Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|039170
Gene name
Locationscaffold_2:154105..158458
Strand-
Gene length (bp)4353
Transcript length (bp)4353
Coding sequence length (bp)4353
Protein length (aa) 1451

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07727 RVT_2 Reverse transcriptase (RNA-dependent DNA polymerase) 7.4E-46 958 1191
PF13976 gag_pre-integrs GAG-pre-integrase domain 1.6E-13 497 567
PF14223 Retrotran_gag_2 gag-polypeptide of LTR copia-type 5.8E-11 91 217

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P10978|POLX_TOBAC Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum PE=2 SV=1 139 1439 2.0E-176
sp|P04146|COPIA_DROME Copia protein OS=Drosophila melanogaster GN=GIP PE=1 SV=3 890 1441 5.0E-92
sp|P04146|COPIA_DROME Copia protein OS=Drosophila melanogaster GN=GIP PE=1 SV=3 386 810 2.0E-45
sp|P25600|YCH4_YEAST Putative transposon Ty5-1 protein YCL074W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY5A PE=5 SV=2 1038 1348 4.0E-36
sp|P92519|M810_ARATH Uncharacterized mitochondrial protein AtMg00810 OS=Arabidopsis thaliana GN=AtMg00810 PE=4 SV=1 1122 1351 3.0E-31
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P10978|POLX_TOBAC Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum PE=2 SV=1 139 1439 2.0E-176
sp|P04146|COPIA_DROME Copia protein OS=Drosophila melanogaster GN=GIP PE=1 SV=3 890 1441 5.0E-92
sp|P04146|COPIA_DROME Copia protein OS=Drosophila melanogaster GN=GIP PE=1 SV=3 386 810 2.0E-45
sp|P25600|YCH4_YEAST Putative transposon Ty5-1 protein YCL074W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY5A PE=5 SV=2 1038 1348 4.0E-36
sp|P92519|M810_ARATH Uncharacterized mitochondrial protein AtMg00810 OS=Arabidopsis thaliana GN=AtMg00810 PE=4 SV=1 1122 1351 3.0E-31
sp|Q12337|YG21B_YEAST Transposon Ty2-GR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-GR1 PE=5 SV=2 279 835 3.0E-26
sp|Q03494|YD22B_YEAST Transposon Ty2-DR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR2 PE=3 SV=2 279 769 3.0E-26
sp|Q12113|YO21B_YEAST Transposon Ty2-OR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-OR1 PE=3 SV=1 279 835 4.0E-26
sp|P0C2J5|YL22B_YEAST Transposon Ty2-LR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-LR2 PE=5 SV=1 279 835 5.0E-26
sp|Q12491|YB21B_YEAST Transposon Ty2-B Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-B PE=3 SV=1 279 769 5.0E-26
sp|Q12472|YD21B_YEAST Transposon Ty2-DR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR1 PE=1 SV=3 279 835 6.0E-26
sp|P0CX64|YG22B_YEAST Transposon Ty2-GR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-GR2 PE=3 SV=1 279 835 6.0E-26
sp|P0CX63|YF21B_YEAST Transposon Ty2-F Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-F PE=3 SV=1 279 835 6.0E-26
sp|P0C2J3|YL21B_YEAST Transposon Ty2-LR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-LR1 PE=3 SV=1 279 769 7.0E-26
sp|Q07791|YD23B_YEAST Transposon Ty2-DR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR3 PE=3 SV=1 279 769 7.0E-26
sp|Q12501|YO22B_YEAST Transposon Ty2-OR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-OR2 PE=1 SV=1 279 769 7.0E-26
sp|P25384|YC21B_YEAST Transposon Ty2-C Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-C PE=3 SV=2 279 835 7.0E-26
sp|Q12193|YB12B_YEAST Transposon Ty1-BR Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-BR PE=3 SV=1 425 829 2.0E-25
sp|Q99231|YD12B_YEAST Transposon Ty1-DR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR3 PE=1 SV=2 425 829 2.0E-25
sp|Q99337|YN12B_YEAST Transposon Ty1-NL2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-NL2 PE=3 SV=1 425 863 4.0E-25
sp|Q03434|YM12B_YEAST Transposon Ty1-ML2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ML2 PE=3 SV=2 425 829 5.0E-25
sp|Q04711|YM11B_YEAST Transposon Ty1-ML1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ML1 PE=3 SV=2 425 829 6.0E-25
sp|Q12273|YO11B_YEAST Transposon Ty1-OL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-OL PE=3 SV=1 425 829 6.0E-25
sp|Q03612|YE11B_YEAST Transposon Ty1-ER1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ER1 PE=3 SV=1 425 829 6.0E-25
sp|Q12316|YG13B_YEAST Transposon Ty1-GR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR3 PE=3 SV=3 425 829 6.0E-25
sp|Q04670|YM14B_YEAST Transposon Ty1-MR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-MR2 PE=3 SV=2 425 829 6.0E-25
sp|Q12088|YL11B_YEAST Transposon Ty1-LR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR1 PE=3 SV=1 425 829 7.0E-25
sp|Q03619|YE12B_YEAST Transposon Ty1-ER2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ER2 PE=3 SV=1 425 829 7.0E-25
sp|Q12490|YB11B_YEAST Transposon Ty1-BL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-BL PE=1 SV=1 425 829 7.0E-25
sp|O13535|YH11B_YEAST Transposon Ty1-H Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-H PE=3 SV=1 425 829 7.0E-25
sp|P47100|YJ12B_YEAST Transposon Ty1-JR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-JR2 PE=3 SV=3 425 829 7.0E-25
sp|Q92393|YO12B_YEAST Transposon Ty1-OR Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-OR PE=3 SV=1 425 829 8.0E-25
sp|Q07163|TY1AB_YEASX Transposon TyH3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae GN=TY1B PE=1 SV=2 425 829 8.0E-25
sp|P0C2I9|YP12B_YEAST Transposon Ty1-PR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR1 PE=3 SV=1 425 829 8.0E-25
sp|Q04214|YM13B_YEAST Transposon Ty1-MR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-MR1 PE=1 SV=2 425 829 8.0E-25
sp|Q07793|YD13B_YEAST Transposon Ty1-DR4 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR4 PE=3 SV=2 425 829 8.0E-25
sp|Q12112|YN11B_YEAST Transposon Ty1-NL1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-NL1 PE=3 SV=1 425 829 9.0E-25
sp|Q12269|YG12B_YEAST Transposon Ty1-GR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR2 PE=3 SV=3 425 829 9.0E-25
sp|P0C2I2|YD14B_YEAST Transposon Ty1-DR5 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR5 PE=3 SV=1 425 829 9.0E-25
sp|Q12414|YP11B_YEAST Transposon Ty1-PL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PL PE=3 SV=1 425 829 9.0E-25
sp|Q03855|YD11B_YEAST Transposon Ty1-DR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR1 PE=3 SV=2 425 829 9.0E-25
sp|P0C2I7|YL14B_YEAST Transposon Ty1-LR4 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR4 PE=5 SV=1 425 829 9.0E-25
sp|P0C2J1|YP14B_YEAST Transposon Ty1-PR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR3 PE=1 SV=1 425 829 1.0E-24
sp|P0C2I6|YL13B_YEAST Transposon Ty1-LR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR3 PE=3 SV=1 425 829 1.0E-24
sp|P47098|YJ11B_YEAST Transposon Ty1-JR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-JR1 PE=3 SV=3 425 829 2.0E-24
sp|Q12141|YG11B_YEAST Transposon Ty1-GR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR1 PE=3 SV=1 425 829 2.0E-24
sp|P0C2I5|YL12B_YEAST Transposon Ty1-LR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR2 PE=3 SV=1 425 829 2.0E-24
sp|P0C2I3|YD15B_YEAST Transposon Ty1-DR6 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR6 PE=3 SV=1 425 829 3.0E-24
sp|P0C2J0|YP13B_YEAST Transposon Ty1-PR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR2 PE=3 SV=1 425 829 6.0E-24
sp|A0A0B7P3V8|YP41B_YEAST Transposon Ty4-P Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY4B-P PE=5 SV=2 384 726 1.0E-21
sp|Q12491|YB21B_YEAST Transposon Ty2-B Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-B PE=3 SV=1 932 1427 3.0E-21
sp|P0C2J7|YH41B_YEAST Transposon Ty4-H Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY4B-H PE=3 SV=1 384 726 4.0E-21
sp|P47024|YJ41B_YEAST Transposon Ty4-J Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY4B-J PE=3 SV=3 384 726 4.0E-21
sp|Q12472|YD21B_YEAST Transposon Ty2-DR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR1 PE=1 SV=3 932 1427 1.0E-20
sp|Q99337|YN12B_YEAST Transposon Ty1-NL2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-NL2 PE=3 SV=1 932 1427 8.0E-20
sp|Q04214|YM13B_YEAST Transposon Ty1-MR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-MR1 PE=1 SV=2 932 1427 1.0E-19
sp|Q12337|YG21B_YEAST Transposon Ty2-GR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-GR1 PE=5 SV=2 932 1427 2.0E-19
sp|P0CX64|YG22B_YEAST Transposon Ty2-GR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-GR2 PE=3 SV=1 932 1427 2.0E-19
sp|P0CX63|YF21B_YEAST Transposon Ty2-F Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-F PE=3 SV=1 932 1427 2.0E-19
sp|Q12501|YO22B_YEAST Transposon Ty2-OR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-OR2 PE=1 SV=1 932 1427 3.0E-19
sp|P25384|YC21B_YEAST Transposon Ty2-C Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-C PE=3 SV=2 932 1427 3.0E-19
sp|Q12490|YB11B_YEAST Transposon Ty1-BL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-BL PE=1 SV=1 932 1427 3.0E-19
sp|Q03494|YD22B_YEAST Transposon Ty2-DR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR2 PE=3 SV=2 932 1427 4.0E-19
sp|Q12113|YO21B_YEAST Transposon Ty2-OR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-OR1 PE=3 SV=1 932 1427 4.0E-19
sp|P0C2J3|YL21B_YEAST Transposon Ty2-LR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-LR1 PE=3 SV=1 932 1427 5.0E-19
sp|Q07791|YD23B_YEAST Transposon Ty2-DR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR3 PE=3 SV=1 932 1427 5.0E-19
sp|Q03855|YD11B_YEAST Transposon Ty1-DR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR1 PE=3 SV=2 932 1427 9.0E-19
sp|Q12141|YG11B_YEAST Transposon Ty1-GR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR1 PE=3 SV=1 932 1427 9.0E-19
sp|Q99231|YD12B_YEAST Transposon Ty1-DR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR3 PE=1 SV=2 932 1427 1.0E-18
sp|Q12269|YG12B_YEAST Transposon Ty1-GR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR2 PE=3 SV=3 932 1427 2.0E-18
sp|Q04711|YM11B_YEAST Transposon Ty1-ML1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ML1 PE=3 SV=2 932 1427 3.0E-18
sp|P0C2I2|YD14B_YEAST Transposon Ty1-DR5 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR5 PE=3 SV=1 932 1427 3.0E-18
sp|P0C2I7|YL14B_YEAST Transposon Ty1-LR4 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR4 PE=5 SV=1 932 1427 3.0E-18
sp|P0C2I3|YD15B_YEAST Transposon Ty1-DR6 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR6 PE=3 SV=1 932 1427 3.0E-18
sp|P0C2J0|YP13B_YEAST Transposon Ty1-PR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR2 PE=3 SV=1 932 1427 3.0E-18
sp|P47100|YJ12B_YEAST Transposon Ty1-JR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-JR2 PE=3 SV=3 932 1427 4.0E-18
sp|Q12112|YN11B_YEAST Transposon Ty1-NL1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-NL1 PE=3 SV=1 932 1427 4.0E-18
sp|Q04670|YM14B_YEAST Transposon Ty1-MR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-MR2 PE=3 SV=2 932 1427 1.0E-17
sp|Q03619|YE12B_YEAST Transposon Ty1-ER2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ER2 PE=3 SV=1 932 1427 1.0E-17
sp|Q03434|YM12B_YEAST Transposon Ty1-ML2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ML2 PE=3 SV=2 932 1427 2.0E-17
sp|Q12273|YO11B_YEAST Transposon Ty1-OL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-OL PE=3 SV=1 932 1427 2.0E-17
sp|Q03612|YE11B_YEAST Transposon Ty1-ER1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ER1 PE=3 SV=1 932 1427 2.0E-17
sp|Q12088|YL11B_YEAST Transposon Ty1-LR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR1 PE=3 SV=1 932 1427 2.0E-17
sp|Q12414|YP11B_YEAST Transposon Ty1-PL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PL PE=3 SV=1 932 1427 2.0E-17
sp|P0C2I5|YL12B_YEAST Transposon Ty1-LR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR2 PE=3 SV=1 932 1427 2.0E-17
sp|O13527|YA11B_YEAST Truncated transposon Ty1-A Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-A PE=3 SV=3 932 1427 2.0E-17
sp|O13527|YA11B_YEAST Truncated transposon Ty1-A Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-A PE=3 SV=3 559 829 2.0E-17
sp|Q12193|YB12B_YEAST Transposon Ty1-BR Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-BR PE=3 SV=1 932 1427 3.0E-17
sp|Q12316|YG13B_YEAST Transposon Ty1-GR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR3 PE=3 SV=3 932 1427 3.0E-17
sp|Q07163|TY1AB_YEASX Transposon TyH3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae GN=TY1B PE=1 SV=2 932 1427 3.0E-17
sp|P0C2I9|YP12B_YEAST Transposon Ty1-PR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR1 PE=3 SV=1 932 1427 3.0E-17
sp|P0C2I6|YL13B_YEAST Transposon Ty1-LR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR3 PE=3 SV=1 932 1427 3.0E-17
sp|Q92393|YO12B_YEAST Transposon Ty1-OR Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-OR PE=3 SV=1 932 1427 4.0E-17
sp|O13535|YH11B_YEAST Transposon Ty1-H Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-H PE=3 SV=1 932 1427 5.0E-17
sp|P0C2J1|YP14B_YEAST Transposon Ty1-PR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR3 PE=1 SV=1 932 1427 8.0E-17
sp|P47098|YJ11B_YEAST Transposon Ty1-JR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-JR1 PE=3 SV=3 932 1427 1.0E-16
sp|P0C2J7|YH41B_YEAST Transposon Ty4-H Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY4B-H PE=3 SV=1 920 1428 7.0E-15
sp|P47024|YJ41B_YEAST Transposon Ty4-J Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY4B-J PE=3 SV=3 920 1428 1.0E-14
sp|P92520|M820_ARATH Uncharacterized mitochondrial protein AtMg00820 OS=Arabidopsis thaliana GN=AtMg00820 PE=4 SV=1 930 1028 6.0E-13
sp|P92512|M710_ARATH Uncharacterized mitochondrial protein AtMg00710 OS=Arabidopsis thaliana GN=AtMg00710 PE=4 SV=1 694 801 1.0E-09
sp|Q07793|YD13B_YEAST Transposon Ty1-DR4 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR4 PE=3 SV=2 932 1284 1.0E-08
sp|Q87040|POL_SFVCP Pro-Pol polyprotein OS=Simian foamy virus (isolate chimpanzee) GN=pol PE=3 SV=1 539 714 2.0E-08
sp|P93290|M240_ARATH Uncharacterized mitochondrial protein AtMg00240 OS=Arabidopsis thaliana GN=AtMg00240 PE=4 SV=1 1233 1310 8.0E-08
sp|P14350|POL_FOAMV Pro-Pol polyprotein OS=Human spumaretrovirus GN=pol PE=1 SV=2 539 714 5.0E-07
sp|P0C2J5|YL22B_YEAST Transposon Ty2-LR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-LR2 PE=5 SV=1 932 1211 1.0E-06
sp|P23074|POL_SFV1 Pro-Pol polyprotein OS=Simian foamy virus type 1 GN=pol PE=1 SV=3 539 714 2.0E-06
sp|O93209|POL_FFV Pro-Pol polyprotein OS=Feline foamy virus GN=pol PE=3 SV=1 581 714 4.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 43 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|039170
MSSNTGGSAPPIFADTAKFNGTNWVSWSGMIRIAAELRGVSGYLDGTAINPAQSIPIITTTPPSPTTVTTTTTST
PLETPWESTTPNTAEWKVRNAWAMGLLIYNTTDPIGLGISISGSAAEAWKSYRDNYEVASEIATLNAEMDLRNMV
YADGQDFTEFVSRLRTKWANANALGASIDDKGFRTIILNSLPRSWDSIVATLYTTKTSREAISQLLTHWARISRD
RVTTSQTTSALQTTTTQSNSRNRQRNQNSQLVCTNTNCNRRGHTIEFCYWPGGGKAGQFPPGFGRRGGAGGSANN
TTTGGYQASANNTTASTTEKAESNEPKVPSTLPIHSNNPNGSLISTPSVSERQRTEICVTGKDQRVSASTASNTT
IPTLPYDVITLLDSGASDHCFVNKLSFSTYVPMTPPRQGNSAGKGSTFFIEGAGEVGFFTPLNGISTKILLNDAL
HTPQLRSNLISVSKLVSRGSSVSFEGNTAIVRNHSGAVALVAVKENGLYVVPSVNVHANAVQSKRRAVPLEIWHR
RLGHISVEVIKRMLREDLVDGLSIVGSMEMEGLCEDCIFGKHTSHPYNNPTLLEKRPLERVYIDIWGPSPVQSAG
GAKYFMLIVDGATSYRKLYFLTSKSADATLMAFKEFHKEAERQTGETLKEVRLDMGREWYNELWSTYVKGHGIVL
NFTTPYAHQQNGKAERSMRTLLDMARTLLADSGLPQKYWADATQTAAYVRNLTPTTGDPANIPAQRWTGQRQDVS
HLRPFGSTAYAHIPVEIHPSKLSPRSAKLTLIGYYGHTGYKLLDRTTGVAYKSRDVIFEEARPHFSTDAITTFPS
DDSRTSTIRQEIAPRPKPINTLHDTANGVTTTPPTVLTPVQGDSSATFEGKATDAVTGVVEEPPVVLRRSQRIPK
PSQRMKESLDYLSRPEAHTMESISGDLHVPKTYHEAMKKPDLWFEPMLKELNIMTEKQVFRLVPRPVGRNVVKSR
WVFANKYDEAGLVVSRKARLVAKGFTQVIGEDYNETYASVARLESVRMVCAIAAARGLRLWQVDFVSAFLNSENS
FEVFMEQPPGFEEGGDHVWLLLKTLYGTMQGAHDWAQTLDRTYAGHGYYISKADPQVRSKVEENEFTLTSTWTDD
VLGASSTADGEAKAKDELGRSYEIKDLGEAKFILGMRIERGINGDVRLSQRTYCERIIERFKFSDSLKPRSTPLP
VGTTLSIEGSPVSDEEKADMKNVPYREVLGSLMWLQVATRPDLSFAVNILSRFANNPGRSHWEAMKHTLAYVKAT
MDYGITYYRDASIKPYGYVDADFAGDIDSRRSTEGHVFFVAGGPVSWASRRQDTVALSTVEAEYMAFSRAVQQAI
WLASFLKEVGLPQDTPTLIYADNDGSIANTQNYKNHRRTKHIDIRYHFIKERTAMGDVVFEYIPSAENLADIFTK
PLARDAVLRLCGDMGLRSVEPGGVL*
Coding >AgabiH97|039170
ATGTCTAGCAACACGGGTGGTAGCGCCCCTCCTATCTTCGCTGACACGGCAAAGTTCAATGGCACCAACTGGGTG
TCATGGAGTGGAATGATTCGCATCGCTGCGGAATTGCGAGGTGTATCCGGGTACCTCGACGGTACAGCTATCAAC
CCTGCCCAAAGCATTCCTATTATCACAACGACGCCTCCGTCGCCTACTACAGTTACAACCACAACTACTTCCACA
CCTCTGGAAACCCCATGGGAATCCACTACCCCAAATACCGCCGAATGGAAAGTCCGTAACGCCTGGGCTATGGGT
CTTCTTATCTATAACACTACCGATCCCATTGGCCTTGGAATCTCCATTAGTGGGAGCGCAGCCGAAGCTTGGAAA
TCGTACCGCGACAACTATGAAGTAGCCTCCGAGATTGCTACTCTCAATGCGGAAATGGACTTGAGAAACATGGTA
TACGCAGACGGACAAGACTTCACCGAGTTCGTGTCTCGACTCAGGACCAAATGGGCGAACGCCAACGCTCTTGGA
GCCAGCATTGACGACAAAGGTTTCCGGACAATTATCTTAAACTCTCTACCCCGCTCTTGGGACTCCATCGTCGCC
ACACTATACACTACCAAAACGTCACGCGAGGCTATAAGCCAACTTCTAACCCACTGGGCTAGAATAAGCCGAGAC
CGGGTCACTACGTCGCAGACCACTTCAGCTCTCCAAACGACCACTACACAATCGAACAGCCGCAACCGCCAGCGA
AATCAAAATAGCCAATTAGTTTGCACCAATACCAACTGTAACCGCAGGGGACATACCATCGAGTTTTGTTACTGG
CCAGGTGGTGGCAAAGCCGGACAATTTCCGCCAGGTTTCGGACGACGTGGGGGAGCTGGAGGTAGTGCCAACAAC
ACTACTACAGGAGGATATCAAGCTTCTGCAAATAACACCACCGCCAGTACCACGGAGAAGGCAGAGAGCAACGAA
CCTAAGGTACCATCCACCCTCCCAATACATTCCAACAATCCTAATGGCTCTTTGATTTCAACCCCTAGTGTCTCT
GAGAGACAGCGTACTGAGATCTGCGTAACGGGGAAGGATCAGAGAGTTAGTGCTAGTACCGCCTCGAATACGACT
ATTCCCACTTTACCATATGACGTGATTACCCTGCTCGACTCTGGAGCAAGCGATCATTGTTTCGTCAATAAATTA
TCCTTCTCTACGTATGTCCCGATGACACCACCTCGACAAGGAAATTCTGCGGGAAAGGGATCCACATTCTTCATA
GAAGGAGCTGGCGAAGTAGGCTTCTTCACGCCTCTGAATGGAATCTCGACAAAGATTTTATTGAATGACGCACTT
CACACCCCACAACTGAGGTCGAACTTAATCTCTGTTTCAAAGCTCGTATCACGGGGTTCGTCTGTGAGTTTTGAG
GGGAACACAGCAATTGTTCGCAATCATAGTGGTGCTGTAGCGCTAGTAGCCGTGAAGGAGAATGGGTTATACGTC
GTTCCTTCGGTGAACGTCCATGCGAACGCCGTGCAGTCGAAGAGGAGAGCTGTACCATTGGAGATCTGGCACCGC
CGCCTGGGACACATTAGCGTGGAAGTTATAAAGAGGATGTTGCGTGAAGATCTTGTCGATGGTTTGAGTATTGTG
GGATCTATGGAGATGGAAGGACTCTGTGAAGACTGTATTTTCGGCAAACACACCTCACACCCGTATAACAATCCT
ACACTCCTGGAGAAACGTCCACTTGAACGCGTATACATTGACATTTGGGGGCCTTCTCCAGTGCAATCTGCTGGG
GGGGCAAAGTATTTCATGTTAATTGTTGACGGCGCCACATCCTACAGAAAGTTGTATTTCCTTACCTCGAAGTCA
GCGGACGCCACTTTAATGGCCTTCAAGGAGTTTCATAAAGAGGCGGAAAGGCAGACTGGTGAAACGCTAAAGGAG
GTCCGGCTAGACATGGGACGTGAGTGGTACAACGAGCTTTGGAGTACGTACGTAAAAGGGCATGGGATCGTTCTG
AACTTTACCACACCTTACGCCCACCAGCAAAATGGCAAGGCAGAACGCTCTATGCGTACTCTGCTGGATATGGCG
CGTACCCTACTGGCAGACTCCGGTTTGCCACAGAAGTATTGGGCGGATGCCACCCAAACTGCTGCCTATGTACGA
AATCTCACTCCAACGACTGGTGACCCCGCCAATATCCCTGCTCAACGTTGGACTGGACAACGACAGGACGTATCA
CATCTACGCCCTTTTGGGTCCACCGCATATGCACACATACCCGTCGAAATACATCCTTCAAAATTGTCTCCTCGC
TCAGCGAAGCTCACATTGATTGGATACTACGGTCATACCGGCTACAAGCTGCTGGATCGTACCACCGGTGTCGCC
TACAAATCAAGAGACGTGATCTTCGAGGAAGCTCGACCTCATTTCTCTACCGACGCCATCACGACATTCCCTTCA
GACGACTCTCGTACCTCAACTATACGGCAAGAGATTGCGCCACGTCCTAAACCAATCAATACACTTCATGATACA
GCCAATGGCGTTACGACAACCCCGCCGACCGTGCTGACGCCAGTGCAGGGGGATTCATCCGCTACTTTTGAGGGT
AAAGCTACGGATGCCGTTACTGGAGTTGTCGAAGAGCCGCCGGTGGTACTGAGGAGAAGTCAAAGGATACCTAAA
CCGTCCCAACGAATGAAAGAGAGTCTGGATTACCTGAGTCGTCCAGAGGCACATACGATGGAATCAATTTCGGGG
GATCTTCATGTGCCAAAGACTTATCATGAAGCGATGAAGAAGCCTGACCTGTGGTTTGAGCCGATGTTGAAGGAG
TTGAATATCATGACGGAGAAACAGGTTTTTAGACTTGTTCCGCGCCCGGTTGGGAGGAACGTTGTCAAATCACGA
TGGGTGTTCGCAAACAAATATGATGAAGCCGGTTTGGTGGTTAGCCGCAAAGCACGCCTTGTCGCAAAGGGATTT
ACACAAGTCATCGGCGAAGACTACAACGAGACCTATGCCTCGGTGGCGCGCTTGGAGTCTGTACGGATGGTGTGT
GCTATTGCTGCCGCACGTGGTCTTCGACTGTGGCAGGTCGACTTCGTCTCTGCTTTTCTTAATAGCGAGAACTCC
TTCGAGGTATTTATGGAGCAGCCTCCTGGTTTCGAGGAGGGGGGAGACCATGTATGGTTACTCCTCAAAACTTTG
TATGGGACGATGCAGGGCGCCCACGACTGGGCACAGACTCTCGATCGAACTTACGCGGGTCATGGATATTATATA
TCGAAAGCCGACCCCCAGGTGCGATCGAAAGTAGAAGAGAATGAATTCACCCTCACATCAACTTGGACGGATGAT
GTCCTCGGCGCCTCATCAACAGCAGATGGTGAAGCGAAGGCTAAGGACGAGTTGGGAAGGAGTTATGAGATCAAG
GATCTGGGGGAGGCGAAATTCATTCTTGGGATGAGGATTGAGAGAGGAATCAATGGAGATGTGAGGTTATCCCAA
CGGACTTACTGTGAGCGCATTATTGAACGATTCAAATTTTCGGATTCCTTGAAACCTCGCTCCACTCCGCTACCT
GTTGGGACTACTTTGTCCATCGAAGGTTCGCCAGTCTCTGATGAAGAAAAGGCCGACATGAAGAATGTGCCTTAT
CGTGAAGTCCTCGGTTCTCTCATGTGGCTTCAAGTTGCAACTCGCCCCGATCTATCCTTTGCGGTGAACATTCTT
TCTCGTTTCGCAAACAATCCTGGACGTAGCCACTGGGAAGCTATGAAACACACACTGGCCTACGTCAAAGCTACT
ATGGACTACGGCATTACATACTACCGTGATGCAAGCATAAAACCTTATGGATACGTGGACGCAGATTTCGCTGGT
GATATCGACTCTCGACGTTCCACAGAGGGACATGTCTTTTTCGTAGCAGGCGGACCTGTATCTTGGGCTAGTAGG
CGGCAGGATACTGTGGCACTTTCCACAGTGGAGGCTGAGTACATGGCTTTCAGCCGTGCCGTTCAACAAGCAATC
TGGCTTGCAAGTTTTCTGAAGGAGGTGGGATTACCACAGGATACGCCCACTTTGATATACGCCGATAACGATGGT
TCTATTGCGAATACACAAAACTACAAGAACCACCGGAGGACGAAGCATATTGATATCAGGTACCATTTTATCAAG
GAGAGGACTGCGATGGGAGACGTTGTTTTCGAGTATATTCCCTCTGCCGAGAATCTAGCCGACATCTTTACCAAA
CCTCTCGCTCGTGACGCGGTGTTGAGGCTTTGCGGTGACATGGGTTTACGGAGTGTCGAACCAGGGGGAGTGTTG
TGA
Transcript >AgabiH97|039170
ATGTCTAGCAACACGGGTGGTAGCGCCCCTCCTATCTTCGCTGACACGGCAAAGTTCAATGGCACCAACTGGGTG
TCATGGAGTGGAATGATTCGCATCGCTGCGGAATTGCGAGGTGTATCCGGGTACCTCGACGGTACAGCTATCAAC
CCTGCCCAAAGCATTCCTATTATCACAACGACGCCTCCGTCGCCTACTACAGTTACAACCACAACTACTTCCACA
CCTCTGGAAACCCCATGGGAATCCACTACCCCAAATACCGCCGAATGGAAAGTCCGTAACGCCTGGGCTATGGGT
CTTCTTATCTATAACACTACCGATCCCATTGGCCTTGGAATCTCCATTAGTGGGAGCGCAGCCGAAGCTTGGAAA
TCGTACCGCGACAACTATGAAGTAGCCTCCGAGATTGCTACTCTCAATGCGGAAATGGACTTGAGAAACATGGTA
TACGCAGACGGACAAGACTTCACCGAGTTCGTGTCTCGACTCAGGACCAAATGGGCGAACGCCAACGCTCTTGGA
GCCAGCATTGACGACAAAGGTTTCCGGACAATTATCTTAAACTCTCTACCCCGCTCTTGGGACTCCATCGTCGCC
ACACTATACACTACCAAAACGTCACGCGAGGCTATAAGCCAACTTCTAACCCACTGGGCTAGAATAAGCCGAGAC
CGGGTCACTACGTCGCAGACCACTTCAGCTCTCCAAACGACCACTACACAATCGAACAGCCGCAACCGCCAGCGA
AATCAAAATAGCCAATTAGTTTGCACCAATACCAACTGTAACCGCAGGGGACATACCATCGAGTTTTGTTACTGG
CCAGGTGGTGGCAAAGCCGGACAATTTCCGCCAGGTTTCGGACGACGTGGGGGAGCTGGAGGTAGTGCCAACAAC
ACTACTACAGGAGGATATCAAGCTTCTGCAAATAACACCACCGCCAGTACCACGGAGAAGGCAGAGAGCAACGAA
CCTAAGGTACCATCCACCCTCCCAATACATTCCAACAATCCTAATGGCTCTTTGATTTCAACCCCTAGTGTCTCT
GAGAGACAGCGTACTGAGATCTGCGTAACGGGGAAGGATCAGAGAGTTAGTGCTAGTACCGCCTCGAATACGACT
ATTCCCACTTTACCATATGACGTGATTACCCTGCTCGACTCTGGAGCAAGCGATCATTGTTTCGTCAATAAATTA
TCCTTCTCTACGTATGTCCCGATGACACCACCTCGACAAGGAAATTCTGCGGGAAAGGGATCCACATTCTTCATA
GAAGGAGCTGGCGAAGTAGGCTTCTTCACGCCTCTGAATGGAATCTCGACAAAGATTTTATTGAATGACGCACTT
CACACCCCACAACTGAGGTCGAACTTAATCTCTGTTTCAAAGCTCGTATCACGGGGTTCGTCTGTGAGTTTTGAG
GGGAACACAGCAATTGTTCGCAATCATAGTGGTGCTGTAGCGCTAGTAGCCGTGAAGGAGAATGGGTTATACGTC
GTTCCTTCGGTGAACGTCCATGCGAACGCCGTGCAGTCGAAGAGGAGAGCTGTACCATTGGAGATCTGGCACCGC
CGCCTGGGACACATTAGCGTGGAAGTTATAAAGAGGATGTTGCGTGAAGATCTTGTCGATGGTTTGAGTATTGTG
GGATCTATGGAGATGGAAGGACTCTGTGAAGACTGTATTTTCGGCAAACACACCTCACACCCGTATAACAATCCT
ACACTCCTGGAGAAACGTCCACTTGAACGCGTATACATTGACATTTGGGGGCCTTCTCCAGTGCAATCTGCTGGG
GGGGCAAAGTATTTCATGTTAATTGTTGACGGCGCCACATCCTACAGAAAGTTGTATTTCCTTACCTCGAAGTCA
GCGGACGCCACTTTAATGGCCTTCAAGGAGTTTCATAAAGAGGCGGAAAGGCAGACTGGTGAAACGCTAAAGGAG
GTCCGGCTAGACATGGGACGTGAGTGGTACAACGAGCTTTGGAGTACGTACGTAAAAGGGCATGGGATCGTTCTG
AACTTTACCACACCTTACGCCCACCAGCAAAATGGCAAGGCAGAACGCTCTATGCGTACTCTGCTGGATATGGCG
CGTACCCTACTGGCAGACTCCGGTTTGCCACAGAAGTATTGGGCGGATGCCACCCAAACTGCTGCCTATGTACGA
AATCTCACTCCAACGACTGGTGACCCCGCCAATATCCCTGCTCAACGTTGGACTGGACAACGACAGGACGTATCA
CATCTACGCCCTTTTGGGTCCACCGCATATGCACACATACCCGTCGAAATACATCCTTCAAAATTGTCTCCTCGC
TCAGCGAAGCTCACATTGATTGGATACTACGGTCATACCGGCTACAAGCTGCTGGATCGTACCACCGGTGTCGCC
TACAAATCAAGAGACGTGATCTTCGAGGAAGCTCGACCTCATTTCTCTACCGACGCCATCACGACATTCCCTTCA
GACGACTCTCGTACCTCAACTATACGGCAAGAGATTGCGCCACGTCCTAAACCAATCAATACACTTCATGATACA
GCCAATGGCGTTACGACAACCCCGCCGACCGTGCTGACGCCAGTGCAGGGGGATTCATCCGCTACTTTTGAGGGT
AAAGCTACGGATGCCGTTACTGGAGTTGTCGAAGAGCCGCCGGTGGTACTGAGGAGAAGTCAAAGGATACCTAAA
CCGTCCCAACGAATGAAAGAGAGTCTGGATTACCTGAGTCGTCCAGAGGCACATACGATGGAATCAATTTCGGGG
GATCTTCATGTGCCAAAGACTTATCATGAAGCGATGAAGAAGCCTGACCTGTGGTTTGAGCCGATGTTGAAGGAG
TTGAATATCATGACGGAGAAACAGGTTTTTAGACTTGTTCCGCGCCCGGTTGGGAGGAACGTTGTCAAATCACGA
TGGGTGTTCGCAAACAAATATGATGAAGCCGGTTTGGTGGTTAGCCGCAAAGCACGCCTTGTCGCAAAGGGATTT
ACACAAGTCATCGGCGAAGACTACAACGAGACCTATGCCTCGGTGGCGCGCTTGGAGTCTGTACGGATGGTGTGT
GCTATTGCTGCCGCACGTGGTCTTCGACTGTGGCAGGTCGACTTCGTCTCTGCTTTTCTTAATAGCGAGAACTCC
TTCGAGGTATTTATGGAGCAGCCTCCTGGTTTCGAGGAGGGGGGAGACCATGTATGGTTACTCCTCAAAACTTTG
TATGGGACGATGCAGGGCGCCCACGACTGGGCACAGACTCTCGATCGAACTTACGCGGGTCATGGATATTATATA
TCGAAAGCCGACCCCCAGGTGCGATCGAAAGTAGAAGAGAATGAATTCACCCTCACATCAACTTGGACGGATGAT
GTCCTCGGCGCCTCATCAACAGCAGATGGTGAAGCGAAGGCTAAGGACGAGTTGGGAAGGAGTTATGAGATCAAG
GATCTGGGGGAGGCGAAATTCATTCTTGGGATGAGGATTGAGAGAGGAATCAATGGAGATGTGAGGTTATCCCAA
CGGACTTACTGTGAGCGCATTATTGAACGATTCAAATTTTCGGATTCCTTGAAACCTCGCTCCACTCCGCTACCT
GTTGGGACTACTTTGTCCATCGAAGGTTCGCCAGTCTCTGATGAAGAAAAGGCCGACATGAAGAATGTGCCTTAT
CGTGAAGTCCTCGGTTCTCTCATGTGGCTTCAAGTTGCAACTCGCCCCGATCTATCCTTTGCGGTGAACATTCTT
TCTCGTTTCGCAAACAATCCTGGACGTAGCCACTGGGAAGCTATGAAACACACACTGGCCTACGTCAAAGCTACT
ATGGACTACGGCATTACATACTACCGTGATGCAAGCATAAAACCTTATGGATACGTGGACGCAGATTTCGCTGGT
GATATCGACTCTCGACGTTCCACAGAGGGACATGTCTTTTTCGTAGCAGGCGGACCTGTATCTTGGGCTAGTAGG
CGGCAGGATACTGTGGCACTTTCCACAGTGGAGGCTGAGTACATGGCTTTCAGCCGTGCCGTTCAACAAGCAATC
TGGCTTGCAAGTTTTCTGAAGGAGGTGGGATTACCACAGGATACGCCCACTTTGATATACGCCGATAACGATGGT
TCTATTGCGAATACACAAAACTACAAGAACCACCGGAGGACGAAGCATATTGATATCAGGTACCATTTTATCAAG
GAGAGGACTGCGATGGGAGACGTTGTTTTCGAGTATATTCCCTCTGCCGAGAATCTAGCCGACATCTTTACCAAA
CCTCTCGCTCGTGACGCGGTGTTGAGGCTTTGCGGTGACATGGGTTTACGGAGTGTCGAACCAGGGGGAGTGTTG
TGA
Gene >AgabiH97|039170
ATGTCTAGCAACACGGGTGGTAGCGCCCCTCCTATCTTCGCTGACACGGCAAAGTTCAATGGCACCAACTGGGTG
TCATGGAGTGGAATGATTCGCATCGCTGCGGAATTGCGAGGTGTATCCGGGTACCTCGACGGTACAGCTATCAAC
CCTGCCCAAAGCATTCCTATTATCACAACGACGCCTCCGTCGCCTACTACAGTTACAACCACAACTACTTCCACA
CCTCTGGAAACCCCATGGGAATCCACTACCCCAAATACCGCCGAATGGAAAGTCCGTAACGCCTGGGCTATGGGT
CTTCTTATCTATAACACTACCGATCCCATTGGCCTTGGAATCTCCATTAGTGGGAGCGCAGCCGAAGCTTGGAAA
TCGTACCGCGACAACTATGAAGTAGCCTCCGAGATTGCTACTCTCAATGCGGAAATGGACTTGAGAAACATGGTA
TACGCAGACGGACAAGACTTCACCGAGTTCGTGTCTCGACTCAGGACCAAATGGGCGAACGCCAACGCTCTTGGA
GCCAGCATTGACGACAAAGGTTTCCGGACAATTATCTTAAACTCTCTACCCCGCTCTTGGGACTCCATCGTCGCC
ACACTATACACTACCAAAACGTCACGCGAGGCTATAAGCCAACTTCTAACCCACTGGGCTAGAATAAGCCGAGAC
CGGGTCACTACGTCGCAGACCACTTCAGCTCTCCAAACGACCACTACACAATCGAACAGCCGCAACCGCCAGCGA
AATCAAAATAGCCAATTAGTTTGCACCAATACCAACTGTAACCGCAGGGGACATACCATCGAGTTTTGTTACTGG
CCAGGTGGTGGCAAAGCCGGACAATTTCCGCCAGGTTTCGGACGACGTGGGGGAGCTGGAGGTAGTGCCAACAAC
ACTACTACAGGAGGATATCAAGCTTCTGCAAATAACACCACCGCCAGTACCACGGAGAAGGCAGAGAGCAACGAA
CCTAAGGTACCATCCACCCTCCCAATACATTCCAACAATCCTAATGGCTCTTTGATTTCAACCCCTAGTGTCTCT
GAGAGACAGCGTACTGAGATCTGCGTAACGGGGAAGGATCAGAGAGTTAGTGCTAGTACCGCCTCGAATACGACT
ATTCCCACTTTACCATATGACGTGATTACCCTGCTCGACTCTGGAGCAAGCGATCATTGTTTCGTCAATAAATTA
TCCTTCTCTACGTATGTCCCGATGACACCACCTCGACAAGGAAATTCTGCGGGAAAGGGATCCACATTCTTCATA
GAAGGAGCTGGCGAAGTAGGCTTCTTCACGCCTCTGAATGGAATCTCGACAAAGATTTTATTGAATGACGCACTT
CACACCCCACAACTGAGGTCGAACTTAATCTCTGTTTCAAAGCTCGTATCACGGGGTTCGTCTGTGAGTTTTGAG
GGGAACACAGCAATTGTTCGCAATCATAGTGGTGCTGTAGCGCTAGTAGCCGTGAAGGAGAATGGGTTATACGTC
GTTCCTTCGGTGAACGTCCATGCGAACGCCGTGCAGTCGAAGAGGAGAGCTGTACCATTGGAGATCTGGCACCGC
CGCCTGGGACACATTAGCGTGGAAGTTATAAAGAGGATGTTGCGTGAAGATCTTGTCGATGGTTTGAGTATTGTG
GGATCTATGGAGATGGAAGGACTCTGTGAAGACTGTATTTTCGGCAAACACACCTCACACCCGTATAACAATCCT
ACACTCCTGGAGAAACGTCCACTTGAACGCGTATACATTGACATTTGGGGGCCTTCTCCAGTGCAATCTGCTGGG
GGGGCAAAGTATTTCATGTTAATTGTTGACGGCGCCACATCCTACAGAAAGTTGTATTTCCTTACCTCGAAGTCA
GCGGACGCCACTTTAATGGCCTTCAAGGAGTTTCATAAAGAGGCGGAAAGGCAGACTGGTGAAACGCTAAAGGAG
GTCCGGCTAGACATGGGACGTGAGTGGTACAACGAGCTTTGGAGTACGTACGTAAAAGGGCATGGGATCGTTCTG
AACTTTACCACACCTTACGCCCACCAGCAAAATGGCAAGGCAGAACGCTCTATGCGTACTCTGCTGGATATGGCG
CGTACCCTACTGGCAGACTCCGGTTTGCCACAGAAGTATTGGGCGGATGCCACCCAAACTGCTGCCTATGTACGA
AATCTCACTCCAACGACTGGTGACCCCGCCAATATCCCTGCTCAACGTTGGACTGGACAACGACAGGACGTATCA
CATCTACGCCCTTTTGGGTCCACCGCATATGCACACATACCCGTCGAAATACATCCTTCAAAATTGTCTCCTCGC
TCAGCGAAGCTCACATTGATTGGATACTACGGTCATACCGGCTACAAGCTGCTGGATCGTACCACCGGTGTCGCC
TACAAATCAAGAGACGTGATCTTCGAGGAAGCTCGACCTCATTTCTCTACCGACGCCATCACGACATTCCCTTCA
GACGACTCTCGTACCTCAACTATACGGCAAGAGATTGCGCCACGTCCTAAACCAATCAATACACTTCATGATACA
GCCAATGGCGTTACGACAACCCCGCCGACCGTGCTGACGCCAGTGCAGGGGGATTCATCCGCTACTTTTGAGGGT
AAAGCTACGGATGCCGTTACTGGAGTTGTCGAAGAGCCGCCGGTGGTACTGAGGAGAAGTCAAAGGATACCTAAA
CCGTCCCAACGAATGAAAGAGAGTCTGGATTACCTGAGTCGTCCAGAGGCACATACGATGGAATCAATTTCGGGG
GATCTTCATGTGCCAAAGACTTATCATGAAGCGATGAAGAAGCCTGACCTGTGGTTTGAGCCGATGTTGAAGGAG
TTGAATATCATGACGGAGAAACAGGTTTTTAGACTTGTTCCGCGCCCGGTTGGGAGGAACGTTGTCAAATCACGA
TGGGTGTTCGCAAACAAATATGATGAAGCCGGTTTGGTGGTTAGCCGCAAAGCACGCCTTGTCGCAAAGGGATTT
ACACAAGTCATCGGCGAAGACTACAACGAGACCTATGCCTCGGTGGCGCGCTTGGAGTCTGTACGGATGGTGTGT
GCTATTGCTGCCGCACGTGGTCTTCGACTGTGGCAGGTCGACTTCGTCTCTGCTTTTCTTAATAGCGAGAACTCC
TTCGAGGTATTTATGGAGCAGCCTCCTGGTTTCGAGGAGGGGGGAGACCATGTATGGTTACTCCTCAAAACTTTG
TATGGGACGATGCAGGGCGCCCACGACTGGGCACAGACTCTCGATCGAACTTACGCGGGTCATGGATATTATATA
TCGAAAGCCGACCCCCAGGTGCGATCGAAAGTAGAAGAGAATGAATTCACCCTCACATCAACTTGGACGGATGAT
GTCCTCGGCGCCTCATCAACAGCAGATGGTGAAGCGAAGGCTAAGGACGAGTTGGGAAGGAGTTATGAGATCAAG
GATCTGGGGGAGGCGAAATTCATTCTTGGGATGAGGATTGAGAGAGGAATCAATGGAGATGTGAGGTTATCCCAA
CGGACTTACTGTGAGCGCATTATTGAACGATTCAAATTTTCGGATTCCTTGAAACCTCGCTCCACTCCGCTACCT
GTTGGGACTACTTTGTCCATCGAAGGTTCGCCAGTCTCTGATGAAGAAAAGGCCGACATGAAGAATGTGCCTTAT
CGTGAAGTCCTCGGTTCTCTCATGTGGCTTCAAGTTGCAACTCGCCCCGATCTATCCTTTGCGGTGAACATTCTT
TCTCGTTTCGCAAACAATCCTGGACGTAGCCACTGGGAAGCTATGAAACACACACTGGCCTACGTCAAAGCTACT
ATGGACTACGGCATTACATACTACCGTGATGCAAGCATAAAACCTTATGGATACGTGGACGCAGATTTCGCTGGT
GATATCGACTCTCGACGTTCCACAGAGGGACATGTCTTTTTCGTAGCAGGCGGACCTGTATCTTGGGCTAGTAGG
CGGCAGGATACTGTGGCACTTTCCACAGTGGAGGCTGAGTACATGGCTTTCAGCCGTGCCGTTCAACAAGCAATC
TGGCTTGCAAGTTTTCTGAAGGAGGTGGGATTACCACAGGATACGCCCACTTTGATATACGCCGATAACGATGGT
TCTATTGCGAATACACAAAACTACAAGAACCACCGGAGGACGAAGCATATTGATATCAGGTACCATTTTATCAAG
GAGAGGACTGCGATGGGAGACGTTGTTTTCGAGTATATTCCCTCTGCCGAGAATCTAGCCGACATCTTTACCAAA
CCTCTCGCTCGTGACGCGGTGTTGAGGCTTTGCGGTGACATGGGTTTACGGAGTGTCGAACCAGGGGGAGTGTTG
TGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail