCGAAAGCTACCGAACCAAAAGTAGAAATACCTTCTAAAACGGGAACT
GTCTGTCCGGGCTGTGCCCTTGGCAAACAGACCCAGAAACCGTTCTATCCTAATCCCAAAAGAGCTAAGAAGCTC
GCAGAGTTAACACACTCCGACTTACTAGAATTGCCTATTACATCATACCACAAATTCAAGTGGGTAATAACATTT
CTAGACGACTATTCTTCAAACTGCTCGATTTTTCTTCTGAAACAAAAATCTGAAGCAACCCAAACCATTAAAGAC
TTTGTCACTGGTACAGAACTCATGAGCAACACAAAATGTTTGCGATTTCATACTGATAATGGAGGAGAATATATG
TCAGAAGAATTAGCTCGCTTCTTTAGGGAAAAGGGAATTATCCATGAAACCACGGCGCCATATGCTCACCAACAA
AATGGAAGAGCAGAACGGCTAAATCGCACTCTATTAGAAAAGGCACAAGCAATGCGTTTACACGCTTGCTTACCC
GATTCTTATTGGGAATTTGCGATAAGAACGGCTGTACATGTATACAACCGAACTCCGATGCGCCGGTTAAATTGG
AAAACTCCGACAGAACTACGAGAAGGTATTAAGCCCAAGATTGATCATCTTAGGGTATTTGGATGTGGGGCTTAC
GTCTTCATTCCTGAAGAAAAGCGACAGAACAAGCTTACGCCTCGTTCTGAGTACATGACATTTATTGGCTATATA
GAAAGTGGTTACATTTTTCTACGCCATAGACATAATCGTGCACTCTTCGTGTCACCCACAGCAATCTTTGATGAA
GGGATCTTCCCCTTATGTCCAAATGGAGGAATTGGCAGAATAACCATTCCAAGAGAACCTGAGACGTCAACAGAC
GATCTAACGTCCAATTCGGACAACAATGCTCCGGAACCTTCAGAACAAGGTTCTGTTCCATCATTTGATCTAGAC
CCTAGTCTATATGATCCAAATGAACCTGCCGTCCCTCCGAGACCGACAAACCCTACTCCGCCTAGATCCGAGTCA
CCTCGATCTAGATCTCCATCTAATGAAGAGGCTTCTGATGACGATGATCATCTTTCTTATGAGGATTTTGATCCG
AGCCAGAAGAAAGAAGTTCATTTTCGCCCCACGCCTCCGCCGAATACACCTTCTGACCTATCAGAAGACGAAGTT
CAACCGCCAACTAACGAAAAAGGCAAAATGCCTGAAAGGCGACGATTAGAACATGAGATAGTTCTTCCGGAAACA
TTTCCGCCAAGAAGATCTACTCGCACTCGGCAACCTCCACTCCGACCCGATAATATCTATGGTGAACGATCAAAT
CCCACAGATATTGAAAGGCAAAAGGTTAATGATTGGCCAAGACCATCAACGGTCAAAGAAAGCCAAAGACCAACC
ATACCTTTACCTAAACGAGTCAGAGGTCCTAGATGGAATAAAGGACAAGATGCAGAAGTACCACGTCCTGCTACC
GGCAACCCTTTGCCGAATACTCCGGAAACGGAGGAGCAGCAACTGCACCGCCTTGCAAGTGAGGGGGGAAAGGAT
TTCATTAACCTTCTATTGGCAAATGCAATTACTCCGGTCACTTACAAAGACTTGGATAATATTCCCCAGGACGAT
CAAAAAGCCTGGATAGAAGCATGCATAGATGAACTCCGTGCTCTAAAGAAGCGTGGAGTATATGAAATCGTCGAT
CTTCCAGAAGGAAGAAAAACCGTCAAAAATAGATGGGTTTTTAACATCAAGTCTGATGGCCGAAAACGTGCCCGA
CTTGTTGCTAAGGGTTTCTCTCAAATTGAAGGTATTGACTTCAATGAGCTTTTCTCTCCCGTAGTCCGCTACGAG
ACTGCCCGTCTCATATTCGGTGTTGCCGCACTCGAAGATTGGGAAATAGAAAGTGTTGACGTCAAAGCAGCATAT
CTATATGGAAAGCTAGAAGAGGAAATCTATATGGAACAGCCTGAAGGCTTCAGAAAAGACAATGACAAAAGAGTC
TGGAGATTACACCGAGCACTATATGGCCTGAAGCAATCTGGCTTAGCCTGGTGGCGCGAATTAACTGCGTCAATG
AAGGACCTAGGCTTTAAGCGATGCTCTTCAGATGCTGGTGTATATTATTACAGTGATCCGCAAACGAAGCAATTG
ATCATTGCGCTAGTTTACGTTGATGACGTAGCCATAATCGGGAAAAAGACTGCGCTATTTATAAACCTTAAGCGC
AAGATCATGAACAAGTGGGAATGTCGAGATCTTGGAGAAACAAAAGAGTTTCTCGGAATCAACATTCAACGTGAT
AGGAAAAACCGAAGAATCTTTCTCAATCAGGAAAATTACCTTGAGAAAATTCTTGAGAAGTTTGATGTTACGTCT
AAACCAACGAAGACTCCACTCAAATCAGGTTTCACCTTTGTTCCGTTTAACAGATCAGCATCACCCGCTTTCAGA
CAGAAGTACCAACAATTAGTTGGATCTTTAATGTACCTAATGATCGGTACGAGACCTGACATTGCTTATGCAACG
GTCAAATTAAGTCAACAGTGTGCGAACCCTGCTCAGGAACACTACGATCAAGGATTATATGTTCTGAGATACCTG
CTCGGATCTCGCCACTATAGACTTAAATTCCATGGCGCCTCCAACGAAGCACTAGTAGCCTATTCAGACTCTGAT
TGGGCTCAAGATCCAACAAACCGGAAATCTGTCACCGGTAACTATGTTACGATAGCCAAAGGCTGTGTAAGCTGG
CTTAGTCGTAAACAAAAGACAGTCGCCTCATCTTCTACGGAAGCTGAATATATGGCTCTATCCGACTGCTCCAAA
CAACTTGTTTGGATGAGCCAATTACTCAAGGAGATCGGCTTCGATCTTCCATCACCTTATCTAAATGCGGATAAT
GAAGGATCAATATTCTGGGCTTCTAATCCTGTTCAGGAACGTCGCTCTAAACATATCGATATTCGATATCATGTT
GTTCGAGAATAA
Transcript >AgabiH97|039240
ATGTCTCACGTTATGGCACTTCTTCCTTCGGTTGCAATGCTTACCGGTGCAGAAAACTATACTACCTGGAGGAAC
GCGATGTCCGATATTTTGACATTACTCCCCGCAGAAGGATTCCCTTTCAGTGGCCTTGACGTTTGTGAAAACAAA
TGGACAATCCAATTAAGAAACATCCCTGGCCGAGCAGCAGATGGCAATACAATCTCTCTCACCCAGGAGCAGATC
GATGAAAACGATGTCATTGATAACGCTAGGAAGGAAAGAGAACGTCTTTCCAGAACCGCTATAGCCATGATCAAT
GCTCGTACCACCAACGGTCTCATCCCCATTAGGTTCGAGAACGCTCACGATCTCTGGAAGATGCTCAAGGACACT
TATGGTATAGCCAGTCCATCGGCTATCTACTCCATGTTTCAACAAACCGGGAATTTCCGTATCTCGGGTGCTAAA
GAACCCTCAGCTGAGATCGCCCAATTGGAGCAGATCTATAGTCAGCTGACTAGTAATAATGTCGAGATTCCACCT
CTCATTCAAGCAATGACGTTGCTCGGATCAATTCCTGAGCAATGGAAAATTGCTTCTTCATTCCTTGCCGCTAAG
GGTGACGTCAAAGATGTCACCTTTCATGCAGTCCGCTCCGCTATTCTTCAAGAATACAATCAGCGTCAGACTGCT
AATAATTCTCAAGCGCATCGATTCTCTGGCGTCAAACAAGGCAATCAAAAGCCTGCTTGGCGACCATATAAAGGG
CAGCAGCAGCAGCAGCAGAGGCCATATAACAATGGCCCTCACCAAAACCAATCGCAGATGCGCCCGCAAGGGCAG
CAACAACAACAACAGCGAAGTGGTCCGCCCCCAAAGAAGAATCGTCGTGGGAAGAAAAACCACCAGCAGGTGAAT
GAAATTTCCAATAGAAATACAGCTCAATGTATTGATTATACTGCACAGGATGCGACCATGTTCGCCTCCGCCAGT
GTCGTTCGAGATGTCCCTGCTCAACATGTAGGAGAACGATCACTATTAACACGGATTTCTCATGATCCACGCCCT
AGACCCTACGAACGCCTCACCCCAGACCGGTTCGAAACTGCCAAACTCCGCGCCGTACTCCAGTATGACGAACGC
CTGAAGAACCGAGAAAATCTCGGCCTCATCCCGCTCACCGACGAACAACTCCGTCGGAAGCTCCTCCGCATCGAG
CTCACCAAGGAGCTCAAAAAGGATGAGCAGGAGCAGAGTCTTATGACAGCGTTCAGGAACGATGGAGAAACTTCT
ACTATCCCCAAGGGGGAAAGACGAGAAGCTTTCCTGAGGCAGCAAGAGGTCCAAGACGAGTACCGGCACATGAAC
GAAATATTCCGGGCACACTTCGCAGCAGAAGAGTCGAAGCAGACCTCCGAAATGGAAATGGACGACGCAGTCTCC
AAGACTATTTCAGAAGATGCCCCAACATCGTTCGATTCGGAGACCGTATCCCTGGGCGGATCTGATGCAGATCAG
ACCGAGATGATTTCGCCGTTTACGTGCGTACCTCGATCTAATCTTGATGACTTAACAGCTAATTTTATCCAGACC
GGAAATGTCCCCTACAATTCAAATGTAGATAGGGATATTTGTAGAACTCCGGCTGTAGATAATAATAATACTTTT
TGCTTCGCTTCTATATCTGAGGAAGAAGGTGATAGCCAATCACAAAAAAGCATAAGTTTAGAAAGTCATCATTGC
TCTGGCAAGCCGTGTGAAACATGCGGAATGATTCCTGTAAATAATAATTACCCAATCAGATGGCTCCTCGATTCG
GGAGCATCAGGTCACTTCACAAACGACCTTGATGACTTCATCGAGTACGATATCGGCGACTTCGGATCAATGGGA
ACTGCCGAAGCAGGAAAGATCCTTCATATCACTGCTTATGGTTCAGTCATGATCGAGCATGAGGTAACTGATGAA
GATACTGGTAATACTCTGAAAAAGAGAACTACAATCCCGAACGTTAAATACGTTGAAGGATTGATGGGCCGCATC
TTGTCCCCTATCCTCTTCTCAGAGGGTAATGATTGGACGATGGTCGGCCGGGCGGCATACACGAATATGTACAAG
CATGATTTACCTGTCCTCACAGCCCAGAGGATCCCAACACAAGCGGACCGTTTACACTACGTGCTAACACGAGTA
GTGAAGATAGCAGAAACTTCATATAAAACGGCAAGGTTAATCACTTACGACATTTGGCATCAAAGATTCGGACAT
ATTTCGGAAACTGCGCTTAGCAAAGTACCGAAAGCTACCGAACCAAAAGTAGAAATACCTTCTAAAACGGGAACT
GTCTGTCCGGGCTGTGCCCTTGGCAAACAGACCCAGAAACCGTTCTATCCTAATCCCAAAAGAGCTAAGAAGCTC
GCAGAGTTAACACACTCCGACTTACTAGAATTGCCTATTACATCATACCACAAATTCAAGTGGGTAATAACATTT
CTAGACGACTATTCTTCAAACTGCTCGATTTTTCTTCTGAAACAAAAATCTGAAGCAACCCAAACCATTAAAGAC
TTTGTCACTGGTACAGAACTCATGAGCAACACAAAATGTTTGCGATTTCATACTGATAATGGAGGAGAATATATG
TCAGAAGAATTAGCTCGCTTCTTTAGGGAAAAGGGAATTATCCATGAAACCACGGCGCCATATGCTCACCAACAA
AATGGAAGAGCAGAACGGCTAAATCGCACTCTATTAGAAAAGGCACAAGCAATGCGTTTACACGCTTGCTTACCC
GATTCTTATTGGGAATTTGCGATAAGAACGGCTGTACATGTATACAACCGAACTCCGATGCGCCGGTTAAATTGG
AAAACTCCGACAGAACTACGAGAAGGTATTAAGCCCAAGATTGATCATCTTAGGGTATTTGGATGTGGGGCTTAC
GTCTTCATTCCTGAAGAAAAGCGACAGAACAAGCTTACGCCTCGTTCTGAGTACATGACATTTATTGGCTATATA
GAAAGTGGTTACATTTTTCTACGCCATAGACATAATCGTGCACTCTTCGTGTCACCCACAGCAATCTTTGATGAA
GGGATCTTCCCCTTATGTCCAAATGGAGGAATTGGCAGAATAACCATTCCAAGAGAACCTGAGACGTCAACAGAC
GATCTAACGTCCAATTCGGACAACAATGCTCCGGAACCTTCAGAACAAGGTTCTGTTCCATCATTTGATCTAGAC
CCTAGTCTATATGATCCAAATGAACCTGCCGTCCCTCCGAGACCGACAAACCCTACTCCGCCTAGATCCGAGTCA
CCTCGATCTAGATCTCCATCTAATGAAGAGGCTTCTGATGACGATGATCATCTTTCTTATGAGGATTTTGATCCG
AGCCAGAAGAAAGAAGTTCATTTTCGCCCCACGCCTCCGCCGAATACACCTTCTGACCTATCAGAAGACGAAGTT
CAACCGCCAACTAACGAAAAAGGCAAAATGCCTGAAAGGCGACGATTAGAACATGAGATAGTTCTTCCGGAAACA
TTTCCGCCAAGAAGATCTACTCGCACTCGGCAACCTCCACTCCGACCCGATAATATCTATGGTGAACGATCAAAT
CCCACAGATATTGAAAGGCAAAAGGTTAATGATTGGCCAAGACCATCAACGGTCAAAGAAAGCCAAAGACCAACC
ATACCTTTACCTAAACGAGTCAGAGGTCCTAGATGGAATAAAGGACAAGATGCAGAAGTACCACGTCCTGCTACC
GGCAACCCTTTGCCGAATACTCCGGAAACGGAGGAGCAGCAACTGCACCGCCTTGCAAGTGAGGGGGGAAAGGAT
TTCATTAACCTTCTATTGGCAAATGCAATTACTCCGGTCACTTACAAAGACTTGGATAATATTCCCCAGGACGAT
CAAAAAGCCTGGATAGAAGCATGCATAGATGAACTCCGTGCTCTAAAGAAGCGTGGAGTATATGAAATCGTCGAT
CTTCCAGAAGGAAGAAAAACCGTCAAAAATAGATGGGTTTTTAACATCAAGTCTGATGGCCGAAAACGTGCCCGA
CTTGTTGCTAAGGGTTTCTCTCAAATTGAAGGTATTGACTTCAATGAGCTTTTCTCTCCCGTAGTCCGCTACGAG
ACTGCCCGTCTCATATTCGGTGTTGCCGCACTCGAAGATTGGGAAATAGAAAGTGTTGACGTCAAAGCAGCATAT
CTATATGGAAAGCTAGAAGAGGAAATCTATATGGAACAGCCTGAAGGCTTCAGAAAAGACAATGACAAAAGAGTC
TGGAGATTACACCGAGCACTATATGGCCTGAAGCAATCTGGCTTAGCCTGGTGGCGCGAATTAACTGCGTCAATG
AAGGACCTAGGCTTTAAGCGATGCTCTTCAGATGCTGGTGTATATTATTACAGTGATCCGCAAACGAAGCAATTG
ATCATTGCGCTAGTTTACGTTGATGACGTAGCCATAATCGGGAAAAAGACTGCGCTATTTATAAACCTTAAGCGC
AAGATCATGAACAAGTGGGAATGTCGAGATCTTGGAGAAACAAAAGAGTTTCTCGGAATCAACATTCAACGTGAT
AGGAAAAACCGAAGAATCTTTCTCAATCAGGAAAATTACCTTGAGAAAATTCTTGAGAAGTTTGATGTTACGTCT
AAACCAACGAAGACTCCACTCAAATCAGGTTTCACCTTTGTTCCGTTTAACAGATCAGCATCACCCGCTTTCAGA
CAGAAGTACCAACAATTAGTTGGATCTTTAATGTACCTAATGATCGGTACGAGACCTGACATTGCTTATGCAACG
GTCAAATTAAGTCAACAGTGTGCGAACCCTGCTCAGGAACACTACGATCAAGGATTATATGTTCTGAGATACCTG
CTCGGATCTCGCCACTATAGACTTAAATTCCATGGCGCCTCCAACGAAGCACTAGTAGCCTATTCAGACTCTGAT
TGGGCTCAAGATCCAACAAACCGGAAATCTGTCACCGGTAACTATGTTACGATAGCCAAAGGCTGTGTAAGCTGG
CTTAGTCGTAAACAAAAGACAGTCGCCTCATCTTCTACGGAAGCTGAATATATGGCTCTATCCGACTGCTCCAAA
CAACTTGTTTGGATGAGCCAATTACTCAAGGAGATCGGCTTCGATCTTCCATCACCTTATCTAAATGCGGATAAT
GAAGGATCAATATTCTGGGCTTCTAATCCTGTTCAGGAACGTCGCTCTAAACATATCGATATTCGATATCATGTT
GTTCGAGAATAA
Gene >AgabiH97|039240
ATGTCTCACGTTATGGCACTTCTTCCTTCGGTTGCAATGCTTACCGGTGCAGAAAACTATACTACCTGGAGGAAC
GCGATGTCCGATATTTTGACATTACTCCCCGCAGAAGGATTCCCTTTCAGTGGCCTTGACGTTTGTGAAAACAAA
TGGACAATCCAATTAAGAAACATCCCTGGCCGAGCAGCAGATGGCAATACAATCTCTCTCACCCAGGAGCAGATC
GATGAAAACGATGTCATTGATAACGCTAGGAAGGAAAGAGAACGTCTTTCCAGAACCGCTATAGCCATGATCAAT
GCTCGTACCACCAACGGTCTCATCCCCATTAGGTTCGAGAACGCTCACGATCTCTGGAAGATGCTCAAGGACACT
TATGGTATAGCCAGTCCATCGGCTATCTACTCCATGTTTCAACAAACCGGGAATTTCCGTATCTCGGGTGCTAAA
GAACCCTCAGCTGAGATCGCCCAATTGGAGCAGATCTATAGTCAGCTGACTAGTAATAATGTCGAGATTCCACCT
CTCATTCAAGCAATGACGTTGCTCGGATCAATTCCTGAGCAATGGAAAATTGCTTCTTCATTCCTTGCCGCTAAG
GGTGACGTCAAAGATGTCACCTTTCATGCAGTCCGCTCCGCTATTCTTCAAGAATACAATCAGCGTCAGACTGCT
AATAATTCTCAAGCGCATCGATTCTCTGGCGTCAAACAAGGCAATCAAAAGCCTGCTTGGCGACCATATAAAGGG
CAGCAGCAGCAGCAGCAGAGGCCATATAACAATGGCCCTCACCAAAACCAATCGCAGATGCGCCCGCAAGGGCAG
CAACAACAACAACAGCGAAGTGGTCCGCCCCCAAAGAAGAATCGTCGTGGGAAGAAAAACCACCAGCAGGTGAAT
GAAATTTCCAATAGAAATACAGCTCAATGTATTGATTATACTGCACAGGATGCGACCATGTTCGCCTCCGCCAGT
GTCGTTCGAGATGTCCCTGCTCAACATGTAGGAGAACGATCACTATTAACACGGATTTCTCATGATCCACGCCCT
AGACCCTACGAACGCCTCACCCCAGACCGGTTCGAAACTGCCAAACTCCGCGCCGTACTCCAGTATGACGAACGC
CTGAAGAACCGAGAAAATCTCGGCCTCATCCCGCTCACCGACGAACAACTCCGTCGGAAGCTCCTCCGCATCGAG
CTCACCAAGGAGCTCAAAAAGGATGAGCAGGAGCAGAGTCTTATGACAGCGTTCAGGAACGATGGAGAAACTTCT
ACTATCCCCAAGGGGGAAAGACGAGAAGCTTTCCTGAGGCAGCAAGAGGTCCAAGACGAGTACCGGCACATGAAC
GAAATATTCCGGGCACACTTCGCAGCAGAAGAGTCGAAGCAGACCTCCGAAATGGAAATGGACGACGCAGTCTCC
AAGACTATTTCAGAAGATGCCCCAACATCGTTCGATTCGGAGACCGTATCCCTGGGCGGATCTGATGCAGATCAG
ACCGAGATGATTTCGCCGTTTACGTGCGTACCTCGATCTAATCTTGATGACTTAACAGCTAATTTTATCCAGACC
GGAAATGTCCCCTACAATTCAAATGTAGATAGGGATATTTGTAGAACTCCGGCTGTAGATAATAATAATACTTTT
TGCTTCGCTTCTATATCTGAGGAAGAAGGTGATAGCCAATCACAAAAAAGCATAAGTTTAGAAAGTCATCATTGC
TCTGGCAAGCCGTGTGAAACATGCGGAATGATTCCTGTAAATAATAATTACCCAATCAGATGGCTCCTCGATTCG
GGAGCATCAGGTCACTTCACAAACGACCTTGATGACTTCATCGAGTACGATATCGGCGACTTCGGATCAATGGGA
ACTGCCGAAGCAGGAAAGATCCTTCATATCACTGCTTATGGTTCAGTCATGATCGAGCATGAGGTAACTGATGAA
GATACTGGTAATACTCTGAAAAAGAGAACTACAATCCCGAACGTTAAATACGTTGAAGGATTGATGGGCCGCATC
TTGTCCCCTATCCTCTTCTCAGAGGGTAATGATTGGACGATGGTCGGCCGGGCGGCATACACGAATATGTACAAG
CATGATTTACCTGTCCTCACAGCCCAGAGGATCCCAACACAAGCGGACCGTTTACACTACGTGCTAACACGAGTA
GTGAAGATAGCAGAAACTTCATATAAAACGGCAAGGTTAATCACTTACGACATTTGGCATCAAAGATTCGGACAT
ATTTCGGAAACTGCGCTTAGCAAAGTACCGAAAGCTACCGAACCAAAAGTAGAAATACCTTCTAAAACGGGAACT
GTCTGTCCGGGCTGTGCCCTTGGCAAACAGACCCAGAAACCGTTCTATCCTAATCCCAAAAGAGCTAAGAAGCTC
GCAGAGTTAACACACTCCGACTTACTAGAATTGCCTATTACATCATACCACAAATTCAAGTGGGTAATAACATTT
CTAGACGACTATTCTTCAAACTGCTCGATTTTTCTTCTGAAACAAAAATCTGAAGCAACCCAAACCATTAAAGAC
TTTGTCACTGGTACAGAACTCATGAGCAACACAAAATGTTTGCGATTTCATACTGATAATGGAGGAGAATATATG
TCAGAAGAATTAGCTCGCTTCTTTAGGGAAAAGGGAATTATCCATGAAACCACGGCGCCATATGCTCACCAACAA
AATGGAAGAGCAGAACGGCTAAATCGCACTCTATTAGAAAAGGCACAAGCAATGCGTTTACACGCTTGCTTACCC
GATTCTTATTGGGAATTTGCGATAAGAACGGCTGTACATGTATACAACCGAACTCCGATGCGCCGGTTAAATTGG
AAAACTCCGACAGAACTACGAGAAGGTATTAAGCCCAAGATTGATCATCTTAGGGTATTTGGATGTGGGGCTTAC
GTCTTCATTCCTGAAGAAAAGCGACAGAACAAGCTTACGCCTCGTTCTGAGTACATGACATTTATTGGCTATATA
GAAAGTGGTTACATTTTTCTACGCCATAGACATAATCGTGCACTCTTCGTGTCACCCACAGCAATCTTTGATGAA
GGGATCTTCCCCTTATGTCCAAATGGAGGAATTGGCAGAATAACCATTCCAAGAGAACCTGAGACGTCAACAGAC
GATCTAACGTCCAATTCGGACAACAATGCTCCGGAACCTTCAGAACAAGGTTCTGTTCCATCATTTGATCTAGAC
CCTAGTCTATATGATCCAAATGAACCTGCCGTCCCTCCGAGACCGACAAACCCTACTCCGCCTAGATCCGAGTCA
CCTCGATCTAGATCTCCATCTAATGAAGAGGCTTCTGATGACGATGATCATCTTTCTTATGAGGATTTTGATCCG
AGCCAGAAGAAAGAAGTTCATTTTCGCCCCACGCCTCCGCCGAATACACCTTCTGACCTATCAGAAGACGAAGTT
CAACCGCCAACTAACGAAAAAGGCAAAATGCCTGAAAGGCGACGATTAGAACATGAGATAGTTCTTCCGGAAACA
TTTCCGCCAAGAAGATCTACTCGCACTCGGCAACCTCCACTCCGACCCGATAATATCTATGGTGAACGATCAAAT
CCCACAGATATTGAAAGGCAAAAGGTTAATGATTGGCCAAGACCATCAACGGTCAAAGAAAGCCAAAGACCAACC
ATACCTTTACCTAAACGAGTCAGAGGTCCTAGATGGAATAAAGGACAAGATGCAGAAGTACCACGTCCTGCTACC
GGCAACCCTTTGCCGAATACTCCGGAAACGGAGGAGCAGCAACTGCACCGCCTTGCAAGTGAGGGGGGAAAGGAT
TTCATTAACCTTCTATTGGCAAATGCAATTACTCCGGTCACTTACAAAGACTTGGATAATATTCCCCAGGACGAT
CAAAAAGCCTGGATAGAAGCATGCATAGATGAACTCCGTGCTCTAAAGAAGCGTGGAGTATATGAAATCGTCGAT
CTTCCAGAAGGAAGAAAAACCGTCAAAAATAGATGGGTTTTTAACATCAAGTCTGATGGCCGAAAACGTGCCCGA
CTTGTTGCTAAGGGTTTCTCTCAAATTGAAGGTATTGACTTCAATGAGCTTTTCTCTCCCGTAGTCCGCTACGAG
ACTGCCCGTCTCATATTCGGTGTTGCCGCACTCGAAGATTGGGAAATAGAAAGTGTTGACGTCAAAGCAGCATAT
CTATATGGAAAGCTAGAAGAGGAAATCTATATGGAACAGCCTGAAGGCTTCAGAAAAGACAATGACAAAAGAGTC
TGGAGATTACACCGAGCACTATATGGCCTGAAGCAATCTGGCTTAGCCTGGTGGCGCGAATTAACTGCGTCAATG
AAGGACCTAGGCTTTAAGCGATGCTCTTCAGATGCTGGTGTATATTATTACAGTGATCCGCAAACGAAGCAATTG
ATCATTGCGCTAGTTTACGTTGATGACGTAGCCATAATCGGGAAAAAGACTGCGCTATTTATAAACCTTAAGCGC
AAGATCATGAACAAGTGGGAATGTCGAGATCTTGGAGAAACAAAAGAGTTTCTCGGAATCAACATTCAACGTGAT
AGGAAAAACCGAAGAATCTTTCTCAATCAGGAAAATTACCTTGAGAAAATTCTTGAGAAGTTTGATGTTACGTCT
AAACCAACGAAGACTCCACTCAAATCAGGTTTCACCTTTGTTCCGTTTAACAGATCAGCATCACCCGCTTTCAGA
CAGAAGTACCAACAATTAGTTGGATCTTTAATGTACCTAATGATCGGTACGAGACCTGACATTGCTTATGCAACG
GTCAAATTAAGTCAACAGTGTGCGAACCCTGCTCAGGAACACTACGATCAAGGATTATATGTTCTGAGATACCTG
CTCGGATCTCGCCACTATAGACTTAAATTCCATGGCGCCTCCAACGAAGCACTAGTAGCCTATTCAGACTCTGAT
TGGGCTCAAGATCCAACAAACCGGAAATCTGTCACCGGTAACTATGTTACGATAGCCAAAGGCTGTGTAAGCTGG
CTTAGTCGTAAACAAAAGACAGTCGCCTCATCTTCTACGGAAGCTGAATATATGGCTCTATCCGACTGCTCCAAA
CAACTTGTTTGGATGAGCCAATTACTCAAGGAGATCGGCTTCGATCTTCCATCACCTTATCTAAATGCGGATAAT
GAAGGATCAATATTCTGGGCTTCTAATCCTGTTCAGGAACGTCGCTCTAAACATATCGATATTCGATATCATGTT
GTTCGAGAATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail