Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|038970
Gene name
Locationscaffold_2:99856..103512
Strand-
Gene length (bp)3656
Transcript length (bp)3201
Coding sequence length (bp)3201
Protein length (aa) 1067

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 34 0.45

Transmembrane Domains

Domain # Start End Length
1 188 210 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 38.32 22.82 53.81
Initials Initials knots 24.47 14.53 34.42
Pileal_Stipeal_center Stage I stipe center 19.26 11.15 27.38
Pileal_Stipeal_shell Stage I stipe shell 11.47 6.53 16.41
DIF_stipe_center Stage II stipe center 14.08 8.18 19.98
DIF_stipe_shell Stage II stipe shell 16.09 9.41 22.77
DIF_stipe_skin Stage II stipe skin 18.44 10.79 26.09
DIF_cap_skin Stage II cap skin 18.49 10.93 26.05
DIF_cap_tissue Stage II cap tissue 13.60 7.70 19.49
DIF_gill_tissue Stage II gill tissue 8.33 4.58 12.08
YFB_stipe_center Young fruiting body stipe center 17.75 10.38 25.12
YFB_stipe_shell Young fruiting body stipe shell 16.03 9.37 22.68
YFB_stipe_skin Young fruiting body stipe skin 17.12 9.81 24.44
YFB_cap_skin Young fruiting body cap skin 16.42 9.59 23.25
YFB_cap_tissue Young fruiting body cap tissue 13.19 7.59 18.80
YFB_gill_tissue Young fruiting body gill tissue 13.30 7.64 18.96
YFB_veil Young fruiting body veil 8.72 4.82 12.61

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.000613 yes
Casing YFB_stipe_center 0.002084 yes
Casing YFB_stipe_shell 0.000613 yes
Casing YFB_stipe_skin 0.001625 yes
Casing YFB_cap_skin 0.003365 yes
Casing YFB_cap_tissue 0.000613 yes
Casing YFB_gill_tissue 0.000613 yes
Casing YFB_veil 0.000613 yes
Casing Initials 0.110231 no
Casing Pileal_Stipeal_center 0.009446 yes
Casing Pileal_Stipeal_shell 0.000613 yes
Casing DIF_stipe_center 0.000613 yes
Casing DIF_stipe_shell 0.000613 yes
Casing DIF_stipe_skin 0.004548 yes
Casing DIF_cap_skin 0.003365 yes
Casing DIF_cap_tissue 0.000613 yes
DIF_gill_tissue YFB_stipe_center 0.005302 yes
DIF_gill_tissue YFB_stipe_shell 0.020523 yes
DIF_gill_tissue YFB_stipe_skin 0.008457 yes
DIF_gill_tissue YFB_cap_skin 0.018896 yes
DIF_gill_tissue YFB_cap_tissue 0.133562 no
DIF_gill_tissue YFB_gill_tissue 0.128525 no
DIF_gill_tissue YFB_veil 0.939339 no
YFB_stipe_center YFB_stipe_shell 0.834446 no
YFB_stipe_center YFB_stipe_skin 0.950050 no
YFB_stipe_center YFB_cap_skin 0.878340 no
YFB_stipe_center YFB_cap_tissue 0.388941 no
YFB_stipe_center YFB_gill_tissue 0.398529 no
YFB_stipe_center YFB_veil 0.011041 yes
YFB_stipe_shell YFB_stipe_skin 0.901280 no
YFB_stipe_shell YFB_cap_skin 0.966641 no
YFB_stipe_shell YFB_cap_tissue 0.633398 no
YFB_stipe_shell YFB_gill_tissue 0.648347 no
YFB_stipe_shell YFB_veil 0.031323 yes
YFB_stipe_skin YFB_cap_skin 0.941758 no
YFB_stipe_skin YFB_cap_tissue 0.478862 no
YFB_stipe_skin YFB_gill_tissue 0.488298 no
YFB_stipe_skin YFB_veil 0.016104 yes
YFB_cap_skin YFB_cap_tissue 0.569086 no
YFB_cap_skin YFB_gill_tissue 0.583135 no
YFB_cap_skin YFB_veil 0.027205 yes
YFB_cap_tissue YFB_gill_tissue 0.988583 no
YFB_cap_tissue YFB_veil 0.197235 no
YFB_gill_tissue YFB_veil 0.186066 no
Initials DIF_gill_tissue 0.000613 yes
Initials YFB_stipe_center 0.314964 no
Initials YFB_stipe_shell 0.150706 no
Initials YFB_stipe_skin 0.260498 no
Initials YFB_cap_skin 0.182058 no
Initials YFB_cap_tissue 0.019442 yes
Initials YFB_gill_tissue 0.022369 yes
Initials YFB_veil 0.000613 yes
Initials Pileal_Stipeal_center 0.510357 no
Initials Pileal_Stipeal_shell 0.003365 yes
Initials DIF_stipe_center 0.038495 yes
Initials DIF_stipe_shell 0.155040 no
Initials DIF_stipe_skin 0.403840 no
Initials DIF_cap_skin 0.396816 no
Initials DIF_cap_tissue 0.035076 yes
Pileal_Stipeal_center DIF_gill_tissue 0.001140 yes
Pileal_Stipeal_center YFB_stipe_center 0.874059 no
Pileal_Stipeal_center YFB_stipe_shell 0.650100 no
Pileal_Stipeal_center YFB_stipe_skin 0.805885 no
Pileal_Stipeal_center YFB_cap_skin 0.706409 no
Pileal_Stipeal_center YFB_cap_tissue 0.236368 no
Pileal_Stipeal_center YFB_gill_tissue 0.245982 no
Pileal_Stipeal_center YFB_veil 0.004548 yes
Pileal_Stipeal_center Pileal_Stipeal_shell 0.069763 no
Pileal_Stipeal_center DIF_stipe_center 0.348230 no
Pileal_Stipeal_center DIF_stipe_shell 0.659822 no
Pileal_Stipeal_center DIF_stipe_skin 0.938755 no
Pileal_Stipeal_center DIF_cap_skin 0.941014 no
Pileal_Stipeal_center DIF_cap_tissue 0.295235 no
Pileal_Stipeal_shell DIF_gill_tissue 0.360096 no
Pileal_Stipeal_shell YFB_stipe_center 0.139559 no
Pileal_Stipeal_shell YFB_stipe_shell 0.306336 no
Pileal_Stipeal_shell YFB_stipe_skin 0.201976 no
Pileal_Stipeal_shell YFB_cap_skin 0.259267 no
Pileal_Stipeal_shell YFB_cap_tissue 0.758194 no
Pileal_Stipeal_shell YFB_gill_tissue 0.739805 no
Pileal_Stipeal_shell YFB_veil 0.457394 no
Pileal_Stipeal_shell DIF_stipe_center 0.601584 no
Pileal_Stipeal_shell DIF_stipe_shell 0.298244 no
Pileal_Stipeal_shell DIF_stipe_skin 0.108850 no
Pileal_Stipeal_shell DIF_cap_skin 0.095478 no
Pileal_Stipeal_shell DIF_cap_tissue 0.695780 no
DIF_stipe_center DIF_gill_tissue 0.073760 no
DIF_stipe_center YFB_stipe_center 0.526709 no
DIF_stipe_center YFB_stipe_shell 0.775488 no
DIF_stipe_center YFB_stipe_skin 0.622614 no
DIF_stipe_center YFB_cap_skin 0.715889 no
DIF_stipe_center YFB_cap_tissue 0.903438 no
DIF_stipe_center YFB_gill_tissue 0.915966 no
DIF_stipe_center YFB_veil 0.111181 no
DIF_stipe_center DIF_stipe_shell 0.762847 no
DIF_stipe_center DIF_stipe_skin 0.443780 no
DIF_stipe_center DIF_cap_skin 0.423834 no
DIF_stipe_center DIF_cap_tissue 0.950933 no
DIF_stipe_shell DIF_gill_tissue 0.019715 yes
DIF_stipe_shell YFB_stipe_center 0.839730 no
DIF_stipe_shell YFB_stipe_shell 0.993411 no
DIF_stipe_shell YFB_stipe_skin 0.905706 no
DIF_stipe_shell YFB_cap_skin 0.971706 no
DIF_stipe_shell YFB_cap_tissue 0.620140 no
DIF_stipe_shell YFB_gill_tissue 0.634672 no
DIF_stipe_shell YFB_veil 0.030851 yes
DIF_stipe_shell DIF_stipe_skin 0.759705 no
DIF_stipe_shell DIF_cap_skin 0.745907 no
DIF_stipe_shell DIF_cap_tissue 0.694381 no
DIF_stipe_skin DIF_gill_tissue 0.003365 yes
DIF_stipe_skin YFB_stipe_center 0.946903 no
DIF_stipe_skin YFB_stipe_shell 0.753992 no
DIF_stipe_skin YFB_stipe_skin 0.888941 no
DIF_stipe_skin YFB_cap_skin 0.805314 no
DIF_stipe_skin YFB_cap_tissue 0.311370 no
DIF_stipe_skin YFB_gill_tissue 0.319242 no
DIF_stipe_skin YFB_veil 0.006742 yes
DIF_stipe_skin DIF_cap_skin 0.995393 no
DIF_stipe_skin DIF_cap_tissue 0.382825 no
DIF_cap_skin DIF_gill_tissue 0.002525 yes
DIF_cap_skin YFB_stipe_center 0.940652 no
DIF_cap_skin YFB_stipe_shell 0.739591 no
DIF_cap_skin YFB_stipe_skin 0.879698 no
DIF_cap_skin YFB_cap_skin 0.792928 no
DIF_cap_skin YFB_cap_tissue 0.291341 no
DIF_cap_skin YFB_gill_tissue 0.300496 no
DIF_cap_skin YFB_veil 0.006032 yes
DIF_cap_skin DIF_cap_tissue 0.362013 no
DIF_cap_tissue DIF_gill_tissue 0.110708 no
DIF_cap_tissue YFB_stipe_center 0.462544 no
DIF_cap_tissue YFB_stipe_shell 0.705498 no
DIF_cap_tissue YFB_stipe_skin 0.558857 no
DIF_cap_tissue YFB_cap_skin 0.644890 no
DIF_cap_tissue YFB_cap_tissue 0.958528 no
DIF_cap_tissue YFB_gill_tissue 0.969948 no
DIF_cap_tissue YFB_veil 0.162096 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|038970
MKSSSQTRNTPSFATLFFVLLFSLLASPTNVHATHTPVFDLKLSPGDWKSILKNDQGRDACSLEGWLASPECKKD
ADGEDESADESTRRALGDLTPSPCKCTIPYFNILCGCLLSNGSSSAIPNLNYTRWIEDCEGSGFPVSQSTSWVDD
QDQDIPDWAFVTPNGLTFDSARVLRVADRLQRWSTIQIITPIIAVISTLALLGLMYLFWYRRQRGKAKSRHDHSF
FAYIRKLLIPRSRSVKHPGRNDTFLIDGHGRERSTSDSGSFNMVPNRRHLVDSPIEATSYWSPDTDIRQASHLNQ
GVEHRVPFTSTMKNVRNRVRELMPWGIHPHPVINVRRGSRYRIDGDQTRSNTLSSITTSRRHGGGGTYRTIKEED
EEPEQMMGHAGDTSTAGHGHRVRAAITAMDREAVEGSVILIGDRDFTLESGSTGQHSSHPRPNAKNSFSEAYARG
HGIEGILTTPESAHPNVQVEPPSPTLNLHSPRAIPISPGAPPLLPPHPQERPPLPPTMERYTPRGSPSPHLRIST
EFVGRNVSKSNLNGEGTAQYQRDPSVSSGTNALSYATASLESHSHPKPSFDNGHNAGAYLTMILNQSRDTTVNPS
RSGSGSRPHPQSQPELLASHSALSRPPSNVSHHHGQASISRAANIVERSVTPSAYLPQPQDEFNPYEGIPHSQTP
RPNRPAGVDVVNVPQRHAQTSSVSLPRLPGEPEGQPQRGWSADDEMDRTSLLIDQPPMQIDSGMSGVYIATPQDV
RTIGRPGAGPRHWTNPSTESFATVISSVEGLGGSGESHRPGNDLGFQPESPTLSMLEKDFKRRSGFAIYAGRGSL
SGSSGWDASTQGHGGASNISPISHPPLPTSSNRQPFSSTTYVNSVGLEASGNSHHGFGNHNFSSASSASRSTSPG
LGHVRLGSDMSINPQNRSREDILSPPRNDPLRLFPDSVRAAGYTIGLRSGALPLTPRSSGLVEFGNVNGNSSANS
NGGGEARDDDVDDQHRDRANSRGVTGSGSLAGYVERDRTQLSNGGTWETDSSGVQTILEAVQQLPEPLNSHRERT
ASSLGTDLRTRPGQSK*
Coding >AgabiH97|038970
ATGAAATCATCATCGCAAACAAGGAACACTCCCAGTTTCGCCACTCTTTTCTTTGTACTTTTATTCTCCTTGCTC
GCATCACCGACGAATGTCCACGCAACACATACGCCGGTTTTCGATCTGAAGTTGTCGCCTGGAGATTGGAAGAGC
ATTTTGAAGAATGACCAAGGTCGTGATGCTTGTTCGCTGGAGGGATGGTTAGCGAGTCCTGAATGTAAAAAAGAC
GCAGATGGCGAGGATGAGAGTGCTGACGAGAGTACCAGGCGCGCGCTGGGCGACCTTACACCCTCCCCATGCAAA
TGTACGATACCTTATTTCAACATACTGTGCGGATGCCTGTTGTCAAATGGGAGCTCGAGTGCGATTCCCAACCTT
AATTATACTCGATGGATAGAGGATTGCGAAGGAAGCGGCTTTCCTGTCAGCCAAAGTACGTCGTGGGTTGACGAT
CAAGATCAAGATATACCCGACTGGGCTTTCGTTACGCCTAATGGTTTGACGTTCGATAGTGCAAGGGTCCTAAGA
GTCGCCGACCGCCTGCAACGGTGGTCGACTATCCAAATCATCACCCCTATTATAGCAGTCATCTCCACTCTCGCC
CTTCTCGGTCTTATGTATCTTTTCTGGTACCGCCGTCAACGCGGGAAGGCCAAATCTCGACATGACCACTCTTTC
TTTGCTTATATTCGGAAATTACTCATACCTCGCTCGCGGAGTGTCAAACACCCAGGACGCAACGACACGTTTCTC
ATTGACGGCCATGGACGCGAACGATCTACCAGCGACAGTGGATCCTTCAACATGGTACCTAACCGCCGTCACCTT
GTCGATTCTCCCATCGAAGCAACTTCATATTGGTCTCCGGACACCGACATTCGCCAGGCATCACATCTCAATCAG
GGTGTCGAGCACCGGGTTCCTTTTACCTCTACCATGAAGAACGTCCGAAATCGCGTGAGGGAACTGATGCCATGG
GGCATTCATCCGCACCCTGTAATTAATGTTCGTCGTGGAAGTCGATACCGGATCGATGGAGATCAGACGAGGAGC
AATACTCTCAGTAGCATCACAACATCGAGGAGACATGGTGGTGGTGGCACCTACCGGACGATCAAGGAAGAAGAT
GAAGAGCCCGAGCAAATGATGGGTCATGCTGGAGATACAAGCACTGCTGGGCATGGCCATAGGGTCAGGGCTGCA
ATTACAGCGATGGATAGGGAGGCTGTTGAGGGAAGTGTTATTCTCATAGGCGACCGGGACTTTACTCTGGAGTCT
GGTAGTACGGGACAACATAGCTCACATCCGAGGCCGAACGCGAAGAACTCCTTTTCCGAAGCCTATGCGAGGGGT
CATGGAATAGAGGGTATTCTGACGACCCCTGAATCTGCCCATCCAAACGTCCAGGTCGAGCCCCCTTCTCCAACG
TTGAATCTCCATTCACCAAGAGCCATTCCTATTTCCCCGGGAGCGCCACCTCTCCTTCCCCCACATCCTCAAGAA
AGGCCTCCGTTACCCCCAACCATGGAGAGATATACACCACGAGGATCCCCATCCCCTCATCTCCGGATCTCAACC
GAATTCGTTGGTCGAAATGTGTCCAAAAGTAATCTCAATGGCGAAGGTACTGCTCAATATCAACGGGATCCGTCA
GTTTCATCCGGAACAAACGCACTATCGTATGCTACTGCGAGCCTTGAGTCCCATTCACATCCCAAGCCATCCTTC
GACAATGGTCATAACGCAGGGGCTTATCTGACTATGATACTTAATCAGAGTCGGGACACTACGGTCAACCCTAGT
CGTTCAGGATCTGGTTCTCGCCCCCATCCACAGTCTCAACCTGAACTTCTTGCATCGCATTCTGCACTGTCTCGC
CCGCCCTCCAATGTGTCTCATCATCATGGTCAAGCTTCTATCTCCCGGGCTGCAAACATAGTTGAAAGAAGCGTA
ACTCCAAGTGCATACCTTCCTCAGCCCCAAGACGAGTTTAATCCTTATGAAGGAATTCCGCATTCCCAAACCCCT
CGACCCAATCGTCCTGCTGGGGTGGATGTGGTTAATGTACCCCAACGGCATGCTCAGACTTCAAGCGTATCACTC
CCTCGTTTGCCCGGTGAACCGGAAGGTCAACCGCAACGAGGTTGGTCGGCTGATGATGAAATGGATCGAACATCC
TTGTTGATCGACCAACCACCTATGCAGATAGACAGTGGGATGAGCGGGGTATACATTGCCACTCCTCAGGACGTG
AGAACAATAGGAAGACCAGGTGCGGGGCCCCGACATTGGACAAATCCCTCAACGGAAAGCTTCGCTACTGTTATC
AGTAGTGTTGAAGGTCTAGGTGGTAGTGGTGAGAGTCATAGACCGGGGAATGATCTCGGGTTTCAACCGGAGTCC
CCCACATTAAGTATGCTGGAGAAAGACTTCAAAAGGCGTTCGGGCTTCGCTATTTACGCTGGACGCGGGAGTCTC
AGTGGTAGTTCCGGATGGGATGCTAGCACTCAAGGCCATGGAGGGGCCAGCAACATATCACCTATCAGTCATCCT
CCACTACCAACTTCCAGTAATCGACAACCTTTTTCGTCCACCACCTACGTTAACTCAGTCGGACTTGAAGCCTCG
GGCAACAGTCACCACGGCTTCGGCAATCACAACTTCTCATCTGCCAGCTCAGCAAGTCGCTCCACTTCTCCTGGT
CTCGGCCACGTCCGACTCGGGAGTGATATGAGCATCAATCCGCAAAACAGGTCCAGAGAGGATATTTTAAGTCCA
CCAAGGAACGATCCACTTCGATTGTTCCCTGATAGTGTCCGCGCTGCGGGATATACAATTGGACTTCGTTCTGGC
GCCTTACCTCTTACTCCACGATCGTCGGGACTAGTTGAGTTTGGGAATGTGAACGGCAATTCCTCCGCTAACAGT
AATGGGGGAGGTGAAGCTCGCGATGACGACGTCGATGATCAGCACCGTGATAGAGCCAACTCCCGCGGAGTAACC
GGAAGTGGATCATTGGCCGGGTATGTTGAAAGAGACAGGACACAATTGAGCAACGGTGGAACGTGGGAGACAGAT
AGTTCAGGAGTACAAACGATCTTGGAAGCTGTACAACAACTTCCGGAACCTCTTAATTCTCATCGTGAAAGGACA
GCATCATCTTTAGGAACAGATTTACGGACGCGGCCTGGACAATCTAAGTAG
Transcript >AgabiH97|038970
ATGAAATCATCATCGCAAACAAGGAACACTCCCAGTTTCGCCACTCTTTTCTTTGTACTTTTATTCTCCTTGCTC
GCATCACCGACGAATGTCCACGCAACACATACGCCGGTTTTCGATCTGAAGTTGTCGCCTGGAGATTGGAAGAGC
ATTTTGAAGAATGACCAAGGTCGTGATGCTTGTTCGCTGGAGGGATGGTTAGCGAGTCCTGAATGTAAAAAAGAC
GCAGATGGCGAGGATGAGAGTGCTGACGAGAGTACCAGGCGCGCGCTGGGCGACCTTACACCCTCCCCATGCAAA
TGTACGATACCTTATTTCAACATACTGTGCGGATGCCTGTTGTCAAATGGGAGCTCGAGTGCGATTCCCAACCTT
AATTATACTCGATGGATAGAGGATTGCGAAGGAAGCGGCTTTCCTGTCAGCCAAAGTACGTCGTGGGTTGACGAT
CAAGATCAAGATATACCCGACTGGGCTTTCGTTACGCCTAATGGTTTGACGTTCGATAGTGCAAGGGTCCTAAGA
GTCGCCGACCGCCTGCAACGGTGGTCGACTATCCAAATCATCACCCCTATTATAGCAGTCATCTCCACTCTCGCC
CTTCTCGGTCTTATGTATCTTTTCTGGTACCGCCGTCAACGCGGGAAGGCCAAATCTCGACATGACCACTCTTTC
TTTGCTTATATTCGGAAATTACTCATACCTCGCTCGCGGAGTGTCAAACACCCAGGACGCAACGACACGTTTCTC
ATTGACGGCCATGGACGCGAACGATCTACCAGCGACAGTGGATCCTTCAACATGGTACCTAACCGCCGTCACCTT
GTCGATTCTCCCATCGAAGCAACTTCATATTGGTCTCCGGACACCGACATTCGCCAGGCATCACATCTCAATCAG
GGTGTCGAGCACCGGGTTCCTTTTACCTCTACCATGAAGAACGTCCGAAATCGCGTGAGGGAACTGATGCCATGG
GGCATTCATCCGCACCCTGTAATTAATGTTCGTCGTGGAAGTCGATACCGGATCGATGGAGATCAGACGAGGAGC
AATACTCTCAGTAGCATCACAACATCGAGGAGACATGGTGGTGGTGGCACCTACCGGACGATCAAGGAAGAAGAT
GAAGAGCCCGAGCAAATGATGGGTCATGCTGGAGATACAAGCACTGCTGGGCATGGCCATAGGGTCAGGGCTGCA
ATTACAGCGATGGATAGGGAGGCTGTTGAGGGAAGTGTTATTCTCATAGGCGACCGGGACTTTACTCTGGAGTCT
GGTAGTACGGGACAACATAGCTCACATCCGAGGCCGAACGCGAAGAACTCCTTTTCCGAAGCCTATGCGAGGGGT
CATGGAATAGAGGGTATTCTGACGACCCCTGAATCTGCCCATCCAAACGTCCAGGTCGAGCCCCCTTCTCCAACG
TTGAATCTCCATTCACCAAGAGCCATTCCTATTTCCCCGGGAGCGCCACCTCTCCTTCCCCCACATCCTCAAGAA
AGGCCTCCGTTACCCCCAACCATGGAGAGATATACACCACGAGGATCCCCATCCCCTCATCTCCGGATCTCAACC
GAATTCGTTGGTCGAAATGTGTCCAAAAGTAATCTCAATGGCGAAGGTACTGCTCAATATCAACGGGATCCGTCA
GTTTCATCCGGAACAAACGCACTATCGTATGCTACTGCGAGCCTTGAGTCCCATTCACATCCCAAGCCATCCTTC
GACAATGGTCATAACGCAGGGGCTTATCTGACTATGATACTTAATCAGAGTCGGGACACTACGGTCAACCCTAGT
CGTTCAGGATCTGGTTCTCGCCCCCATCCACAGTCTCAACCTGAACTTCTTGCATCGCATTCTGCACTGTCTCGC
CCGCCCTCCAATGTGTCTCATCATCATGGTCAAGCTTCTATCTCCCGGGCTGCAAACATAGTTGAAAGAAGCGTA
ACTCCAAGTGCATACCTTCCTCAGCCCCAAGACGAGTTTAATCCTTATGAAGGAATTCCGCATTCCCAAACCCCT
CGACCCAATCGTCCTGCTGGGGTGGATGTGGTTAATGTACCCCAACGGCATGCTCAGACTTCAAGCGTATCACTC
CCTCGTTTGCCCGGTGAACCGGAAGGTCAACCGCAACGAGGTTGGTCGGCTGATGATGAAATGGATCGAACATCC
TTGTTGATCGACCAACCACCTATGCAGATAGACAGTGGGATGAGCGGGGTATACATTGCCACTCCTCAGGACGTG
AGAACAATAGGAAGACCAGGTGCGGGGCCCCGACATTGGACAAATCCCTCAACGGAAAGCTTCGCTACTGTTATC
AGTAGTGTTGAAGGTCTAGGTGGTAGTGGTGAGAGTCATAGACCGGGGAATGATCTCGGGTTTCAACCGGAGTCC
CCCACATTAAGTATGCTGGAGAAAGACTTCAAAAGGCGTTCGGGCTTCGCTATTTACGCTGGACGCGGGAGTCTC
AGTGGTAGTTCCGGATGGGATGCTAGCACTCAAGGCCATGGAGGGGCCAGCAACATATCACCTATCAGTCATCCT
CCACTACCAACTTCCAGTAATCGACAACCTTTTTCGTCCACCACCTACGTTAACTCAGTCGGACTTGAAGCCTCG
GGCAACAGTCACCACGGCTTCGGCAATCACAACTTCTCATCTGCCAGCTCAGCAAGTCGCTCCACTTCTCCTGGT
CTCGGCCACGTCCGACTCGGGAGTGATATGAGCATCAATCCGCAAAACAGGTCCAGAGAGGATATTTTAAGTCCA
CCAAGGAACGATCCACTTCGATTGTTCCCTGATAGTGTCCGCGCTGCGGGATATACAATTGGACTTCGTTCTGGC
GCCTTACCTCTTACTCCACGATCGTCGGGACTAGTTGAGTTTGGGAATGTGAACGGCAATTCCTCCGCTAACAGT
AATGGGGGAGGTGAAGCTCGCGATGACGACGTCGATGATCAGCACCGTGATAGAGCCAACTCCCGCGGAGTAACC
GGAAGTGGATCATTGGCCGGGTATGTTGAAAGAGACAGGACACAATTGAGCAACGGTGGAACGTGGGAGACAGAT
AGTTCAGGAGTACAAACGATCTTGGAAGCTGTACAACAACTTCCGGAACCTCTTAATTCTCATCGTGAAAGGACA
GCATCATCTTTAGGAACAGATTTACGGACGCGGCCTGGACAATCTAAGTAG
Gene >AgabiH97|038970
ATGAAATCATCATCGCAAACAAGGAACACTCCCAGTTTCGCCACTCTTTTCTTTGTACTTTTATTCTCCTTGCTC
GCATCACCGACGAATGTCCACGCAACACATACGCCGGTTTTCGATCTGAAGTTGTCGGTGAGCTGAGCGCTCTGA
CCAATCTCAACGCTGTGACTGACGATATAACTCCTTTATGACGCTCCTTGAATCCGATACCATGATTTGTAGCCT
GGAGATTGGAAGAGCATTGTGAGTGTCGGTTGACATAGCCTATAAGCGTGGAGCATGCCGTTGCTAACACAACAG
GATTTTAGTTGAAGAATGACCAAGGTCGTGATGCTTGTTCGCTGGAGGGATGGTTAGCGAGTCCTGAATGTAAAA
AAGACGCAGATGGCGAGGATGAGAGTGCTGACGAGAGTACCAGGCGCGGTGAGTCGATCATCCAGTCAGCCTTGC
TTGGTCACCGAATTGATTGTTTTTGGGCCTACCGATTGTAGCGCTGGGCGACCTTACACCCTCCCCATGCAAATG
GTAAGAGCTTCATTCATTTTGGTGCTTCAAAATTTTCATGTGTTACAGTACGATACCTTATTTCAACATACTGTG
CGGATGCCTGTTGTCAAATGGGAGCTCGAGTGCGATTCCCAACCTTAATTATACTCGATGGATAGAGGATTGCGA
AGGAAGCGGCTTTCCTGTCAGCCAAAGTACGTCGTGGGTTGACGATCAAGATCAAGATATACCCGACTGGGCTTT
CGTTACGCCTAATGGTTTGACGTTCGATAGTGCAAGGGTCCTAAGAGGTGCGGGAAAGTCGTCTTCTTGTCTCTA
TCTTATCTCATAGCGTCAAACAAGTCGCCGACCGCCTGCAACGGTGGTCGACTATCCAAATCATCACCCCTATTA
TAGCAGTCATCTCCACTCTCGCCCTTCTCGGTCTTATGTATCTTTTCTGGTACCGCCGTCAACGCGGGAAGGCCA
AATCTCGACATGACCACTCTTTCTTTGCTTATATTCGGAAATTACTCATACCTCGCTCGCGGAGTGTCAAACACC
CAGGACGCAACGACACGTTTCTCATTGACGGCCATGGACGCGAACGATCTACCAGCGACAGTGGATCCTTCAACA
TGGTACCTAACCGCCGTCACCTTGTCGATTCTCCCATCGAAGCAACTTCATATTGGTCTCCGGACACCGACATTC
GCCAGGCATCACATCTCAATCAGGGTGTCGAGCACCGGGTTCCTTTTACCTCTACCATGAAGAACGTCCGAAATC
GCGTGAGGGAACTGATGCCATGGGGCATTCATCCGCACCCTGTAATTAATGTTCGTCGTGGAAGTCGATACCGGA
TCGATGGAGATCAGACGAGGAGCAATACTCTCAGTAGCATCACAACATCGAGGAGACATGGTGGTGGTGGCACCT
ACCGGACGATCAAGGAAGAAGATGAAGAGCCCGAGCAAATGATGGGTCATGCTGGAGATACAAGCACTGCTGGGC
ATGGCCATAGGGTCAGGGCTGCAATTACAGCGATGGATAGGGAGGCTGTTGAGGGAAGTGTTATTCTCATAGGCG
ACCGGGACTTTACTCTGGAGTCTGGTAGTACGGGACAACATAGCTCACATCCGAGGCCGAACGCGAAGAACTCCT
TTTCCGAAGCCTATGCGAGGGGTCATGGAATAGAGGGTATTCTGACGACCCCTGAATCTGCCCATCCAAACGTCC
AGGTCGAGCCCCCTTCTCCAACGTTGAATCTCCATTCACCAAGAGCCATTCCTATTGTACGTGCGGTTCACGCCA
TCCTCGCTTGGTCCTTTTTTGAGTTTTGAGTAATTGCTTGTCTTTTCTAGTCCCCGGGAGCGCCACCTCTCCTTC
CCCCACATCCTCAAGAAAGGCCTCCGTTACCCCCAACCATGGAGAGATATACACCACGAGGATCCCCATCCCCTC
ATCTCCGGATCTCAACCGAATTCGTTGGTCGAAATGTGTCCAAAAGTAATCTCAATGGCGAAGGTAACGCTGGCA
TCAGAGCTGATACAGAAGATAAAAACTCAAATTTCCTTTTCCCATCTGCAGGTACTGCTCAATATCAACGGGATC
CGTCAGTTTCATCCGGAACAAACGCACTATCGTATGCTACTGCGAGCCTTGAGTCCCATTCACATCCCAAGCCAT
CCTTCGACAATGGTCATAACGCAGGGGCTTATCTGACTATGATACTTAATCAGAGTCGGGACACTACGGTCAACC
CTAGTCGTTCAGGATCTGGTTCTCGCCCCCATCCACAGTCTCAACCTGAACTTCTTGCATCGCATTCTGCACTGT
CTCGCCCGCCCTCCAATGTGTCTCATCATCATGGTCAAGCTTCTATCTCCCGGGCTGCAAACATAGTTGAAAGAA
GCGTAACTCCAAGTGCATACCTTCCTCAGCCCCAAGACGAGTTTAATCCTTATGAAGGAATTCCGCATTCCCAAA
CCCCTCGACCCAATCGTCCTGCTGGGGTGGATGTGGTTAATGTACCCCAACGGCATGCTCAGACTTCAAGCGTAT
CACTCCCTCGTTTGCCCGGTGAACCGGAAGGTCAACCGCAACGAGGTTGGTCGGCTGATGATGAAATGGATCGAA
CATCCTTGTTGATCGACCAACCACCTATGCAGATAGACAGTGGGATGAGCGGGGTATACATTGCCACTCCTCAGG
ACGTGAGAACAATAGGAAGACCAGGTGCGGGGCCCCGACATTGGACAAATCCCTCAACGGAAAGCTTCGCTACTG
TTATCAGTAGTGTTGAAGGTCTAGGTGGTAGTGGTGAGAGTCATAGACCGGGGAATGATCTCGGGTTTCAACCGG
AGTCCCCCACATTAAGTATGCTGGAGAAAGACTTCAAAAGGCGTTCGGGCTTCGCTATTTACGCTGGACGCGGGA
GTCTCAGTGGTAGTTCCGGATGGGATGCTAGCACTCAAGGCCATGGAGGGGCCAGCAACATATCACCTATCAGTC
ATCCTCCACTACCAACTTCCAGTAATCGACAACCTTTTTCGTCCACCACCTACGTTAACTCAGTCGGACTTGAAG
CCTCGGGCAACAGTCACCACGGCTTCGGCAATCACAACTTCTCATCTGCCAGCTCAGCAAGTCGCTCCACTTCTC
CTGGTCTCGGCCACGTCCGACTCGGGAGTGATATGAGCATCAATCCGCAAAACAGGTCCAGAGAGGATATTTTAA
GTCCACCAAGGAACGATCCACTTCGATTGTTCCCTGATAGTGTCCGCGCTGCGGGATATACAATTGGACTTCGTT
CTGGCGCCTTACCTCTTACTCCACGATCGTCGGGACTAGTTGAGTTTGGGAATGTGAACGGCAATTCCTCCGCTA
ACAGTAATGGGGGAGGTGAAGCTCGCGATGACGACGTCGATGATCAGCACCGTGATAGAGCCAACTCCCGCGGAG
TAACCGGAAGTGGATCATTGGCCGGGTATGTTGAAAGAGACAGGACACAATTGAGCAACGGTGGAACGTGGGAGA
CAGATAGTTCAGGAGTACAAACGATCTTGGAAGCTGTACAACAACTTCCGGAACCTCTTAATTCTCATCGTGAAA
GGACAGCATCATCTTTAGGAACAGATTTACGGACGCGGCCTGGACAATCTAAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail