Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|038940
Gene name
Locationscaffold_2:85214..91016
Strand-
Gene length (bp)5802
Transcript length (bp)5631
Coding sequence length (bp)5631
Protein length (aa) 1877

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00481 PP2C Protein phosphatase 2C 8.0E-38 1306 1454
PF13855 LRR_8 Leucine rich repeat 2.2E-06 709 766
PF13855 LRR_8 Leucine rich repeat 3.4E-09 999 1059
PF13855 LRR_8 Leucine rich repeat 4.1E-07 1023 1080
PF00211 Guanylate_cyc Adenylate and Guanylate cyclase catalytic domain 9.2E-19 1509 1670

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P49606|CYAA_USTMA Adenylate cyclase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UAC1 PE=3 SV=1 444 1839 0.0E+00
sp|Q01513|CYAA_PODAS Adenylate cyclase OS=Podospora anserina PE=3 SV=1 280 1729 0.0E+00
sp|P23466|CYAA_LACKL Adenylate cyclase OS=Lachancea kluyveri GN=CYR1 PE=3 SV=1 514 1732 0.0E+00
sp|Q01631|CYAA_NEUCR Adenylate cyclase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cr-1 PE=1 SV=2 368 1838 0.0E+00
sp|P08678|CYAA_YEAST Adenylate cyclase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CYR1 PE=1 SV=2 439 1766 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P49606|CYAA_USTMA Adenylate cyclase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UAC1 PE=3 SV=1 444 1839 0.0E+00
sp|Q01513|CYAA_PODAS Adenylate cyclase OS=Podospora anserina PE=3 SV=1 280 1729 0.0E+00
sp|P23466|CYAA_LACKL Adenylate cyclase OS=Lachancea kluyveri GN=CYR1 PE=3 SV=1 514 1732 0.0E+00
sp|Q01631|CYAA_NEUCR Adenylate cyclase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cr-1 PE=1 SV=2 368 1838 0.0E+00
sp|P08678|CYAA_YEAST Adenylate cyclase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CYR1 PE=1 SV=2 439 1766 0.0E+00
sp|P14605|CYAA_SCHPO Adenylate cyclase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cyr1 PE=1 SV=1 439 1729 9.0E-156
sp|Q8BXA7|PHLP2_MOUSE PH domain leucine-rich repeat-containing protein phosphatase 2 OS=Mus musculus GN=Phlpp2 PE=1 SV=3 555 1461 1.0E-35
sp|Q8AVI4|SHOC2_XENLA Leucine-rich repeat protein SHOC-2 OS=Xenopus laevis GN=shoc2 PE=2 SV=1 546 933 1.0E-30
sp|Q5F4C4|SHOC2_CHICK Leucine-rich repeat protein SHOC-2 OS=Gallus gallus GN=SHOC2 PE=2 SV=1 529 933 3.0E-30
sp|Q6AYI5|SHOC2_RAT Leucine-rich repeat protein SHOC-2 OS=Rattus norvegicus GN=Shoc2 PE=2 SV=1 529 933 3.0E-28
sp|B0W6M9|SUR8_CULQU Leucine-rich repeat protein soc-2 homolog OS=Culex quinquefasciatus GN=Sur-8 PE=3 SV=1 566 933 4.0E-28
sp|Q9V780|LAP1_DROME Protein lap1 OS=Drosophila melanogaster GN=Lap1 PE=2 SV=1 578 933 7.0E-28
sp|Q8CHE4|PHLP1_MOUSE PH domain leucine-rich repeat-containing protein phosphatase 1 OS=Mus musculus GN=Phlpp1 PE=1 SV=2 620 1082 9.0E-28
sp|O60346|PHLP1_HUMAN PH domain leucine-rich repeat-containing protein phosphatase 1 OS=Homo sapiens GN=PHLPP1 PE=1 SV=3 620 1082 1.0E-27
sp|Q96NW7|LRRC7_HUMAN Leucine-rich repeat-containing protein 7 OS=Homo sapiens GN=LRRC7 PE=1 SV=1 578 933 3.0E-27
sp|O61967|LAP1_CAEEL Protein lap1 OS=Caenorhabditis elegans GN=let-413 PE=1 SV=3 580 988 4.0E-27
sp|P70587|LRRC7_RAT Leucine-rich repeat-containing protein 7 OS=Rattus norvegicus GN=Lrrc7 PE=1 SV=2 578 933 6.0E-27
sp|Q9WTR8|PHLP1_RAT PH domain leucine-rich repeat protein phosphatase 1 OS=Rattus norvegicus GN=Phlpp1 PE=1 SV=1 620 1082 6.0E-27
sp|Q7KRY7|LAP4_DROME Protein lap4 OS=Drosophila melanogaster GN=scrib PE=1 SV=1 604 933 6.0E-27
sp|Q80TE7|LRRC7_MOUSE Leucine-rich repeat-containing protein 7 OS=Mus musculus GN=Lrrc7 PE=1 SV=2 578 933 6.0E-27
sp|Q96RT1|LAP2_HUMAN Protein LAP2 OS=Homo sapiens GN=ERBB2IP PE=1 SV=2 569 933 3.0E-26
sp|Q4H4B6|SCRIB_DANRE Protein scribble homolog OS=Danio rerio GN=scrib PE=1 SV=1 664 933 3.0E-26
sp|O88520|SHOC2_MOUSE Leucine-rich repeat protein SHOC-2 OS=Mus musculus GN=Shoc2 PE=1 SV=2 529 933 4.0E-26
sp|A6QLV3|SHOC2_BOVIN Leucine-rich repeat protein SHOC-2 OS=Bos taurus GN=SHOC2 PE=2 SV=1 529 933 4.0E-26
sp|Q5RAV5|SHOC2_PONAB Leucine-rich repeat protein SHOC-2 OS=Pongo abelii GN=SHOC2 PE=2 SV=2 529 933 5.0E-26
sp|Q9UQ13|SHOC2_HUMAN Leucine-rich repeat protein SHOC-2 OS=Homo sapiens GN=SHOC2 PE=1 SV=2 529 933 5.0E-26
sp|Q5F4C4|SHOC2_CHICK Leucine-rich repeat protein SHOC-2 OS=Gallus gallus GN=SHOC2 PE=2 SV=1 685 1082 3.0E-25
sp|Q9BTT6|LRRC1_HUMAN Leucine-rich repeat-containing protein 1 OS=Homo sapiens GN=LRRC1 PE=1 SV=1 647 1080 4.0E-25
sp|F1MCA7|LRRC7_BOVIN Leucine-rich repeat-containing protein 7 OS=Bos taurus GN=LRRC7 PE=3 SV=3 578 933 5.0E-25
sp|Q8C0R9|LRRD1_MOUSE Leucine-rich repeat and death domain-containing protein 1 OS=Mus musculus GN=Lrrd1 PE=2 SV=2 625 1083 6.0E-25
sp|O61967|LAP1_CAEEL Protein lap1 OS=Caenorhabditis elegans GN=let-413 PE=1 SV=3 548 933 1.0E-24
sp|Q14160|SCRIB_HUMAN Protein scribble homolog OS=Homo sapiens GN=SCRIB PE=1 SV=4 647 933 2.0E-24
sp|Q80TH2|LAP2_MOUSE Protein LAP2 OS=Mus musculus GN=Erbb2ip PE=1 SV=3 569 933 2.0E-24
sp|Q8AVI4|SHOC2_XENLA Leucine-rich repeat protein SHOC-2 OS=Xenopus laevis GN=shoc2 PE=2 SV=1 685 1082 3.0E-24
sp|Q7SXW3|LRC40_DANRE Leucine-rich repeat-containing protein 40 OS=Danio rerio GN=lrrc40 PE=2 SV=1 541 1080 3.0E-24
sp|A4D1F6|LRRD1_HUMAN Leucine-rich repeat and death domain-containing protein 1 OS=Homo sapiens GN=LRRD1 PE=2 SV=2 625 1083 4.0E-24
sp|A7SFP1|SHOC2_NEMVE Leucine-rich repeat protein soc-2 homolog OS=Nematostella vectensis GN=v1g189306 PE=3 SV=1 618 1079 5.0E-24
sp|A7SFP1|SHOC2_NEMVE Leucine-rich repeat protein soc-2 homolog OS=Nematostella vectensis GN=v1g189306 PE=3 SV=1 534 933 7.0E-24
sp|Q8C0R9|LRRD1_MOUSE Leucine-rich repeat and death domain-containing protein 1 OS=Mus musculus GN=Lrrd1 PE=2 SV=2 556 1080 9.0E-24
sp|B4LXW1|SUR8_DROVI Leucine-rich repeat protein soc-2 homolog OS=Drosophila virilis GN=Sur-8 PE=3 SV=1 685 1080 9.0E-24
sp|Q1L8Y7|SHOC2_DANRE Leucine-rich repeat protein SHOC-2 OS=Danio rerio GN=shoc2 PE=2 SV=1 529 933 9.0E-24
sp|Q9BTT6|LRRC1_HUMAN Leucine-rich repeat-containing protein 1 OS=Homo sapiens GN=LRRC1 PE=1 SV=1 635 933 1.0E-23
sp|Q5UQG7|YR818_MIMIV Putative serine/threonine-protein kinase/receptor R818 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R818 PE=3 SV=1 1510 1669 1.0E-23
sp|Q4R6F0|LRRD1_MACFA Leucine-rich repeat and death domain-containing protein 1 OS=Macaca fascicularis GN=LRRD1 PE=2 SV=1 625 1083 1.0E-23
sp|Q80U72|SCRIB_MOUSE Protein scribble homolog OS=Mus musculus GN=Scrib PE=1 SV=2 647 933 2.0E-23
sp|Q6AYI5|SHOC2_RAT Leucine-rich repeat protein SHOC-2 OS=Rattus norvegicus GN=Shoc2 PE=2 SV=1 685 1083 4.0E-23
sp|B4JTV9|SUR8_DROGR Leucine-rich repeat protein soc-2 homolog OS=Drosophila grimshawi GN=Sur-8 PE=3 SV=1 685 1080 4.0E-23
sp|B3P3E8|SUR8_DROER Leucine-rich repeat protein soc-2 homolog OS=Drosophila erecta GN=Sur-8 PE=3 SV=1 685 1080 4.0E-23
sp|B4IBI9|SUR8_DROSE Leucine-rich repeat protein soc-2 homolog OS=Drosophila sechellia GN=Sur-8 PE=3 SV=1 685 1080 4.0E-23
sp|B4LXW1|SUR8_DROVI Leucine-rich repeat protein soc-2 homolog OS=Drosophila virilis GN=Sur-8 PE=3 SV=1 532 1016 5.0E-23
sp|B4PU77|SUR8_DROYA Leucine-rich repeat protein soc-2 homolog OS=Drosophila yakuba GN=Sur-8 PE=3 SV=1 685 1080 8.0E-23
sp|Q6GPJ5|LRC40_XENLA Leucine-rich repeat-containing protein 40 OS=Xenopus laevis GN=lrrc40 PE=2 SV=1 570 1084 9.0E-23
sp|A7SFP1|SHOC2_NEMVE Leucine-rich repeat protein soc-2 homolog OS=Nematostella vectensis GN=v1g189306 PE=3 SV=1 677 1091 1.0E-22
sp|Q7T6Y2|YR831_MIMIV Putative serine/threonine-protein kinase/receptor R831 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R831 PE=3 SV=2 1510 1669 1.0E-22
sp|Q94AT1|P2C76_ARATH Probable protein phosphatase 2C 76 OS=Arabidopsis thaliana GN=At5g53140 PE=2 SV=1 1204 1509 1.0E-22
sp|B5DX45|SUR8_DROPS Leucine-rich repeat protein soc-2 homolog OS=Drosophila pseudoobscura pseudoobscura GN=Sur-8 PE=3 SV=1 685 1080 1.0E-22
sp|Q9V780|LAP1_DROME Protein lap1 OS=Drosophila melanogaster GN=Lap1 PE=2 SV=1 557 940 2.0E-22
sp|A6QLV3|SHOC2_BOVIN Leucine-rich repeat protein SHOC-2 OS=Bos taurus GN=SHOC2 PE=2 SV=1 685 1102 2.0E-22
sp|Q5RAV5|SHOC2_PONAB Leucine-rich repeat protein SHOC-2 OS=Pongo abelii GN=SHOC2 PE=2 SV=2 685 1102 2.0E-22
sp|Q9UQ13|SHOC2_HUMAN Leucine-rich repeat protein SHOC-2 OS=Homo sapiens GN=SHOC2 PE=1 SV=2 685 1102 2.0E-22
sp|B4QVR7|SUR8_DROSI Leucine-rich repeat protein soc-2 homolog OS=Drosophila simulans GN=Sur-8 PE=3 SV=2 690 1080 2.0E-22
sp|Q9VEK6|SUR8_DROME Leucine-rich repeat protein soc-2 homolog OS=Drosophila melanogaster GN=Sur-8 PE=2 SV=3 685 1080 2.0E-22
sp|B4N9T4|SUR8_DROWI Leucine-rich repeat protein soc-2 homolog OS=Drosophila willistoni GN=Sur-8 PE=3 SV=1 685 1080 2.0E-22
sp|O88520|SHOC2_MOUSE Leucine-rich repeat protein SHOC-2 OS=Mus musculus GN=Shoc2 PE=1 SV=2 685 1082 5.0E-22
sp|Q7KRY7|LAP4_DROME Protein lap4 OS=Drosophila melanogaster GN=scrib PE=1 SV=1 697 1084 6.0E-22
sp|Q22875|SHOC2_CAEEL Leucine-rich repeat protein soc-2 OS=Caenorhabditis elegans GN=soc-2 PE=1 SV=3 568 933 7.0E-22
sp|Q22875|SHOC2_CAEEL Leucine-rich repeat protein soc-2 OS=Caenorhabditis elegans GN=soc-2 PE=1 SV=3 675 1080 1.0E-21
sp|B4JTV9|SUR8_DROGR Leucine-rich repeat protein soc-2 homolog OS=Drosophila grimshawi GN=Sur-8 PE=3 SV=1 532 1016 2.0E-21
sp|B3LWU3|SUR8_DROAN Leucine-rich repeat protein soc-2 homolog OS=Drosophila ananassae GN=Sur-8 PE=3 SV=1 685 1080 2.0E-21
sp|Q1L8Y7|SHOC2_DANRE Leucine-rich repeat protein SHOC-2 OS=Danio rerio GN=shoc2 PE=2 SV=1 685 1102 3.0E-21
sp|Q80VQ1|LRRC1_MOUSE Leucine-rich repeat-containing protein 1 OS=Mus musculus GN=Lrrc1 PE=1 SV=2 635 934 3.0E-21
sp|Q5M8G4|LRC40_XENTR Leucine-rich repeat-containing protein 40 OS=Xenopus tropicalis GN=lrrc40 PE=2 SV=1 613 1084 5.0E-21
sp|P70587|LRRC7_RAT Leucine-rich repeat-containing protein 7 OS=Rattus norvegicus GN=Lrrc7 PE=1 SV=2 570 927 6.0E-21
sp|Q80TE7|LRRC7_MOUSE Leucine-rich repeat-containing protein 7 OS=Mus musculus GN=Lrrc7 PE=1 SV=2 570 927 6.0E-21
sp|B4IBI9|SUR8_DROSE Leucine-rich repeat protein soc-2 homolog OS=Drosophila sechellia GN=Sur-8 PE=3 SV=1 532 933 6.0E-21
sp|Q9VEK6|SUR8_DROME Leucine-rich repeat protein soc-2 homolog OS=Drosophila melanogaster GN=Sur-8 PE=2 SV=3 532 933 6.0E-21
sp|F1MCA7|LRRC7_BOVIN Leucine-rich repeat-containing protein 7 OS=Bos taurus GN=LRRC7 PE=3 SV=3 570 927 7.0E-21
sp|B4N9T4|SUR8_DROWI Leucine-rich repeat protein soc-2 homolog OS=Drosophila willistoni GN=Sur-8 PE=3 SV=1 532 933 7.0E-21
sp|Q80VQ1|LRRC1_MOUSE Leucine-rich repeat-containing protein 1 OS=Mus musculus GN=Lrrc1 PE=1 SV=2 647 1080 7.0E-21
sp|B3P3E8|SUR8_DROER Leucine-rich repeat protein soc-2 homolog OS=Drosophila erecta GN=Sur-8 PE=3 SV=1 532 933 8.0E-21
sp|A8XWW4|SHOC2_CAEBR Leucine-rich repeat protein soc-2 OS=Caenorhabditis briggsae GN=soc-2 PE=3 SV=1 617 933 9.0E-21
sp|B0W6M9|SUR8_CULQU Leucine-rich repeat protein soc-2 homolog OS=Culex quinquefasciatus GN=Sur-8 PE=3 SV=1 685 1080 1.0E-20
sp|Q80TH2|LAP2_MOUSE Protein LAP2 OS=Mus musculus GN=Erbb2ip PE=1 SV=3 625 1083 1.0E-20
sp|B4PU77|SUR8_DROYA Leucine-rich repeat protein soc-2 homolog OS=Drosophila yakuba GN=Sur-8 PE=3 SV=1 532 933 1.0E-20
sp|Q9Y4C4|MFHA1_HUMAN Malignant fibrous histiocytoma-amplified sequence 1 OS=Homo sapiens GN=MFHAS1 PE=1 SV=2 564 913 1.0E-20
sp|Q4R6F0|LRRD1_MACFA Leucine-rich repeat and death domain-containing protein 1 OS=Macaca fascicularis GN=LRRD1 PE=2 SV=1 542 1080 2.0E-20
sp|B3LWU3|SUR8_DROAN Leucine-rich repeat protein soc-2 homolog OS=Drosophila ananassae GN=Sur-8 PE=3 SV=1 567 933 2.0E-20
sp|B4QVR7|SUR8_DROSI Leucine-rich repeat protein soc-2 homolog OS=Drosophila simulans GN=Sur-8 PE=3 SV=2 567 933 3.0E-20
sp|Q54AX5|LRRA_DICDI Leucine-rich repeat protein lrrA OS=Dictyostelium discoideum GN=lrrA PE=1 SV=1 615 1082 3.0E-20
sp|P26338|CYAA_TRYEQ Receptor-type adenylate cyclase (Fragment) OS=Trypanosoma equiperdum GN=ESAG4C PE=3 SV=1 1514 1700 4.0E-20
sp|A4D1F6|LRRD1_HUMAN Leucine-rich repeat and death domain-containing protein 1 OS=Homo sapiens GN=LRRD1 PE=2 SV=2 548 1080 5.0E-20
sp|Q7T6X2|YR826_MIMIV Putative serine/threonine-protein kinase/receptor R826 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R826 PE=3 SV=2 1504 1669 5.0E-20
sp|Q5ZLN0|LRC40_CHICK Leucine-rich repeat-containing protein 40 OS=Gallus gallus GN=LRRC40 PE=2 SV=1 539 1080 6.0E-20
sp|Q27675|CYAA_LEIDO Receptor-type adenylate cyclase A OS=Leishmania donovani GN=RAC-A PE=2 SV=1 1514 1662 7.0E-20
sp|Q7KRY7|LAP4_DROME Protein lap4 OS=Drosophila melanogaster GN=scrib PE=1 SV=1 549 948 8.0E-20
sp|Q25263|CYAB_LEIDO Receptor-type adenylate cyclase B OS=Leishmania donovani GN=RAC-B PE=2 SV=1 1514 1662 8.0E-20
sp|Q13045|FLII_HUMAN Protein flightless-1 homolog OS=Homo sapiens GN=FLII PE=1 SV=2 723 1080 9.0E-20
sp|P70587|LRRC7_RAT Leucine-rich repeat-containing protein 7 OS=Rattus norvegicus GN=Lrrc7 PE=1 SV=2 624 1083 1.0E-19
sp|Q80TE7|LRRC7_MOUSE Leucine-rich repeat-containing protein 7 OS=Mus musculus GN=Lrrc7 PE=1 SV=2 624 1083 1.0E-19
sp|A7SFP1|SHOC2_NEMVE Leucine-rich repeat protein soc-2 homolog OS=Nematostella vectensis GN=v1g189306 PE=3 SV=1 711 1113 1.0E-19
sp|Q96NW7|LRRC7_HUMAN Leucine-rich repeat-containing protein 7 OS=Homo sapiens GN=LRRC7 PE=1 SV=1 624 1080 2.0E-19
sp|A4D1F6|LRRD1_HUMAN Leucine-rich repeat and death domain-containing protein 1 OS=Homo sapiens GN=LRRD1 PE=2 SV=2 537 934 2.0E-19
sp|B5DX45|SUR8_DROPS Leucine-rich repeat protein soc-2 homolog OS=Drosophila pseudoobscura pseudoobscura GN=Sur-8 PE=3 SV=1 618 1080 2.0E-19
sp|Q9JJ28|FLII_MOUSE Protein flightless-1 homolog OS=Mus musculus GN=Flii PE=1 SV=1 660 1080 2.0E-19
sp|Q26896|CYAA_TRYCO Receptor-type adenylate cyclase (Fragment) OS=Trypanosoma congolense PE=2 SV=1 1514 1663 2.0E-19
sp|Q99280|CY43_TRYBB Receptor-type adenylate cyclase GRESAG 4.3 OS=Trypanosoma brucei brucei GN=GRESAG 4.3 PE=1 SV=1 1510 1683 3.0E-19
sp|Q8LAY8|P2C69_ARATH Probable protein phosphatase 2C 69 OS=Arabidopsis thaliana GN=At5g10740 PE=2 SV=1 1147 1461 3.0E-19
sp|Q9BTT6|LRRC1_HUMAN Leucine-rich repeat-containing protein 1 OS=Homo sapiens GN=LRRC1 PE=1 SV=1 566 947 5.0E-19
sp|A8XWW4|SHOC2_CAEBR Leucine-rich repeat protein soc-2 OS=Caenorhabditis briggsae GN=soc-2 PE=3 SV=1 675 1090 8.0E-19
sp|Q22875|SHOC2_CAEEL Leucine-rich repeat protein soc-2 OS=Caenorhabditis elegans GN=soc-2 PE=1 SV=3 713 1090 1.0E-18
sp|Q3V1N1|MFHA1_MOUSE Malignant fibrous histiocytoma-amplified sequence 1 homolog OS=Mus musculus GN=Mfhas1 PE=2 SV=2 594 913 1.0E-18
sp|Q6Z8P4|PIRL4_ORYSJ Plant intracellular Ras-group-related LRR protein 4 OS=Oryza sativa subsp. japonica GN=IRL4 PE=2 SV=1 677 910 2.0E-18
sp|Q4PSE8|P2C71_ARATH Probable protein phosphatase 2C 71 OS=Arabidopsis thaliana GN=At5g24940 PE=2 SV=1 1302 1502 2.0E-18
sp|Q99396|CY42_TRYBB Receptor-type adenylate cyclase GRESAG 4.2 (Fragment) OS=Trypanosoma brucei brucei GN=GRESAG 4.2 PE=2 SV=1 1514 1709 3.0E-18
sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 557 1109 3.0E-18
sp|Q4R6F0|LRRD1_MACFA Leucine-rich repeat and death domain-containing protein 1 OS=Macaca fascicularis GN=LRRD1 PE=2 SV=1 537 927 4.0E-18
sp|Q7XK44|PIRL3_ORYSJ Plant intracellular Ras-group-related LRR protein 3 OS=Oryza sativa subsp. japonica GN=IRL3 PE=2 SV=3 618 809 4.0E-18
sp|Q26721|CYA4_TRYBB Receptor-type adenylate cyclase ESAG 4 OS=Trypanosoma brucei brucei GN=ESAG4 PE=3 SV=1 1514 1685 4.0E-18
sp|Q99279|CY41_TRYBB Receptor-type adenylate cyclase GRESAG 4.1 OS=Trypanosoma brucei brucei GN=GRESAG 4.1 PE=1 SV=1 1501 1685 4.0E-18
sp|Q8VYG9|PIRL9_ARATH Plant intracellular Ras-group-related LRR protein 9 OS=Arabidopsis thaliana GN=PIRL9 PE=2 SV=1 570 831 5.0E-18
sp|Q9H9A6|LRC40_HUMAN Leucine-rich repeat-containing protein 40 OS=Homo sapiens GN=LRRC40 PE=1 SV=1 541 1080 6.0E-18
sp|Q6ZH85|PIRL2_ORYSJ Plant intracellular Ras-group-related LRR protein 2 OS=Oryza sativa subsp. japonica GN=IRL2 PE=2 SV=1 618 809 9.0E-18
sp|B4N9T4|SUR8_DROWI Leucine-rich repeat protein soc-2 homolog OS=Drosophila willistoni GN=Sur-8 PE=3 SV=1 556 927 1.0E-17
sp|Q80U72|SCRIB_MOUSE Protein scribble homolog OS=Mus musculus GN=Scrib PE=1 SV=2 732 1083 2.0E-17
sp|Q9JJ28|FLII_MOUSE Protein flightless-1 homolog OS=Mus musculus GN=Flii PE=1 SV=1 609 933 2.0E-17
sp|Q6ZVD8|PHLP2_HUMAN PH domain leucine-rich repeat-containing protein phosphatase 2 OS=Homo sapiens GN=PHLPP2 PE=1 SV=3 620 1080 2.0E-17
sp|Q6L5C4|P2C52_ORYSJ Probable protein phosphatase 2C 52 OS=Oryza sativa subsp. japonica GN=Os05g0587100 PE=2 SV=1 1309 1462 2.0E-17
sp|Q9FIZ3|GSO2_ARATH LRR receptor-like serine/threonine-protein kinase GSO2 OS=Arabidopsis thaliana GN=GSO2 PE=2 SV=2 557 1122 2.0E-17
sp|A4IIK1|MFHA1_XENTR Malignant fibrous histiocytoma-amplified sequence 1 homolog OS=Xenopus tropicalis GN=mfhas1 PE=2 SV=1 669 933 2.0E-17
sp|P70389|ALS_MOUSE Insulin-like growth factor-binding protein complex acid labile subunit OS=Mus musculus GN=Igfals PE=1 SV=1 593 1095 2.0E-17
sp|A7SFP1|SHOC2_NEMVE Leucine-rich repeat protein soc-2 homolog OS=Nematostella vectensis GN=v1g189306 PE=3 SV=1 564 933 3.0E-17
sp|Q80VQ1|LRRC1_MOUSE Leucine-rich repeat-containing protein 1 OS=Mus musculus GN=Lrrc1 PE=1 SV=2 566 913 3.0E-17
sp|F1MCA7|LRRC7_BOVIN Leucine-rich repeat-containing protein 7 OS=Bos taurus GN=LRRC7 PE=3 SV=3 624 1080 4.0E-17
sp|Q9Y4C4|MFHA1_HUMAN Malignant fibrous histiocytoma-amplified sequence 1 OS=Homo sapiens GN=MFHAS1 PE=1 SV=2 774 1082 4.0E-17
sp|Q0JL75|P2C07_ORYSJ Probable protein phosphatase 2C 7 OS=Oryza sativa subsp. japonica GN=Os01g0618200 PE=2 SV=2 1300 1461 4.0E-17
sp|Q8S7M7|PIRL5_ORYSJ Plant intracellular Ras-group-related LRR protein 5 OS=Oryza sativa subsp. japonica GN=IRL5 PE=2 SV=1 541 893 4.0E-17
sp|Q24020|FLII_DROME Protein flightless-1 OS=Drosophila melanogaster GN=fliI PE=2 SV=1 618 964 5.0E-17
sp|Q5JJY4|P2C04_ORYSJ Protein kinase and PP2C-like domain-containing protein OS=Oryza sativa subsp. japonica GN=Os01g0541900 PE=2 SV=1 1309 1462 5.0E-17
sp|Q6EN45|P2C13_ORYSJ Probable protein phosphatase 2C 13 OS=Oryza sativa subsp. japonica GN=Os02g0255100 PE=2 SV=1 1309 1467 7.0E-17
sp|Q9V780|LAP1_DROME Protein lap1 OS=Drosophila melanogaster GN=Lap1 PE=2 SV=1 680 1082 9.0E-17
sp|Q09564|PHLPP_CAEEL Protein phosphatase PHLPP-like protein OS=Caenorhabditis elegans GN=F43C1.1 PE=3 SV=2 631 933 9.0E-17
sp|Q940A2|P2C31_ARATH Protein kinase and PP2C-like domain-containing protein OS=Arabidopsis thaliana GN=At2g40860/At2g40870 PE=2 SV=1 1309 1462 9.0E-17
sp|Q14160|SCRIB_HUMAN Protein scribble homolog OS=Homo sapiens GN=SCRIB PE=1 SV=4 732 1119 1.0E-16
sp|Q8W4Q3|PIRL3_ARATH Plant intracellular Ras-group-related LRR protein 3 OS=Arabidopsis thaliana GN=PIRL3 PE=2 SV=1 568 809 1.0E-16
sp|Q8RXV3|P2C59_ARATH Probable protein phosphatase 2C 59 OS=Arabidopsis thaliana GN=WIN2 PE=1 SV=1 1300 1461 1.0E-16
sp|Q96NW7|LRRC7_HUMAN Leucine-rich repeat-containing protein 7 OS=Homo sapiens GN=LRRC7 PE=1 SV=1 570 899 2.0E-16
sp|Q96RT1|LAP2_HUMAN Protein LAP2 OS=Homo sapiens GN=ERBB2IP PE=1 SV=2 625 1080 2.0E-16
sp|Q14160|SCRIB_HUMAN Protein scribble homolog OS=Homo sapiens GN=SCRIB PE=1 SV=4 813 1082 2.0E-16
sp|Q55E58|PATS1_DICDI Probable serine/threonine-protein kinase pats1 OS=Dictyostelium discoideum GN=pats1 PE=3 SV=1 542 787 2.0E-16
sp|Q67UX7|P2C10_ORYSJ Probable protein phosphatase 2C 10 OS=Oryza sativa subsp. japonica GN=Os02g0149800 PE=2 SV=1 1303 1461 2.0E-16
sp|Q80U72|SCRIB_MOUSE Protein scribble homolog OS=Mus musculus GN=Scrib PE=1 SV=2 813 1082 3.0E-16
sp|Q7XR06|P2C45_ORYSJ Probable protein phosphatase 2C 45 OS=Oryza sativa subsp. japonica GN=Os04g0659500 PE=2 SV=2 1302 1461 4.0E-16
sp|Q4H4B6|SCRIB_DANRE Protein scribble homolog OS=Danio rerio GN=scrib PE=1 SV=1 549 948 5.0E-16
sp|B4IBI9|SUR8_DROSE Leucine-rich repeat protein soc-2 homolog OS=Drosophila sechellia GN=Sur-8 PE=3 SV=1 556 927 5.0E-16
sp|B3LWU3|SUR8_DROAN Leucine-rich repeat protein soc-2 homolog OS=Drosophila ananassae GN=Sur-8 PE=3 SV=1 556 927 5.0E-16
sp|Q5M8G4|LRC40_XENTR Leucine-rich repeat-containing protein 40 OS=Xenopus tropicalis GN=lrrc40 PE=2 SV=1 570 1057 5.0E-16
sp|B3P3E8|SUR8_DROER Leucine-rich repeat protein soc-2 homolog OS=Drosophila erecta GN=Sur-8 PE=3 SV=1 556 927 6.0E-16
sp|P93194|RPK1_IPONI Receptor-like protein kinase OS=Ipomoea nil GN=INRPK1 PE=2 SV=2 628 1083 7.0E-16
sp|Q8BXA7|PHLP2_MOUSE PH domain leucine-rich repeat-containing protein phosphatase 2 OS=Mus musculus GN=Phlpp2 PE=1 SV=3 544 939 8.0E-16
sp|Q4H4B6|SCRIB_DANRE Protein scribble homolog OS=Danio rerio GN=scrib PE=1 SV=1 732 1095 8.0E-16
sp|B4PU77|SUR8_DROYA Leucine-rich repeat protein soc-2 homolog OS=Drosophila yakuba GN=Sur-8 PE=3 SV=1 556 927 9.0E-16
sp|B5DX45|SUR8_DROPS Leucine-rich repeat protein soc-2 homolog OS=Drosophila pseudoobscura pseudoobscura GN=Sur-8 PE=3 SV=1 541 933 9.0E-16
sp|B4QVR7|SUR8_DROSI Leucine-rich repeat protein soc-2 homolog OS=Drosophila simulans GN=Sur-8 PE=3 SV=2 556 927 1.0E-15
sp|Q9VEK6|SUR8_DROME Leucine-rich repeat protein soc-2 homolog OS=Drosophila melanogaster GN=Sur-8 PE=2 SV=3 556 927 1.0E-15
sp|Q80VQ1|LRRC1_MOUSE Leucine-rich repeat-containing protein 1 OS=Mus musculus GN=Lrrc1 PE=1 SV=2 813 1080 1.0E-15
sp|Q8VYG9|PIRL9_ARATH Plant intracellular Ras-group-related LRR protein 9 OS=Arabidopsis thaliana GN=PIRL9 PE=2 SV=1 839 1082 1.0E-15
sp|Q80X72|LRC15_MOUSE Leucine-rich repeat-containing protein 15 OS=Mus musculus GN=Lrrc15 PE=2 SV=1 553 927 1.0E-15
sp|Q5G5E0|PIRL5_ARATH Plant intracellular Ras-group-related LRR protein 5 OS=Arabidopsis thaliana GN=PIRL5 PE=2 SV=1 628 890 1.0E-15
sp|O60346|PHLP1_HUMAN PH domain leucine-rich repeat-containing protein phosphatase 1 OS=Homo sapiens GN=PHLPP1 PE=1 SV=3 1322 1461 2.0E-15
sp|P70587|LRRC7_RAT Leucine-rich repeat-containing protein 7 OS=Rattus norvegicus GN=Lrrc7 PE=1 SV=2 690 1110 2.0E-15
sp|Q80TE7|LRRC7_MOUSE Leucine-rich repeat-containing protein 7 OS=Mus musculus GN=Lrrc7 PE=1 SV=2 690 1110 2.0E-15
sp|Q9BTT6|LRRC1_HUMAN Leucine-rich repeat-containing protein 1 OS=Homo sapiens GN=LRRC1 PE=1 SV=1 813 1080 2.0E-15
sp|Q6Z8P4|PIRL4_ORYSJ Plant intracellular Ras-group-related LRR protein 4 OS=Oryza sativa subsp. japonica GN=IRL4 PE=2 SV=1 860 1104 2.0E-15
sp|Q24020|FLII_DROME Protein flightless-1 OS=Drosophila melanogaster GN=fliI PE=2 SV=1 699 1080 2.0E-15
sp|Q8W4Q3|PIRL3_ARATH Plant intracellular Ras-group-related LRR protein 3 OS=Arabidopsis thaliana GN=PIRL3 PE=2 SV=1 829 1084 2.0E-15
sp|A6H6A4|LRIQ4_MOUSE Leucine-rich repeat and IQ domain-containing protein 4 OS=Mus musculus GN=Lrriq4 PE=2 SV=1 621 1080 2.0E-15
sp|Q3UVD5|LGR6_MOUSE Leucine-rich repeat-containing G-protein coupled receptor 6 OS=Mus musculus GN=Lgr6 PE=2 SV=1 564 937 2.0E-15
sp|Q9HBX8|LGR6_HUMAN Leucine-rich repeat-containing G-protein coupled receptor 6 OS=Homo sapiens GN=LGR6 PE=1 SV=3 570 937 2.0E-15
sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 557 1086 3.0E-15
sp|Q9FFJ3|PIRL1_ARATH Plant intracellular Ras-group-related LRR protein 1 OS=Arabidopsis thaliana GN=PIRL1 PE=2 SV=1 567 831 3.0E-15
sp|Q5Z6F5|P2C59_ORYSJ Probable protein phosphatase 2C 59 OS=Oryza sativa subsp. japonica GN=Os06g0698300 PE=2 SV=1 1300 1468 3.0E-15
sp|Q6Z8P4|PIRL4_ORYSJ Plant intracellular Ras-group-related LRR protein 4 OS=Oryza sativa subsp. japonica GN=IRL4 PE=2 SV=1 794 1067 4.0E-15
sp|Q7XK44|PIRL3_ORYSJ Plant intracellular Ras-group-related LRR protein 3 OS=Oryza sativa subsp. japonica GN=IRL3 PE=2 SV=3 556 788 4.0E-15
sp|Q6ZVD8|PHLP2_HUMAN PH domain leucine-rich repeat-containing protein phosphatase 2 OS=Homo sapiens GN=PHLPP2 PE=1 SV=3 1307 1461 4.0E-15
sp|Q96II8|LRCH3_HUMAN Leucine-rich repeat and calponin homology domain-containing protein 3 OS=Homo sapiens GN=LRCH3 PE=1 SV=2 569 759 4.0E-15
sp|Q5RFE9|LRC40_PONAB Leucine-rich repeat-containing protein 40 OS=Pongo abelii GN=LRRC40 PE=2 SV=1 570 1014 4.0E-15
sp|Q7XK44|PIRL3_ORYSJ Plant intracellular Ras-group-related LRR protein 3 OS=Oryza sativa subsp. japonica GN=IRL3 PE=2 SV=3 844 1092 5.0E-15
sp|Q652Z7|P2C55_ORYSJ Probable protein phosphatase 2C 55 OS=Oryza sativa subsp. japonica GN=Os06g0526700 PE=2 SV=2 1204 1461 5.0E-15
sp|Q6Z8P4|PIRL4_ORYSJ Plant intracellular Ras-group-related LRR protein 4 OS=Oryza sativa subsp. japonica GN=IRL4 PE=2 SV=1 609 891 6.0E-15
sp|Q6ZVD8|PHLP2_HUMAN PH domain leucine-rich repeat-containing protein phosphatase 2 OS=Homo sapiens GN=PHLPP2 PE=1 SV=3 684 1110 6.0E-15
sp|P12024|CHAO_DROME Chaoptin OS=Drosophila melanogaster GN=chp PE=1 SV=2 567 1084 6.0E-15
sp|Q9SLA1|P2C22_ARATH Probable protein phosphatase 2C 22 OS=Arabidopsis thaliana GN=At2g25620 PE=2 SV=1 1275 1462 6.0E-15
sp|Q80TH2|LAP2_MOUSE Protein LAP2 OS=Mus musculus GN=Erbb2ip PE=1 SV=3 557 829 7.0E-15
sp|Q80TL0|PPM1E_MOUSE Protein phosphatase 1E OS=Mus musculus GN=Ppm1e PE=1 SV=2 1307 1463 7.0E-15
sp|Q7K4Q5|Y0417_DROME Probable protein phosphatase CG10417 OS=Drosophila melanogaster GN=CG10417 PE=1 SV=1 1308 1462 8.0E-15
sp|P34268|FLII_CAEEL Protein flightless-1 homolog OS=Caenorhabditis elegans GN=fli-1 PE=2 SV=2 557 881 8.0E-15
sp|Q9CRC8|LRC40_MOUSE Leucine-rich repeat-containing protein 40 OS=Mus musculus GN=Lrrc40 PE=1 SV=2 638 1080 8.0E-15
sp|Q9WTR8|PHLP1_RAT PH domain leucine-rich repeat protein phosphatase 1 OS=Rattus norvegicus GN=Phlpp1 PE=1 SV=1 1322 1461 9.0E-15
sp|Q6ZH85|PIRL2_ORYSJ Plant intracellular Ras-group-related LRR protein 2 OS=Oryza sativa subsp. japonica GN=IRL2 PE=2 SV=1 844 1067 9.0E-15
sp|Q9DBB9|CPN2_MOUSE Carboxypeptidase N subunit 2 OS=Mus musculus GN=Cpn2 PE=1 SV=2 825 1122 9.0E-15
sp|Q80Z30|PPM1E_RAT Protein phosphatase 1E OS=Rattus norvegicus GN=Ppm1e PE=1 SV=1 1307 1463 9.0E-15
sp|O60346|PHLP1_HUMAN PH domain leucine-rich repeat-containing protein phosphatase 1 OS=Homo sapiens GN=PHLPP1 PE=1 SV=3 544 939 1.0E-14
sp|Q96NW7|LRRC7_HUMAN Leucine-rich repeat-containing protein 7 OS=Homo sapiens GN=LRRC7 PE=1 SV=1 690 1110 1.0E-14
sp|Q80VQ1|LRRC1_MOUSE Leucine-rich repeat-containing protein 1 OS=Mus musculus GN=Lrrc1 PE=1 SV=2 732 1084 1.0E-14
sp|Q8S7M7|PIRL5_ORYSJ Plant intracellular Ras-group-related LRR protein 5 OS=Oryza sativa subsp. japonica GN=IRL5 PE=2 SV=1 844 1083 1.0E-14
sp|A6H6A4|LRIQ4_MOUSE Leucine-rich repeat and IQ domain-containing protein 4 OS=Mus musculus GN=Lrriq4 PE=2 SV=1 612 957 1.0E-14
sp|Q8WY54|PPM1E_HUMAN Protein phosphatase 1E OS=Homo sapiens GN=PPM1E PE=1 SV=2 1307 1463 1.0E-14
sp|C0LGR3|Y4265_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g26540 OS=Arabidopsis thaliana GN=At4g26540 PE=2 SV=1 677 1086 1.0E-14
sp|P0DM44|LGR6_DANRE Leucine-rich repeat-containing G-protein coupled receptor 6 OS=Danio rerio GN=lgr6 PE=2 SV=1 558 940 1.0E-14
sp|Q8CHE4|PHLP1_MOUSE PH domain leucine-rich repeat-containing protein phosphatase 1 OS=Mus musculus GN=Phlpp1 PE=1 SV=2 1322 1461 2.0E-14
sp|F1MCA7|LRRC7_BOVIN Leucine-rich repeat-containing protein 7 OS=Bos taurus GN=LRRC7 PE=3 SV=3 557 816 2.0E-14
sp|Q13045|FLII_HUMAN Protein flightless-1 homolog OS=Homo sapiens GN=FLII PE=1 SV=2 609 933 2.0E-14
sp|Q96DD0|LRC39_HUMAN Leucine-rich repeat-containing protein 39 OS=Homo sapiens GN=LRRC39 PE=2 SV=1 723 927 2.0E-14
sp|Q7SXW3|LRC40_DANRE Leucine-rich repeat-containing protein 40 OS=Danio rerio GN=lrrc40 PE=2 SV=1 826 1083 3.0E-14
sp|Q8VYG9|PIRL9_ARATH Plant intracellular Ras-group-related LRR protein 9 OS=Arabidopsis thaliana GN=PIRL9 PE=2 SV=1 612 906 3.0E-14
sp|Q24020|FLII_DROME Protein flightless-1 OS=Drosophila melanogaster GN=fliI PE=2 SV=1 844 1082 3.0E-14
sp|C0LGP4|Y3475_ARATH Probable LRR receptor-like serine/threonine-protein kinase At3g47570 OS=Arabidopsis thaliana GN=At3g47570 PE=2 SV=1 595 1059 3.0E-14
sp|Q8R5M3|LRC15_RAT Leucine-rich repeat-containing protein 15 OS=Rattus norvegicus GN=Lrrc15 PE=2 SV=1 553 927 3.0E-14
sp|Q9LRV8|PIRL2_ARATH Plant intracellular Ras-group-related LRR protein 2 OS=Arabidopsis thaliana GN=PIRL2 PE=2 SV=1 609 812 3.0E-14
sp|Q9LRV8|PIRL2_ARATH Plant intracellular Ras-group-related LRR protein 2 OS=Arabidopsis thaliana GN=PIRL2 PE=2 SV=1 850 1083 4.0E-14
sp|Q24020|FLII_DROME Protein flightless-1 OS=Drosophila melanogaster GN=fliI PE=2 SV=1 557 851 5.0E-14
sp|A6NIV6|LRIQ4_HUMAN Leucine-rich repeat and IQ domain-containing protein 4 OS=Homo sapiens GN=LRRIQ4 PE=3 SV=2 556 955 5.0E-14
sp|Q42371|ERECT_ARATH LRR receptor-like serine/threonine-protein kinase ERECTA OS=Arabidopsis thaliana GN=ERECTA PE=1 SV=1 617 1089 5.0E-14
sp|Q9WTR8|PHLP1_RAT PH domain leucine-rich repeat protein phosphatase 1 OS=Rattus norvegicus GN=Phlpp1 PE=1 SV=1 544 939 6.0E-14
sp|Q5ZLN0|LRC40_CHICK Leucine-rich repeat-containing protein 40 OS=Gallus gallus GN=LRRC40 PE=2 SV=1 557 927 6.0E-14
sp|Q3V1N1|MFHA1_MOUSE Malignant fibrous histiocytoma-amplified sequence 1 homolog OS=Mus musculus GN=Mfhas1 PE=2 SV=2 774 1090 6.0E-14
sp|A4IIK1|MFHA1_XENTR Malignant fibrous histiocytoma-amplified sequence 1 homolog OS=Xenopus tropicalis GN=mfhas1 PE=2 SV=1 613 913 6.0E-14
sp|Q9SZ53|P2C60_ARATH Probable protein phosphatase 2C 60 OS=Arabidopsis thaliana GN=At4g31860 PE=2 SV=1 1308 1463 6.0E-14
sp|Q9LY03|IRK_ARATH Probable LRR receptor-like serine/threonine-protein kinase IRK OS=Arabidopsis thaliana GN=IRK PE=1 SV=1 664 1112 6.0E-14
sp|Q6ZH85|PIRL2_ORYSJ Plant intracellular Ras-group-related LRR protein 2 OS=Oryza sativa subsp. japonica GN=IRL2 PE=2 SV=1 667 891 7.0E-14
sp|Q9LRV8|PIRL2_ARATH Plant intracellular Ras-group-related LRR protein 2 OS=Arabidopsis thaliana GN=PIRL2 PE=2 SV=1 709 933 7.0E-14
sp|Q3ZC49|LRC39_BOVIN Leucine-rich repeat-containing protein 39 OS=Bos taurus GN=LRRC39 PE=2 SV=1 723 927 7.0E-14
sp|Q8CHE4|PHLP1_MOUSE PH domain leucine-rich repeat-containing protein phosphatase 1 OS=Mus musculus GN=Phlpp1 PE=1 SV=2 544 939 9.0E-14
sp|Q3EAF9|P2C49_ARATH Probable protein phosphatase 2C 49 OS=Arabidopsis thaliana GN=At3g62260 PE=2 SV=1 1186 1470 9.0E-14
sp|Q5G5E0|PIRL5_ARATH Plant intracellular Ras-group-related LRR protein 5 OS=Arabidopsis thaliana GN=PIRL5 PE=2 SV=1 677 915 1.0E-13
sp|Q3UVD5|LGR6_MOUSE Leucine-rich repeat-containing G-protein coupled receptor 6 OS=Mus musculus GN=Lgr6 PE=2 SV=1 713 1074 1.0E-13
sp|P34268|FLII_CAEEL Protein flightless-1 homolog OS=Caenorhabditis elegans GN=fli-1 PE=2 SV=2 556 904 1.0E-13
sp|Q4R3P6|LRC40_MACFA Leucine-rich repeat-containing protein 40 OS=Macaca fascicularis GN=LRRC40 PE=2 SV=1 570 1014 1.0E-13
sp|Q9Y2L9|LRCH1_HUMAN Leucine-rich repeat and calponin homology domain-containing protein 1 OS=Homo sapiens GN=LRCH1 PE=1 SV=3 570 757 1.0E-13
sp|Q5SN75|P2C08_ORYSJ Probable protein phosphatase 2C 8 OS=Oryza sativa subsp. japonica GN=Os01g0656200 PE=2 SV=1 1302 1467 1.0E-13
sp|Q55CS7|MPL1_DICDI MAP kinase phosphatase with leucine-rich repeats protein 1 OS=Dictyostelium discoideum GN=mpl1 PE=2 SV=1 663 933 1.0E-13
sp|Q8BGR2|LRC8D_MOUSE Volume-regulated anion channel subunit LRRC8D OS=Mus musculus GN=Lrrc8d PE=1 SV=1 604 800 1.0E-13
sp|Q9RBS2|POPC_RALSO Protein PopC OS=Ralstonia solanacearum (strain GMI1000) GN=popC PE=4 SV=2 564 933 1.0E-13
sp|Q8VZN9|P2C11_ARATH Probable protein phosphatase 2C 11 OS=Arabidopsis thaliana GN=At1g43900 PE=2 SV=1 1308 1462 1.0E-13
sp|P93006|P2C27_ARATH Probable protein phosphatase 2C 27 OS=Arabidopsis thaliana GN=At2g33700 PE=2 SV=1 1271 1459 1.0E-13
sp|Q54AX5|LRRA_DICDI Leucine-rich repeat protein lrrA OS=Dictyostelium discoideum GN=lrrA PE=1 SV=1 557 935 2.0E-13
sp|Q6ZH85|PIRL2_ORYSJ Plant intracellular Ras-group-related LRR protein 2 OS=Oryza sativa subsp. japonica GN=IRL2 PE=2 SV=1 868 1131 2.0E-13
sp|Q6ZVD8|PHLP2_HUMAN PH domain leucine-rich repeat-containing protein phosphatase 2 OS=Homo sapiens GN=PHLPP2 PE=1 SV=3 544 939 2.0E-13
sp|Q9FFJ3|PIRL1_ARATH Plant intracellular Ras-group-related LRR protein 1 OS=Arabidopsis thaliana GN=PIRL1 PE=2 SV=1 839 1082 2.0E-13
sp|Q6P3Y9|PONL1_MOUSE Podocan-like protein 1 OS=Mus musculus GN=Podnl1 PE=2 SV=2 621 1110 2.0E-13
sp|Q53Q11|P2C74_ORYSJ Probable protein phosphatase 2C 74 OS=Oryza sativa subsp. japonica GN=Os11g0242200 PE=3 SV=1 1301 1464 2.0E-13
sp|Q9SCT4|IMK2_ARATH Probably inactive leucine-rich repeat receptor-like protein kinase IMK2 OS=Arabidopsis thaliana GN=IMK2 PE=1 SV=1 657 938 2.0E-13
sp|Q5U308|LRC8D_RAT Volume-regulated anion channel subunit LRRC8D OS=Rattus norvegicus GN=Lrrc8d PE=2 SV=1 604 800 2.0E-13
sp|Q8YA32|INLI_LISMO Internalin-I OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=inlI PE=3 SV=1 513 1104 2.0E-13
sp|Q8BGI7|LRC39_MOUSE Leucine-rich repeat-containing protein 39 OS=Mus musculus GN=Lrrc39 PE=1 SV=1 723 927 2.0E-13
sp|Q54XZ5|Y0138_DICDI Probable serine/threonine-protein kinase DDB_G0278509 OS=Dictyostelium discoideum GN=DDB_G0278509 PE=3 SV=1 570 919 2.0E-13
sp|Q9BTT6|LRRC1_HUMAN Leucine-rich repeat-containing protein 1 OS=Homo sapiens GN=LRRC1 PE=1 SV=1 556 769 3.0E-13
sp|Q09564|PHLPP_CAEEL Protein phosphatase PHLPP-like protein OS=Caenorhabditis elegans GN=F43C1.1 PE=3 SV=2 1307 1513 3.0E-13
sp|Q5G5E0|PIRL5_ARATH Plant intracellular Ras-group-related LRR protein 5 OS=Arabidopsis thaliana GN=PIRL5 PE=2 SV=1 695 938 3.0E-13
sp|Q9HBX8|LGR6_HUMAN Leucine-rich repeat-containing G-protein coupled receptor 6 OS=Homo sapiens GN=LGR6 PE=1 SV=3 713 1074 3.0E-13
sp|Q9RBS2|POPC_RALSO Protein PopC OS=Ralstonia solanacearum (strain GMI1000) GN=popC PE=4 SV=2 682 1079 3.0E-13
sp|P62046|LRCH1_MOUSE Leucine-rich repeat and calponin homology domain-containing protein 1 OS=Mus musculus GN=Lrch1 PE=1 SV=2 566 757 3.0E-13
sp|Q6GPJ5|LRC40_XENLA Leucine-rich repeat-containing protein 40 OS=Xenopus laevis GN=lrrc40 PE=2 SV=1 557 927 4.0E-13
sp|Q9Y4C4|MFHA1_HUMAN Malignant fibrous histiocytoma-amplified sequence 1 OS=Homo sapiens GN=MFHAS1 PE=1 SV=2 723 1066 5.0E-13
sp|Q9SVW8|PIRL4_ARATH Plant intracellular Ras-group-related LRR protein 4 OS=Arabidopsis thaliana GN=PIRL4 PE=1 SV=1 628 869 5.0E-13
sp|Q7L1W4|LRC8D_HUMAN Volume-regulated anion channel subunit LRRC8D OS=Homo sapiens GN=LRRC8D PE=1 SV=1 604 800 5.0E-13
sp|Q6ETK3|P2C11_ORYSJ Probable protein phosphatase 2C 11 OS=Oryza sativa subsp. japonica GN=Os02g0180000 PE=2 SV=1 1308 1427 6.0E-13
sp|A4D1F6|LRRD1_HUMAN Leucine-rich repeat and death domain-containing protein 1 OS=Homo sapiens GN=LRRD1 PE=2 SV=2 847 1109 7.0E-13
sp|Q6ZH85|PIRL2_ORYSJ Plant intracellular Ras-group-related LRR protein 2 OS=Oryza sativa subsp. japonica GN=IRL2 PE=2 SV=1 536 750 7.0E-13
sp|Q9LRV8|PIRL2_ARATH Plant intracellular Ras-group-related LRR protein 2 OS=Arabidopsis thaliana GN=PIRL2 PE=2 SV=1 674 910 7.0E-13
sp|P35182|PP2C1_YEAST Protein phosphatase 2C homolog 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PTC1 PE=1 SV=1 1225 1461 7.0E-13
sp|P82963|CHAO_TRICA Chaoptin (Fragment) OS=Tribolium castaneum GN=CHP PE=2 SV=1 658 1064 7.0E-13
sp|Q5G5D8|PIRL7_ARATH Plant intracellular Ras-group-related LRR protein 7 OS=Arabidopsis thaliana GN=PIRL7 PE=2 SV=1 620 810 8.0E-13
sp|Q9VJ07|PHLPP_DROME Protein phosphatase PHLPP-like protein OS=Drosophila melanogaster GN=Phlpp PE=3 SV=1 757 1132 9.0E-13
sp|Q4H4B6|SCRIB_DANRE Protein scribble homolog OS=Danio rerio GN=scrib PE=1 SV=1 813 1082 1.0E-12
sp|Q6P9F7|LRC8B_HUMAN Volume-regulated anion channel subunit LRRC8B OS=Homo sapiens GN=LRRC8B PE=1 SV=2 567 935 1.0E-12
sp|P35859|ALS_RAT Insulin-like growth factor-binding protein complex acid labile subunit OS=Rattus norvegicus GN=Igfals PE=1 SV=1 681 1080 1.0E-12
sp|Q0DBU3|P2C56_ORYSJ Probable protein phosphatase 2C 56 OS=Oryza sativa subsp. japonica GN=Os06g0526800 PE=3 SV=2 1309 1461 1.0E-12
sp|Q9ZWC8|BRL1_ARATH Serine/threonine-protein kinase BRI1-like 1 OS=Arabidopsis thaliana GN=BRL1 PE=1 SV=1 603 1082 1.0E-12
sp|Q69VD9|P2C57_ORYSJ Probable protein phosphatase 2C 57 OS=Oryza sativa subsp. japonica GN=Os06g0597200 PE=2 SV=1 1298 1459 1.0E-12
sp|Q0JAA0|P2C44_ORYSJ Probable protein phosphatase 2C 44 OS=Oryza sativa subsp. japonica GN=Os04g0609600 PE=2 SV=1 1314 1462 1.0E-12
sp|Q8AVI4|SHOC2_XENLA Leucine-rich repeat protein SHOC-2 OS=Xenopus laevis GN=shoc2 PE=2 SV=1 544 759 2.0E-12
sp|Q80U72|SCRIB_MOUSE Protein scribble homolog OS=Mus musculus GN=Scrib PE=1 SV=2 743 1082 2.0E-12
sp|Q09564|PHLPP_CAEEL Protein phosphatase PHLPP-like protein OS=Caenorhabditis elegans GN=F43C1.1 PE=3 SV=2 690 1082 2.0E-12
sp|Q5G5E0|PIRL5_ARATH Plant intracellular Ras-group-related LRR protein 5 OS=Arabidopsis thaliana GN=PIRL5 PE=2 SV=1 844 1084 2.0E-12
sp|Q0J2L7|P2C68_ORYSJ Probable protein phosphatase 2C 68 OS=Oryza sativa subsp. japonica GN=Os09g0325700 PE=2 SV=2 1309 1462 2.0E-12
sp|B0M0P8|GEFL_DICDI Ras guanine nucleotide exchange factor L OS=Dictyostelium discoideum GN=gefL PE=2 SV=1 664 904 2.0E-12
sp|Q8RWE5|PIRL8_ARATH Plant intracellular Ras-group-related LRR protein 8 OS=Arabidopsis thaliana GN=PIRL8 PE=2 SV=1 618 810 2.0E-12
sp|Q5RFE9|LRC40_PONAB Leucine-rich repeat-containing protein 40 OS=Pongo abelii GN=LRRC40 PE=2 SV=1 557 933 3.0E-12
sp|B0M0P8|GEFL_DICDI Ras guanine nucleotide exchange factor L OS=Dictyostelium discoideum GN=gefL PE=2 SV=1 553 807 3.0E-12
sp|O64566|PIRL6_ARATH Plant intracellular Ras-group-related LRR protein 6 OS=Arabidopsis thaliana GN=PIRL6 PE=2 SV=1 620 810 3.0E-12
sp|C0LGV1|RCH1_ARATH LRR receptor-like serine/threonine-protein kinase RCH1 OS=Arabidopsis thaliana GN=RCH1 PE=2 SV=1 612 1080 3.0E-12
sp|Q6K7R2|PIRL6_ORYSJ Plant intracellular Ras-group-related LRR protein 6 OS=Oryza sativa subsp. japonica GN=IRL6 PE=2 SV=1 844 1083 3.0E-12
sp|O81716|P2C21_ARATH Probable protein phosphatase 2C 21 OS=Arabidopsis thaliana GN=PPC4-2 PE=1 SV=1 1308 1427 3.0E-12
sp|Q14160|SCRIB_HUMAN Protein scribble homolog OS=Homo sapiens GN=SCRIB PE=1 SV=4 556 829 4.0E-12
sp|Q7XK44|PIRL3_ORYSJ Plant intracellular Ras-group-related LRR protein 3 OS=Oryza sativa subsp. japonica GN=IRL3 PE=2 SV=3 674 913 4.0E-12
sp|A4IIK1|MFHA1_XENTR Malignant fibrous histiocytoma-amplified sequence 1 homolog OS=Xenopus tropicalis GN=mfhas1 PE=2 SV=1 573 769 4.0E-12
sp|Q9FFJ3|PIRL1_ARATH Plant intracellular Ras-group-related LRR protein 1 OS=Arabidopsis thaliana GN=PIRL1 PE=2 SV=1 674 892 4.0E-12
sp|B0M0P8|GEFL_DICDI Ras guanine nucleotide exchange factor L OS=Dictyostelium discoideum GN=gefL PE=2 SV=1 794 1082 4.0E-12
sp|Q9SGP2|HSL1_ARATH Receptor-like protein kinase HSL1 OS=Arabidopsis thaliana GN=HSL1 PE=2 SV=1 613 1080 4.0E-12
sp|Q7SXW3|LRC40_DANRE Leucine-rich repeat-containing protein 40 OS=Danio rerio GN=lrrc40 PE=2 SV=1 557 927 5.0E-12
sp|Q5G5E0|PIRL5_ARATH Plant intracellular Ras-group-related LRR protein 5 OS=Arabidopsis thaliana GN=PIRL5 PE=2 SV=1 779 1066 5.0E-12
sp|A6H6A4|LRIQ4_MOUSE Leucine-rich repeat and IQ domain-containing protein 4 OS=Mus musculus GN=Lrriq4 PE=2 SV=1 693 1083 5.0E-12
sp|Q42371|ERECT_ARATH LRR receptor-like serine/threonine-protein kinase ERECTA OS=Arabidopsis thaliana GN=ERECTA PE=1 SV=1 672 1109 5.0E-12
sp|Q8VZG8|Y4885_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g08850 OS=Arabidopsis thaliana GN=At4g08850 PE=2 SV=3 671 1109 5.0E-12
sp|O75427|LRCH4_HUMAN Leucine-rich repeat and calponin homology domain-containing protein 4 OS=Homo sapiens GN=LRCH4 PE=1 SV=2 569 759 5.0E-12
sp|Q65XK7|P2C51_ORYSJ Probable protein phosphatase 2C 51 OS=Oryza sativa subsp. japonica GN=Os05g0572700 PE=2 SV=1 1289 1467 5.0E-12
sp|O80871|P2C25_ARATH Probable protein phosphatase 2C 25 OS=Arabidopsis thaliana GN=At2g30020 PE=1 SV=1 1310 1464 5.0E-12
sp|C0LGR3|Y4265_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g26540 OS=Arabidopsis thaliana GN=At4g26540 PE=2 SV=1 544 1087 6.0E-12
sp|F1MT22|LGR5_BOVIN Leucine-rich repeat-containing G-protein coupled receptor 5 OS=Bos taurus GN=LGR5 PE=3 SV=2 519 937 6.0E-12
sp|P34268|FLII_CAEEL Protein flightless-1 homolog OS=Caenorhabditis elegans GN=fli-1 PE=2 SV=2 723 1080 7.0E-12
sp|Q69QZ0|P2C27_ORYSJ Probable protein phosphatase 2C 27 OS=Oryza sativa subsp. japonica GN=Os02g0799000 PE=2 SV=1 1308 1459 7.0E-12
sp|E7FE13|LGR4_DANRE Leucine-rich repeat-containing G-protein coupled receptor 4 OS=Danio rerio GN=lgr4 PE=2 SV=1 713 1059 7.0E-12
sp|P90920|EGG6_CAEEL Leucine-rich repeat-containing protein egg-6 OS=Caenorhabditis elegans GN=egg-6 PE=2 SV=2 564 915 7.0E-12
sp|Q9CRC8|LRC40_MOUSE Leucine-rich repeat-containing protein 40 OS=Mus musculus GN=Lrrc40 PE=1 SV=2 826 1083 8.0E-12
sp|Q3KQF4|LRC69_XENLA Leucine-rich repeat-containing protein 69 OS=Xenopus laevis GN=lrrc69 PE=2 SV=1 568 788 8.0E-12
sp|Q653S3|P2C70_ORYSJ Probable protein phosphatase 2C 70 OS=Oryza sativa subsp. japonica GN=Os09g0558000 PE=2 SV=2 1308 1462 8.0E-12
sp|Q14160|SCRIB_HUMAN Protein scribble homolog OS=Homo sapiens GN=SCRIB PE=1 SV=4 743 1082 9.0E-12
sp|A8XWW4|SHOC2_CAEBR Leucine-rich repeat protein soc-2 OS=Caenorhabditis briggsae GN=soc-2 PE=3 SV=1 674 1080 1.0E-11
sp|Q55E58|PATS1_DICDI Probable serine/threonine-protein kinase pats1 OS=Dictyostelium discoideum GN=pats1 PE=3 SV=1 582 905 1.0E-11
sp|C0LGP4|Y3475_ARATH Probable LRR receptor-like serine/threonine-protein kinase At3g47570 OS=Arabidopsis thaliana GN=At3g47570 PE=2 SV=1 557 1109 1.0E-11
sp|Q4V8I7|LRC8A_RAT Volume-regulated anion channel subunit LRRC8A OS=Rattus norvegicus GN=Lrrc8a PE=1 SV=1 556 735 1.0E-11
sp|Q7XNY1|PIRL1_ORYSJ Plant intracellular Ras-group-related LRR protein 1 OS=Oryza sativa subsp. japonica GN=IRL1 PE=2 SV=2 557 747 1.0E-11
sp|Q9S9Z7|P2C10_ARATH Probable protein phosphatase 2C 10 OS=Arabidopsis thaliana GN=At1g34750 PE=2 SV=1 1306 1462 1.0E-11
sp|Q921G6|LRCH4_MOUSE Leucine-rich repeat and calponin homology domain-containing protein 4 OS=Mus musculus GN=Lrch4 PE=1 SV=1 569 759 1.0E-11
sp|A2ARI4|LGR4_MOUSE Leucine-rich repeat-containing G-protein coupled receptor 4 OS=Mus musculus GN=Lgr4 PE=1 SV=1 713 1080 1.0E-11
sp|O49318|Y2317_ARATH Probable leucine-rich repeat receptor-like protein kinase At2g33170 OS=Arabidopsis thaliana GN=At2g33170 PE=2 SV=1 569 1086 1.0E-11
sp|Q8RX37|P2C02_ARATH Probable protein phosphatase 2C 2 OS=Arabidopsis thaliana GN=At1g07160 PE=2 SV=1 1285 1461 1.0E-11
sp|C0LGX3|HSL2_ARATH LRR receptor-like serine/threonine-protein kinase HSL2 OS=Arabidopsis thaliana GN=HSL2 PE=2 SV=1 556 930 1.0E-11
sp|Q5F4C4|SHOC2_CHICK Leucine-rich repeat protein SHOC-2 OS=Gallus gallus GN=SHOC2 PE=2 SV=1 544 753 2.0E-11
sp|Q5M8G4|LRC40_XENTR Leucine-rich repeat-containing protein 40 OS=Xenopus tropicalis GN=lrrc40 PE=2 SV=1 557 927 2.0E-11
sp|Q5M8G4|LRC40_XENTR Leucine-rich repeat-containing protein 40 OS=Xenopus tropicalis GN=lrrc40 PE=2 SV=1 869 1162 2.0E-11
sp|Q9FIZ3|GSO2_ARATH LRR receptor-like serine/threonine-protein kinase GSO2 OS=Arabidopsis thaliana GN=GSO2 PE=2 SV=2 661 1082 2.0E-11
sp|Q7L1W4|LRC8D_HUMAN Volume-regulated anion channel subunit LRRC8D OS=Homo sapiens GN=LRRC8D PE=1 SV=1 697 1073 2.0E-11
sp|Q9SD02|P2C47_ARATH Probable protein phosphatase 2C 47 OS=Arabidopsis thaliana GN=At3g51470 PE=1 SV=1 1275 1459 2.0E-11
sp|P40371|PP2C1_SCHPO Protein phosphatase 2C homolog 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ptc1 PE=2 SV=1 1309 1461 2.0E-11
sp|Q8IWT6|LRC8A_HUMAN Volume-regulated anion channel subunit LRRC8A OS=Homo sapiens GN=LRRC8A PE=1 SV=1 556 735 2.0E-11
sp|Q9Z2H4|LGR4_RAT Leucine-rich repeat-containing G-protein coupled receptor 4 OS=Rattus norvegicus GN=Lgr4 PE=2 SV=2 713 1080 2.0E-11
sp|Q5DU41|LRC8B_MOUSE Volume-regulated anion channel subunit LRRC8B OS=Mus musculus GN=Lrrc8b PE=1 SV=3 567 935 2.0E-11
sp|Q3TX51|LRC28_MOUSE Leucine-rich repeat-containing protein 28 OS=Mus musculus GN=Lrrc28 PE=2 SV=1 563 759 2.0E-11
sp|P34268|FLII_CAEEL Protein flightless-1 homolog OS=Caenorhabditis elegans GN=fli-1 PE=2 SV=2 609 936 3.0E-11
sp|Q8BGR2|LRC8D_MOUSE Volume-regulated anion channel subunit LRRC8D OS=Mus musculus GN=Lrrc8d PE=1 SV=1 697 1073 3.0E-11
sp|Q9SVW8|PIRL4_ARATH Plant intracellular Ras-group-related LRR protein 4 OS=Arabidopsis thaliana GN=PIRL4 PE=1 SV=1 860 1083 3.0E-11
sp|F1MT22|LGR5_BOVIN Leucine-rich repeat-containing G-protein coupled receptor 5 OS=Bos taurus GN=LGR5 PE=3 SV=2 713 1074 3.0E-11
sp|O08770|GPV_RAT Platelet glycoprotein V OS=Rattus norvegicus GN=Gp5 PE=3 SV=1 730 1057 3.0E-11
sp|Q80WG5|LRC8A_MOUSE Volume-regulated anion channel subunit LRRC8A OS=Mus musculus GN=Lrrc8a PE=1 SV=1 556 735 3.0E-11
sp|A0DSB3|PP2C6_PARTE Probable protein phosphatase 2C 6 OS=Paramecium tetraurelia GN=GSPATT00019634001 PE=3 SV=1 1308 1427 3.0E-11
sp|A8JAM0|DRC7_CHLRE Dynein regulatory complex subunit 7 (Fragment) OS=Chlamydomonas reinhardtii GN=DRC7 PE=1 SV=1 620 835 3.0E-11
sp|P22792|CPN2_HUMAN Carboxypeptidase N subunit 2 OS=Homo sapiens GN=CPN2 PE=1 SV=3 693 1063 3.0E-11
sp|Q09173|PP2C3_SCHPO Protein phosphatase 2C homolog 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ptc3 PE=3 SV=1 1308 1513 3.0E-11
sp|Q9LY03|IRK_ARATH Probable LRR receptor-like serine/threonine-protein kinase IRK OS=Arabidopsis thaliana GN=IRK PE=1 SV=1 604 936 4.0E-11
sp|Q9SVW8|PIRL4_ARATH Plant intracellular Ras-group-related LRR protein 4 OS=Arabidopsis thaliana GN=PIRL4 PE=1 SV=1 826 1082 4.0E-11
sp|Q5DU41|LRC8B_MOUSE Volume-regulated anion channel subunit LRRC8B OS=Mus musculus GN=Lrrc8b PE=1 SV=3 564 779 4.0E-11
sp|A8JAM0|DRC7_CHLRE Dynein regulatory complex subunit 7 (Fragment) OS=Chlamydomonas reinhardtii GN=DRC7 PE=1 SV=1 590 768 4.0E-11
sp|A0CUB5|PP2C5_PARTE Probable protein phosphatase 2C 5 OS=Paramecium tetraurelia GN=GSPATT00010582001 PE=3 SV=1 1301 1440 4.0E-11
sp|Q6GLE8|LRC28_XENTR Leucine-rich repeat-containing protein 28 OS=Xenopus tropicalis GN=lrrc28 PE=2 SV=1 563 759 4.0E-11
sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 549 1097 4.0E-11
sp|Q6XHA7|ROCO9_DICDI Probable serine/threonine-protein kinase roco9 OS=Dictyostelium discoideum GN=roco9 PE=3 SV=1 591 930 4.0E-11
sp|Q8W4Q3|PIRL3_ARATH Plant intracellular Ras-group-related LRR protein 3 OS=Arabidopsis thaliana GN=PIRL3 PE=2 SV=1 669 910 5.0E-11
sp|Q80X72|LRC15_MOUSE Leucine-rich repeat-containing protein 15 OS=Mus musculus GN=Lrrc15 PE=2 SV=1 826 1084 5.0E-11
sp|Q9SVW8|PIRL4_ARATH Plant intracellular Ras-group-related LRR protein 4 OS=Arabidopsis thaliana GN=PIRL4 PE=1 SV=1 677 906 5.0E-11
sp|Q9Z1P4|LGR5_MOUSE Leucine-rich repeat-containing G-protein coupled receptor 5 OS=Mus musculus GN=Lgr5 PE=2 SV=2 711 1060 5.0E-11
sp|B9F655|PIRL7_ORYSJ Plant intracellular Ras-group-related LRR protein 7 OS=Oryza sativa subsp. japonica GN=IRL7 PE=2 SV=1 696 904 5.0E-11
sp|Q67UP9|P2C58_ORYSJ Probable protein phosphatase 2C 58 OS=Oryza sativa subsp. japonica GN=Os06g0651600 PE=2 SV=1 1308 1427 5.0E-11
sp|Q8R5M3|LRC15_RAT Leucine-rich repeat-containing protein 15 OS=Rattus norvegicus GN=Lrrc15 PE=2 SV=1 798 1084 6.0E-11
sp|Q9LRV8|PIRL2_ARATH Plant intracellular Ras-group-related LRR protein 2 OS=Arabidopsis thaliana GN=PIRL2 PE=2 SV=1 473 764 6.0E-11
sp|Q9LYN8|EMS1_ARATH Leucine-rich repeat receptor protein kinase EMS1 OS=Arabidopsis thaliana GN=EMS1 PE=1 SV=1 556 1082 6.0E-11
sp|Q5U308|LRC8D_RAT Volume-regulated anion channel subunit LRRC8D OS=Rattus norvegicus GN=Lrrc8d PE=2 SV=1 518 735 7.0E-11
sp|B0M0P8|GEFL_DICDI Ras guanine nucleotide exchange factor L OS=Dictyostelium discoideum GN=gefL PE=2 SV=1 674 992 7.0E-11
sp|Q8L7I4|P2C17_ARATH Probable protein phosphatase 2C 17 OS=Arabidopsis thaliana GN=At1g78200 PE=2 SV=1 1176 1462 7.0E-11
sp|Q8VDB8|LRRC2_MOUSE Leucine-rich repeat-containing protein 2 OS=Mus musculus GN=Lrrc2 PE=2 SV=1 565 913 7.0E-11
sp|Q8GUQ5|BRI1_SOLLC Brassinosteroid LRR receptor kinase OS=Solanum lycopersicum GN=CURL3 PE=1 SV=1 612 1082 7.0E-11
sp|Q9FYN7|P2C02_ORYSJ Probable protein phosphatase 2C 2 OS=Oryza sativa subsp. japonica GN=Os01g0295700 PE=2 SV=1 1308 1459 7.0E-11
sp|Q8YA32|INLI_LISMO Internalin-I OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=inlI PE=3 SV=1 637 1151 8.0E-11
sp|Q6XHA7|ROCO9_DICDI Probable serine/threonine-protein kinase roco9 OS=Dictyostelium discoideum GN=roco9 PE=3 SV=1 768 1084 9.0E-11
sp|Q4R6F0|LRRD1_MACFA Leucine-rich repeat and death domain-containing protein 1 OS=Macaca fascicularis GN=LRRD1 PE=2 SV=1 847 1109 1.0E-10
sp|Q6ZH85|PIRL2_ORYSJ Plant intracellular Ras-group-related LRR protein 2 OS=Oryza sativa subsp. japonica GN=IRL2 PE=2 SV=1 567 766 1.0E-10
sp|Q9DBB9|CPN2_MOUSE Carboxypeptidase N subunit 2 OS=Mus musculus GN=Cpn2 PE=1 SV=2 567 769 1.0E-10
sp|Q5U308|LRC8D_RAT Volume-regulated anion channel subunit LRRC8D OS=Rattus norvegicus GN=Lrrc8d PE=2 SV=1 607 919 1.0E-10
sp|Q5U308|LRC8D_RAT Volume-regulated anion channel subunit LRRC8D OS=Rattus norvegicus GN=Lrrc8d PE=2 SV=1 697 1073 1.0E-10
sp|Q7L1W4|LRC8D_HUMAN Volume-regulated anion channel subunit LRRC8D OS=Homo sapiens GN=LRRC8D PE=1 SV=1 556 735 1.0E-10
sp|Q7XNY1|PIRL1_ORYSJ Plant intracellular Ras-group-related LRR protein 1 OS=Oryza sativa subsp. japonica GN=IRL1 PE=2 SV=2 637 812 1.0E-10
sp|F1MLX5|LGR4_BOVIN Leucine-rich repeat-containing G-protein coupled receptor 4 OS=Bos taurus GN=LGR4 PE=3 SV=3 690 1080 1.0E-10
sp|Q14392|LRC32_HUMAN Leucine-rich repeat-containing protein 32 OS=Homo sapiens GN=LRRC32 PE=1 SV=1 568 1061 1.0E-10
sp|F1LNI5|PPM1G_RAT Protein phosphatase 1G OS=Rattus norvegicus GN=Ppm1g PE=1 SV=2 1308 1427 1.0E-10
sp|Q61074|PPM1G_MOUSE Protein phosphatase 1G OS=Mus musculus GN=Ppm1g PE=1 SV=3 1308 1427 1.0E-10
sp|Q6AYI5|SHOC2_RAT Leucine-rich repeat protein SHOC-2 OS=Rattus norvegicus GN=Shoc2 PE=2 SV=1 557 759 2.0E-10
sp|A6QLV3|SHOC2_BOVIN Leucine-rich repeat protein SHOC-2 OS=Bos taurus GN=SHOC2 PE=2 SV=1 557 759 2.0E-10
sp|Q5RAV5|SHOC2_PONAB Leucine-rich repeat protein SHOC-2 OS=Pongo abelii GN=SHOC2 PE=2 SV=2 557 759 2.0E-10
sp|Q9UQ13|SHOC2_HUMAN Leucine-rich repeat protein SHOC-2 OS=Homo sapiens GN=SHOC2 PE=1 SV=2 557 759 2.0E-10
sp|F1MCA7|LRRC7_BOVIN Leucine-rich repeat-containing protein 7 OS=Bos taurus GN=LRRC7 PE=3 SV=3 826 1090 2.0E-10
sp|B4PU77|SUR8_DROYA Leucine-rich repeat protein soc-2 homolog OS=Drosophila yakuba GN=Sur-8 PE=3 SV=1 557 781 2.0E-10
sp|Q9VEK6|SUR8_DROME Leucine-rich repeat protein soc-2 homolog OS=Drosophila melanogaster GN=Sur-8 PE=2 SV=3 557 781 2.0E-10
sp|Q7L1W4|LRC8D_HUMAN Volume-regulated anion channel subunit LRRC8D OS=Homo sapiens GN=LRRC8D PE=1 SV=1 607 919 2.0E-10
sp|C0LGX3|HSL2_ARATH LRR receptor-like serine/threonine-protein kinase HSL2 OS=Arabidopsis thaliana GN=HSL2 PE=2 SV=1 663 1082 2.0E-10
sp|Q6NU09|LRC8E_XENLA Volume-regulated anion channel subunit LRRC8E OS=Xenopus laevis GN=lrrc8e PE=2 SV=1 518 735 2.0E-10
sp|Q4R4V2|PPM1G_MACFA Protein phosphatase 1G OS=Macaca fascicularis GN=PPM1G PE=2 SV=1 1308 1427 2.0E-10
sp|Q8L899|BRI1_SOLPE Systemin receptor SR160 OS=Solanum peruvianum PE=1 SV=1 638 1082 2.0E-10
sp|Q9LJF3|BRL3_ARATH Receptor-like protein kinase BRI1-like 3 OS=Arabidopsis thaliana GN=BRL3 PE=1 SV=1 607 1082 2.0E-10
sp|O15355|PPM1G_HUMAN Protein phosphatase 1G OS=Homo sapiens GN=PPM1G PE=1 SV=1 1308 1427 2.0E-10
sp|Q6DHL5|LRC57_DANRE Leucine-rich repeat-containing protein 57 OS=Danio rerio GN=lrrc57 PE=2 SV=1 659 766 2.0E-10
sp|P79126|PPM1G_BOVIN Protein phosphatase 1G OS=Bos taurus GN=PPM1G PE=2 SV=2 1308 1427 2.0E-10
sp|Q6ING9|PPM1K_XENLA Protein phosphatase 1K, mitochondrial OS=Xenopus laevis GN=ppm1k PE=2 SV=1 1299 1459 2.0E-10
sp|Q96NW7|LRRC7_HUMAN Leucine-rich repeat-containing protein 7 OS=Homo sapiens GN=LRRC7 PE=1 SV=1 556 765 3.0E-10
sp|Q1L8Y7|SHOC2_DANRE Leucine-rich repeat protein SHOC-2 OS=Danio rerio GN=shoc2 PE=2 SV=1 569 757 3.0E-10
sp|B4IBI9|SUR8_DROSE Leucine-rich repeat protein soc-2 homolog OS=Drosophila sechellia GN=Sur-8 PE=3 SV=1 557 781 3.0E-10
sp|B4QVR7|SUR8_DROSI Leucine-rich repeat protein soc-2 homolog OS=Drosophila simulans GN=Sur-8 PE=3 SV=2 557 781 3.0E-10
sp|Q8BGR2|LRC8D_MOUSE Volume-regulated anion channel subunit LRRC8D OS=Mus musculus GN=Lrrc8d PE=1 SV=1 556 735 3.0E-10
sp|O75427|LRCH4_HUMAN Leucine-rich repeat and calponin homology domain-containing protein 4 OS=Homo sapiens GN=LRCH4 PE=1 SV=2 609 863 3.0E-10
sp|Q9HB75|PIDD1_HUMAN p53-induced death domain-containing protein 1 OS=Homo sapiens GN=PIDD1 PE=1 SV=2 624 788 3.0E-10
sp|Q7XDQ7|PIRL8_ORYSJ Plant intracellular Ras-group-related LRR protein 8 OS=Oryza sativa subsp. japonica GN=IRL8 PE=2 SV=1 594 769 3.0E-10
sp|Q8K3W2|LRC10_MOUSE Leucine-rich repeat-containing protein 10 OS=Mus musculus GN=Lrrc10 PE=1 SV=1 620 786 3.0E-10
sp|Q8BGA3|LRRT2_MOUSE Leucine-rich repeat transmembrane neuronal protein 2 OS=Mus musculus GN=Lrrtm2 PE=2 SV=1 783 1080 3.0E-10
sp|Q55CS8|MPL2_DICDI MAP kinase phosphatase with leucine-rich repeats protein 2 OS=Dictyostelium discoideum GN=mpl2 PE=3 SV=2 664 864 3.0E-10
sp|Q96NW7|LRRC7_HUMAN Leucine-rich repeat-containing protein 7 OS=Homo sapiens GN=LRRC7 PE=1 SV=1 557 769 4.0E-10
sp|P70587|LRRC7_RAT Leucine-rich repeat-containing protein 7 OS=Rattus norvegicus GN=Lrrc7 PE=1 SV=2 556 765 4.0E-10
sp|Q80TE7|LRRC7_MOUSE Leucine-rich repeat-containing protein 7 OS=Mus musculus GN=Lrrc7 PE=1 SV=2 556 765 4.0E-10
sp|Q96DD0|LRC39_HUMAN Leucine-rich repeat-containing protein 39 OS=Homo sapiens GN=LRRC39 PE=2 SV=1 570 773 4.0E-10
sp|Q8BGR2|LRC8D_MOUSE Volume-regulated anion channel subunit LRRC8D OS=Mus musculus GN=Lrrc8d PE=1 SV=1 607 919 4.0E-10
sp|Q921G6|LRCH4_MOUSE Leucine-rich repeat and calponin homology domain-containing protein 4 OS=Mus musculus GN=Lrch4 PE=1 SV=1 609 863 4.0E-10
sp|Q6XHA7|ROCO9_DICDI Probable serine/threonine-protein kinase roco9 OS=Dictyostelium discoideum GN=roco9 PE=3 SV=1 640 929 4.0E-10
sp|Q9HB75|PIDD1_HUMAN p53-induced death domain-containing protein 1 OS=Homo sapiens GN=PIDD1 PE=1 SV=2 598 769 4.0E-10
sp|Q68F79|LRC8E_XENTR Volume-regulated anion channel subunit LRRC8E OS=Xenopus tropicalis GN=lrrc8e PE=2 SV=1 556 735 4.0E-10
sp|A0DTY1|PP2C4_PARTE Probable protein phosphatase 2C 4 OS=Paramecium tetraurelia GN=GSPATT00020181001 PE=3 SV=1 1233 1422 4.0E-10
sp|F7D3V9|LGR5_XENTR Leucine-rich repeat-containing G-protein coupled receptor 5 OS=Xenopus tropicalis GN=lgr5 PE=2 SV=2 564 937 4.0E-10
sp|Q93YW5|P2C58_ARATH Probable protein phosphatase 2C 58 OS=Arabidopsis thaliana GN=At4g28400 PE=2 SV=1 1305 1461 4.0E-10
sp|Q7XU84|P2C42_ORYSJ Probable protein phosphatase 2C 42 OS=Oryza sativa subsp. japonica GN=Os04g0500900 PE=3 SV=4 1309 1461 4.0E-10
sp|Q5RF01|LRC32_PONAB Leucine-rich repeat-containing protein 32 OS=Pongo abelii GN=LRRC32 PE=2 SV=1 568 1061 4.0E-10
sp|F1MCA7|LRRC7_BOVIN Leucine-rich repeat-containing protein 7 OS=Bos taurus GN=LRRC7 PE=3 SV=3 556 765 5.0E-10
sp|Q8BGI7|LRC39_MOUSE Leucine-rich repeat-containing protein 39 OS=Mus musculus GN=Lrrc39 PE=1 SV=1 570 790 5.0E-10
sp|P82963|CHAO_TRICA Chaoptin (Fragment) OS=Tribolium castaneum GN=CHP PE=2 SV=1 588 1079 5.0E-10
sp|O08742|GPV_MOUSE Platelet glycoprotein V OS=Mus musculus GN=Gp5 PE=1 SV=1 730 1057 5.0E-10
sp|Q9ZPS9|BRL2_ARATH Serine/threonine-protein kinase BRI1-like 2 OS=Arabidopsis thaliana GN=BRL2 PE=1 SV=1 577 1086 5.0E-10
sp|Q5S006|LRRK2_MOUSE Leucine-rich repeat serine/threonine-protein kinase 2 OS=Mus musculus GN=Lrrk2 PE=1 SV=2 641 958 5.0E-10
sp|O43300|LRRT2_HUMAN Leucine-rich repeat transmembrane neuronal protein 2 OS=Homo sapiens GN=LRRTM2 PE=2 SV=3 783 1080 5.0E-10
sp|Q6NSJ5|LRC8E_HUMAN Volume-regulated anion channel subunit LRRC8E OS=Homo sapiens GN=LRRC8E PE=1 SV=2 580 779 5.0E-10
sp|Q7XQU7|P2C41_ORYSJ Probable protein phosphatase 2C 41 OS=Oryza sativa subsp. japonica GN=Os04g0452000 PE=2 SV=2 1314 1462 5.0E-10
sp|Q3UHC2|LRRK1_MOUSE Leucine-rich repeat serine/threonine-protein kinase 1 OS=Mus musculus GN=Lrrk1 PE=1 SV=1 570 913 5.0E-10
sp|Q6AYI5|SHOC2_RAT Leucine-rich repeat protein SHOC-2 OS=Rattus norvegicus GN=Shoc2 PE=2 SV=1 569 747 6.0E-10
sp|O88520|SHOC2_MOUSE Leucine-rich repeat protein SHOC-2 OS=Mus musculus GN=Shoc2 PE=1 SV=2 557 759 6.0E-10
sp|O88520|SHOC2_MOUSE Leucine-rich repeat protein SHOC-2 OS=Mus musculus GN=Shoc2 PE=1 SV=2 569 747 6.0E-10
sp|A6QLV3|SHOC2_BOVIN Leucine-rich repeat protein SHOC-2 OS=Bos taurus GN=SHOC2 PE=2 SV=1 569 747 6.0E-10
sp|C0LGV1|RCH1_ARATH LRR receptor-like serine/threonine-protein kinase RCH1 OS=Arabidopsis thaliana GN=RCH1 PE=2 SV=1 628 1110 6.0E-10
sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 557 1080 6.0E-10
sp|D0ZRB2|SLRP_SALT1 E3 ubiquitin-protein ligase SlrP OS=Salmonella typhimurium (strain 14028s / SGSC 2262) GN=slrP PE=1 SV=1 661 867 6.0E-10
sp|Q8ZQQ2|SLRP_SALTY E3 ubiquitin-protein ligase SlrP OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=slrP PE=1 SV=1 661 867 6.0E-10
sp|D4A7P2|LRRT2_RAT Leucine-rich repeat transmembrane neuronal protein 2 OS=Rattus norvegicus GN=Lrrtm2 PE=1 SV=1 783 1080 6.0E-10
sp|Q723X5|INLI_LISMF Internalin-I OS=Listeria monocytogenes serotype 4b (strain F2365) GN=inlI PE=3 SV=1 637 1080 6.0E-10
sp|Q5RAV5|SHOC2_PONAB Leucine-rich repeat protein SHOC-2 OS=Pongo abelii GN=SHOC2 PE=2 SV=2 569 747 7.0E-10
sp|Q9UQ13|SHOC2_HUMAN Leucine-rich repeat protein SHOC-2 OS=Homo sapiens GN=SHOC2 PE=1 SV=2 569 747 7.0E-10
sp|B4N9T4|SUR8_DROWI Leucine-rich repeat protein soc-2 homolog OS=Drosophila willistoni GN=Sur-8 PE=3 SV=1 544 766 7.0E-10
sp|Q5M8G4|LRC40_XENTR Leucine-rich repeat-containing protein 40 OS=Xenopus tropicalis GN=lrrc40 PE=2 SV=1 556 927 7.0E-10
sp|E7FE13|LGR4_DANRE Leucine-rich repeat-containing G-protein coupled receptor 4 OS=Danio rerio GN=lgr4 PE=2 SV=1 552 850 7.0E-10
sp|B9F655|PIRL7_ORYSJ Plant intracellular Ras-group-related LRR protein 7 OS=Oryza sativa subsp. japonica GN=IRL7 PE=2 SV=1 591 769 7.0E-10
sp|Q9BYS8|LRRC2_HUMAN Leucine-rich repeat-containing protein 2 OS=Homo sapiens GN=LRRC2 PE=2 SV=2 676 913 7.0E-10
sp|Q9BXB1|LGR4_HUMAN Leucine-rich repeat-containing G-protein coupled receptor 4 OS=Homo sapiens GN=LGR4 PE=1 SV=2 713 1075 7.0E-10
sp|Q9LMT1|P2C08_ARATH Probable protein phosphatase 2C 8 OS=Arabidopsis thaliana GN=At1g18030 PE=2 SV=2 1303 1425 7.0E-10
sp|P35858|ALS_HUMAN Insulin-like growth factor-binding protein complex acid labile subunit OS=Homo sapiens GN=IGFALS PE=1 SV=1 568 940 7.0E-10
sp|P70587|LRRC7_RAT Leucine-rich repeat-containing protein 7 OS=Rattus norvegicus GN=Lrrc7 PE=1 SV=2 826 1090 8.0E-10
sp|Q80TE7|LRRC7_MOUSE Leucine-rich repeat-containing protein 7 OS=Mus musculus GN=Lrrc7 PE=1 SV=2 826 1090 8.0E-10
sp|Q55FD8|GEFV_DICDI Ras guanine nucleotide exchange factor V OS=Dictyostelium discoideum GN=gefV PE=2 SV=1 613 933 8.0E-10
sp|A6NM36|LRC30_HUMAN Leucine-rich repeat-containing protein 30 OS=Homo sapiens GN=LRRC30 PE=4 SV=1 572 750 8.0E-10
sp|Q3ZC49|LRC39_BOVIN Leucine-rich repeat-containing protein 39 OS=Bos taurus GN=LRRC39 PE=2 SV=1 570 773 9.0E-10
sp|Q8AVI4|SHOC2_XENLA Leucine-rich repeat protein SHOC-2 OS=Xenopus laevis GN=shoc2 PE=2 SV=1 569 747 1.0E-09
sp|B0W6M9|SUR8_CULQU Leucine-rich repeat protein soc-2 homolog OS=Culex quinquefasciatus GN=Sur-8 PE=3 SV=1 542 787 1.0E-09
sp|Q96NW7|LRRC7_HUMAN Leucine-rich repeat-containing protein 7 OS=Homo sapiens GN=LRRC7 PE=1 SV=1 826 1090 1.0E-09
sp|Q9FFJ3|PIRL1_ARATH Plant intracellular Ras-group-related LRR protein 1 OS=Arabidopsis thaliana GN=PIRL1 PE=2 SV=1 521 764 1.0E-09
sp|Q8BGI7|LRC39_MOUSE Leucine-rich repeat-containing protein 39 OS=Mus musculus GN=Lrrc39 PE=1 SV=1 834 1086 1.0E-09
sp|Q5S006|LRRK2_MOUSE Leucine-rich repeat serine/threonine-protein kinase 2 OS=Mus musculus GN=Lrrk2 PE=1 SV=2 825 1080 1.0E-09
sp|Q9LHP4|RCH2_ARATH Receptor-like protein kinase 2 OS=Arabidopsis thaliana GN=RCH2 PE=1 SV=1 612 1119 1.0E-09
sp|A5PK13|LRC8C_BOVIN Volume-regulated anion channel subunit LRRC8C OS=Bos taurus GN=LRRC8C PE=2 SV=1 606 796 1.0E-09
sp|Q6AUQ4|P2C47_ORYSJ Probable protein phosphatase 2C 47 OS=Oryza sativa subsp. japonica GN=Os05g0134200 PE=2 SV=1 1308 1459 1.0E-09
sp|Q8TDW0|LRC8C_HUMAN Volume-regulated anion channel subunit LRRC8C OS=Homo sapiens GN=LRRC8C PE=1 SV=2 606 796 1.0E-09
sp|Q6UXM1|LRIG3_HUMAN Leucine-rich repeats and immunoglobulin-like domains protein 3 OS=Homo sapiens GN=LRIG3 PE=2 SV=1 612 909 1.0E-09
sp|Q9C9H7|RLP12_ARATH Receptor-like protein 12 OS=Arabidopsis thaliana GN=RLP12 PE=2 SV=2 621 1086 1.0E-09
sp|Q5SMK6|P2C54_ORYSJ Probable protein phosphatase 2C 54 OS=Oryza sativa subsp. japonica GN=Os06g0179700 PE=2 SV=1 1244 1459 1.0E-09
sp|D4AC13|LGR5_RAT Leucine-rich repeat-containing G-protein coupled receptor 5 OS=Rattus norvegicus GN=Lgr5 PE=3 SV=1 713 1060 1.0E-09
sp|Q8W4Q3|PIRL3_ARATH Plant intracellular Ras-group-related LRR protein 3 OS=Arabidopsis thaliana GN=PIRL3 PE=2 SV=1 873 1083 2.0E-09
sp|Q8RWE5|PIRL8_ARATH Plant intracellular Ras-group-related LRR protein 8 OS=Arabidopsis thaliana GN=PIRL8 PE=2 SV=1 556 747 2.0E-09
sp|O64566|PIRL6_ARATH Plant intracellular Ras-group-related LRR protein 6 OS=Arabidopsis thaliana GN=PIRL6 PE=2 SV=1 777 1066 2.0E-09
sp|Q4V8I7|LRC8A_RAT Volume-regulated anion channel subunit LRRC8A OS=Rattus norvegicus GN=Lrrc8a PE=1 SV=1 628 919 2.0E-09
sp|Q4V8I7|LRC8A_RAT Volume-regulated anion channel subunit LRRC8A OS=Rattus norvegicus GN=Lrrc8a PE=1 SV=1 606 779 2.0E-09
sp|Q8IWT6|LRC8A_HUMAN Volume-regulated anion channel subunit LRRC8A OS=Homo sapiens GN=LRRC8A PE=1 SV=1 606 779 2.0E-09
sp|Q8IWT6|LRC8A_HUMAN Volume-regulated anion channel subunit LRRC8A OS=Homo sapiens GN=LRRC8A PE=1 SV=1 628 919 2.0E-09
sp|Q80WG5|LRC8A_MOUSE Volume-regulated anion channel subunit LRRC8A OS=Mus musculus GN=Lrrc8a PE=1 SV=1 606 779 2.0E-09
sp|Q9LYN8|EMS1_ARATH Leucine-rich repeat receptor protein kinase EMS1 OS=Arabidopsis thaliana GN=EMS1 PE=1 SV=1 557 1086 2.0E-09
sp|Q9XEE8|P2C30_ARATH Probable protein phosphatase 2C 30 OS=Arabidopsis thaliana GN=PP2C5 PE=2 SV=1 1306 1464 2.0E-09
sp|Q9LNF4|P2C13_ARATH Probable protein phosphatase 2C 13 OS=Arabidopsis thaliana GN=At1g48040 PE=2 SV=2 1210 1459 2.0E-09
sp|O02833|ALS_PAPHA Insulin-like growth factor-binding protein complex acid labile subunit OS=Papio hamadryas GN=IGFALS PE=2 SV=1 557 936 2.0E-09
sp|Q9SHI2|Y1723_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230 OS=Arabidopsis thaliana GN=At1g17230 PE=2 SV=2 664 1082 2.0E-09
sp|Q3KRC6|LRC8E_RAT Volume-regulated anion channel subunit LRRC8E OS=Rattus norvegicus GN=Lrrc8e PE=2 SV=1 580 756 2.0E-09
sp|Q6UWE0|LRSM1_HUMAN E3 ubiquitin-protein ligase LRSAM1 OS=Homo sapiens GN=LRSAM1 PE=1 SV=1 808 933 2.0E-09
sp|Q66JT1|LRC8E_MOUSE Volume-regulated anion channel subunit LRRC8E OS=Mus musculus GN=Lrrc8e PE=2 SV=2 518 757 2.0E-09
sp|Q8RZV7|MSP1_ORYSJ Leucine-rich repeat receptor protein kinase MSP1 OS=Oryza sativa subsp. japonica GN=MSP1 PE=1 SV=1 564 1146 2.0E-09
sp|Q80VQ1|LRRC1_MOUSE Leucine-rich repeat-containing protein 1 OS=Mus musculus GN=Lrrc1 PE=1 SV=2 556 769 3.0E-09
sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 798 1086 3.0E-09
sp|Q55E58|PATS1_DICDI Probable serine/threonine-protein kinase pats1 OS=Dictyostelium discoideum GN=pats1 PE=3 SV=1 824 1082 3.0E-09
sp|P0DM44|LGR6_DANRE Leucine-rich repeat-containing G-protein coupled receptor 6 OS=Danio rerio GN=lgr6 PE=2 SV=1 687 1074 3.0E-09
sp|P82963|CHAO_TRICA Chaoptin (Fragment) OS=Tribolium castaneum GN=CHP PE=2 SV=1 562 938 3.0E-09
sp|Q6K7R2|PIRL6_ORYSJ Plant intracellular Ras-group-related LRR protein 6 OS=Oryza sativa subsp. japonica GN=IRL6 PE=2 SV=1 567 824 3.0E-09
sp|O49318|Y2317_ARATH Probable leucine-rich repeat receptor-like protein kinase At2g33170 OS=Arabidopsis thaliana GN=At2g33170 PE=2 SV=1 668 1061 3.0E-09
sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 703 1082 3.0E-09
sp|F7D3V9|LGR5_XENTR Leucine-rich repeat-containing G-protein coupled receptor 5 OS=Xenopus tropicalis GN=lgr5 PE=2 SV=2 713 1074 3.0E-09
sp|Q9WVR7|PPM1F_RAT Protein phosphatase 1F OS=Rattus norvegicus GN=Ppm1f PE=2 SV=1 1307 1463 3.0E-09
sp|Q5BKY1|LRC10_HUMAN Leucine-rich repeat-containing protein 10 OS=Homo sapiens GN=LRRC10 PE=2 SV=1 620 786 3.0E-09
sp|A6NIK2|LR10B_HUMAN Leucine-rich repeat-containing protein 10B OS=Homo sapiens GN=LRRC10B PE=4 SV=2 617 788 3.0E-09
sp|Q9ERV7|PIDD1_MOUSE p53-induced death domain-containing protein 1 OS=Mus musculus GN=Pidd1 PE=1 SV=1 611 769 3.0E-09
sp|Q5S007|LRRK2_HUMAN Leucine-rich repeat serine/threonine-protein kinase 2 OS=Homo sapiens GN=LRRK2 PE=1 SV=2 641 896 3.0E-09
sp|Q9DBY4|TRIL_MOUSE TLR4 interactor with leucine rich repeats OS=Mus musculus GN=Tril PE=2 SV=1 836 1080 3.0E-09
sp|Q3URE9|LIGO2_MOUSE Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 2 OS=Mus musculus GN=Lingo2 PE=2 SV=1 741 1080 3.0E-09
sp|Q7KRY7|LAP4_DROME Protein lap4 OS=Drosophila melanogaster GN=scrib PE=1 SV=1 816 1082 4.0E-09
sp|Q55E58|PATS1_DICDI Probable serine/threonine-protein kinase pats1 OS=Dictyostelium discoideum GN=pats1 PE=3 SV=1 775 1080 4.0E-09
sp|A6NIV6|LRIQ4_HUMAN Leucine-rich repeat and IQ domain-containing protein 4 OS=Homo sapiens GN=LRRIQ4 PE=3 SV=2 713 1080 4.0E-09
sp|E7FE13|LGR4_DANRE Leucine-rich repeat-containing G-protein coupled receptor 4 OS=Danio rerio GN=lgr4 PE=2 SV=1 803 1157 4.0E-09
sp|Q80WG5|LRC8A_MOUSE Volume-regulated anion channel subunit LRRC8A OS=Mus musculus GN=Lrrc8a PE=1 SV=1 628 919 4.0E-09
sp|Q9HB75|PIDD1_HUMAN p53-induced death domain-containing protein 1 OS=Homo sapiens GN=PIDD1 PE=1 SV=2 809 934 4.0E-09
sp|O02833|ALS_PAPHA Insulin-like growth factor-binding protein complex acid labile subunit OS=Papio hamadryas GN=IGFALS PE=2 SV=1 568 940 4.0E-09
sp|Q9D9Q0|LRC69_MOUSE Leucine-rich repeat-containing protein 69 OS=Mus musculus GN=Lrrc69 PE=2 SV=1 882 1083 4.0E-09
sp|Q3UMG5|LRCH2_MOUSE Leucine-rich repeat and calponin homology domain-containing protein 2 OS=Mus musculus GN=Lrch2 PE=2 SV=2 566 757 4.0E-09
sp|Q149C3|LIGO4_MOUSE Leucine-rich repeat and immunoglobulin-like domain containing-NOGO receptor-interacting protein 4 OS=Mus musculus GN=Lingo4 PE=2 SV=2 825 1062 4.0E-09
sp|Q38SD2|LRRK1_HUMAN Leucine-rich repeat serine/threonine-protein kinase 1 OS=Homo sapiens GN=LRRK1 PE=1 SV=3 570 913 4.0E-09
sp|Q5G5E0|PIRL5_ARATH Plant intracellular Ras-group-related LRR protein 5 OS=Arabidopsis thaliana GN=PIRL5 PE=2 SV=1 518 769 5.0E-09
sp|Q9CRC8|LRC40_MOUSE Leucine-rich repeat-containing protein 40 OS=Mus musculus GN=Lrrc40 PE=1 SV=2 557 927 5.0E-09
sp|P35858|ALS_HUMAN Insulin-like growth factor-binding protein complex acid labile subunit OS=Homo sapiens GN=IGFALS PE=1 SV=1 720 1084 5.0E-09
sp|P0C895|Y2010_ARATH LRR repeats and ubiquitin-like domain-containing protein At2g30105 OS=Arabidopsis thaliana GN=At2g30105 PE=1 SV=1 796 933 5.0E-09
sp|Q5VUJ6|LRCH2_HUMAN Leucine-rich repeat and calponin homology domain-containing protein 2 OS=Homo sapiens GN=LRCH2 PE=2 SV=2 570 757 5.0E-09
sp|Q0D673|P2C62_ORYSJ Probable protein phosphatase 2C 62 OS=Oryza sativa subsp. japonica GN=Os07g0507000 PE=2 SV=1 1322 1461 5.0E-09
sp|Q7SXW3|LRC40_DANRE Leucine-rich repeat-containing protein 40 OS=Danio rerio GN=lrrc40 PE=2 SV=1 525 745 6.0E-09
sp|Q6P1C6|LRIG3_MOUSE Leucine-rich repeats and immunoglobulin-like domains protein 3 OS=Mus musculus GN=Lrig3 PE=1 SV=1 611 909 6.0E-09
sp|Q9LUU7|P2C43_ARATH Probable protein phosphatase 2C 43 OS=Arabidopsis thaliana GN=At3g17250 PE=2 SV=1 1305 1459 6.0E-09
sp|Q9FRS6|PXL1_ARATH Leucine-rich repeat receptor-like protein kinase PXL1 OS=Arabidopsis thaliana GN=PXL1 PE=1 SV=1 633 1086 6.0E-09
sp|Q8CGA0|PPM1F_MOUSE Protein phosphatase 1F OS=Mus musculus GN=Ppm1f PE=1 SV=1 1307 1463 6.0E-09
sp|A7SFP1|SHOC2_NEMVE Leucine-rich repeat protein soc-2 homolog OS=Nematostella vectensis GN=v1g189306 PE=3 SV=1 543 765 7.0E-09
sp|Q80VQ1|LRRC1_MOUSE Leucine-rich repeat-containing protein 1 OS=Mus musculus GN=Lrrc1 PE=1 SV=2 557 781 7.0E-09
sp|P35858|ALS_HUMAN Insulin-like growth factor-binding protein complex acid labile subunit OS=Homo sapiens GN=IGFALS PE=1 SV=1 558 936 7.0E-09
sp|Q9M2Z1|BAME2_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM2 OS=Arabidopsis thaliana GN=BAM2 PE=1 SV=1 633 1080 7.0E-09
sp|Q9SSL9|PEPR1_ARATH Leucine-rich repeat receptor-like protein kinase PEPR1 OS=Arabidopsis thaliana GN=PEPR1 PE=1 SV=1 692 1082 7.0E-09
sp|Q6UY18|LIGO4_HUMAN Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 4 OS=Homo sapiens GN=LINGO4 PE=2 SV=1 802 1062 7.0E-09
sp|Q55FD8|GEFV_DICDI Ras guanine nucleotide exchange factor V OS=Dictyostelium discoideum GN=gefV PE=2 SV=1 567 756 8.0E-09
sp|Q9SIU8|P2C20_ARATH Probable protein phosphatase 2C 20 OS=Arabidopsis thaliana GN=PPC3-1.2 PE=1 SV=3 1197 1458 8.0E-09
sp|Q8R502|LRC8C_MOUSE Volume-regulated anion channel subunit LRRC8C OS=Mus musculus GN=Lrrc8c PE=1 SV=1 606 796 8.0E-09
sp|Q9VJ07|PHLPP_DROME Protein phosphatase PHLPP-like protein OS=Drosophila melanogaster GN=Phlpp PE=3 SV=1 643 928 9.0E-09
sp|Q9BYS8|LRRC2_HUMAN Leucine-rich repeat-containing protein 2 OS=Homo sapiens GN=LRRC2 PE=2 SV=2 569 756 9.0E-09
sp|Q10MX1|P2C32_ORYSJ Probable protein phosphatase 2C 32 OS=Oryza sativa subsp. japonica GN=Os03g0292100 PE=2 SV=1 1309 1464 9.0E-09
sp|Q6XAT2|ERL2_ARATH LRR receptor-like serine/threonine-protein kinase ERL2 OS=Arabidopsis thaliana GN=ERL2 PE=2 SV=1 672 1082 9.0E-09
sp|Q6INV3|LRC57_XENLA Leucine-rich repeat-containing protein 57 OS=Xenopus laevis GN=lrrc57 PE=2 SV=1 664 790 9.0E-09
sp|Q6Z8P4|PIRL4_ORYSJ Plant intracellular Ras-group-related LRR protein 4 OS=Oryza sativa subsp. japonica GN=IRL4 PE=2 SV=1 557 790 1.0E-08
sp|Q8W4Q3|PIRL3_ARATH Plant intracellular Ras-group-related LRR protein 3 OS=Arabidopsis thaliana GN=PIRL3 PE=2 SV=1 729 933 1.0E-08
sp|P93194|RPK1_IPONI Receptor-like protein kinase OS=Ipomoea nil GN=INRPK1 PE=2 SV=2 661 1082 1.0E-08
sp|Q9CRC8|LRC40_MOUSE Leucine-rich repeat-containing protein 40 OS=Mus musculus GN=Lrrc40 PE=1 SV=2 679 1080 1.0E-08
sp|A6NIV6|LRIQ4_HUMAN Leucine-rich repeat and IQ domain-containing protein 4 OS=Homo sapiens GN=LRRIQ4 PE=3 SV=2 690 1083 1.0E-08
sp|Q5U308|LRC8D_RAT Volume-regulated anion channel subunit LRRC8D OS=Rattus norvegicus GN=Lrrc8d PE=2 SV=1 650 933 1.0E-08
sp|Q6P9F7|LRC8B_HUMAN Volume-regulated anion channel subunit LRRC8B OS=Homo sapiens GN=LRRC8B PE=1 SV=2 564 781 1.0E-08
sp|P22792|CPN2_HUMAN Carboxypeptidase N subunit 2 OS=Homo sapiens GN=CPN2 PE=1 SV=3 594 867 1.0E-08
sp|Q7XDQ7|PIRL8_ORYSJ Plant intracellular Ras-group-related LRR protein 8 OS=Oryza sativa subsp. japonica GN=IRL8 PE=2 SV=1 796 933 1.0E-08
sp|Q7XDQ7|PIRL8_ORYSJ Plant intracellular Ras-group-related LRR protein 8 OS=Oryza sativa subsp. japonica GN=IRL8 PE=2 SV=1 778 933 1.0E-08
sp|D4AC13|LGR5_RAT Leucine-rich repeat-containing G-protein coupled receptor 5 OS=Rattus norvegicus GN=Lgr5 PE=3 SV=1 570 937 1.0E-08
sp|Q9SHI2|Y1723_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230 OS=Arabidopsis thaliana GN=At1g17230 PE=2 SV=2 664 1086 1.0E-08
sp|Q3KRC6|LRC8E_RAT Volume-regulated anion channel subunit LRRC8E OS=Rattus norvegicus GN=Lrrc8e PE=2 SV=1 518 757 1.0E-08
sp|Q8RZV7|MSP1_ORYSJ Leucine-rich repeat receptor protein kinase MSP1 OS=Oryza sativa subsp. japonica GN=MSP1 PE=1 SV=1 556 1086 1.0E-08
sp|Q6INV3|LRC57_XENLA Leucine-rich repeat-containing protein 57 OS=Xenopus laevis GN=lrrc57 PE=2 SV=1 974 1080 1.0E-08
sp|Q498T9|LRC8C_RAT Volume-regulated anion channel subunit LRRC8C OS=Rattus norvegicus GN=Lrrc8c PE=1 SV=1 606 796 1.0E-08
sp|Q496Z2|TRIL_RAT TLR4 interactor with leucine rich repeats OS=Rattus norvegicus GN=Tril PE=1 SV=1 836 1080 1.0E-08
sp|Q54TM7|DRKD_DICDI Probable serine/threonine-protein kinase drkD OS=Dictyostelium discoideum GN=drkD PE=2 SV=1 603 757 1.0E-08
sp|Q15404|RSU1_HUMAN Ras suppressor protein 1 OS=Homo sapiens GN=RSU1 PE=1 SV=3 870 1069 1.0E-08
sp|Q1ZXD6|ROCO5_DICDI Probable serine/threonine-protein kinase roco5 OS=Dictyostelium discoideum GN=roco5 PE=3 SV=1 661 927 1.0E-08
sp|Q9LJM4|IKU2_ARATH Receptor-like protein kinase HAIKU2 OS=Arabidopsis thaliana GN=IKU2 PE=1 SV=1 603 1086 1.0E-08
sp|Q8C0R9|LRRD1_MOUSE Leucine-rich repeat and death domain-containing protein 1 OS=Mus musculus GN=Lrrd1 PE=2 SV=2 507 760 2.0E-08
sp|Q55E58|PATS1_DICDI Probable serine/threonine-protein kinase pats1 OS=Dictyostelium discoideum GN=pats1 PE=3 SV=1 687 927 2.0E-08
sp|P34268|FLII_CAEEL Protein flightless-1 homolog OS=Caenorhabditis elegans GN=fli-1 PE=2 SV=2 797 1082 2.0E-08
sp|Q54XZ5|Y0138_DICDI Probable serine/threonine-protein kinase DDB_G0278509 OS=Dictyostelium discoideum GN=DDB_G0278509 PE=3 SV=1 672 937 2.0E-08
sp|P90920|EGG6_CAEEL Leucine-rich repeat-containing protein egg-6 OS=Caenorhabditis elegans GN=egg-6 PE=2 SV=2 667 1059 2.0E-08
sp|Q3KQF4|LRC69_XENLA Leucine-rich repeat-containing protein 69 OS=Xenopus laevis GN=lrrc69 PE=2 SV=1 874 1083 2.0E-08
sp|O08770|GPV_RAT Platelet glycoprotein V OS=Rattus norvegicus GN=Gp5 PE=3 SV=1 567 867 2.0E-08
sp|A8JAM0|DRC7_CHLRE Dynein regulatory complex subunit 7 (Fragment) OS=Chlamydomonas reinhardtii GN=DRC7 PE=1 SV=1 798 933 2.0E-08
sp|Q8GUQ5|BRI1_SOLLC Brassinosteroid LRR receptor kinase OS=Solanum lycopersicum GN=CURL3 PE=1 SV=1 681 1132 2.0E-08
sp|Q9HB75|PIDD1_HUMAN p53-induced death domain-containing protein 1 OS=Homo sapiens GN=PIDD1 PE=1 SV=2 564 729 2.0E-08
sp|Q68F79|LRC8E_XENTR Volume-regulated anion channel subunit LRRC8E OS=Xenopus tropicalis GN=lrrc8e PE=2 SV=1 576 779 2.0E-08
sp|Q9C9H7|RLP12_ARATH Receptor-like protein 12 OS=Arabidopsis thaliana GN=RLP12 PE=2 SV=2 614 1080 2.0E-08
sp|Q5S007|LRRK2_HUMAN Leucine-rich repeat serine/threonine-protein kinase 2 OS=Homo sapiens GN=LRRK2 PE=1 SV=2 815 1080 2.0E-08
sp|Q9FL51|Y5694_ARATH Probably inactive leucine-rich repeat receptor-like protein kinase At5g06940 OS=Arabidopsis thaliana GN=At5g06940 PE=3 SV=1 566 929 2.0E-08
sp|Q01730|RSU1_MOUSE Ras suppressor protein 1 OS=Mus musculus GN=Rsu1 PE=1 SV=3 870 1069 2.0E-08
sp|Q6K5I0|P2C20_ORYSJ Probable protein phosphatase 2C 20 OS=Oryza sativa subsp. japonica GN=Os02g0600000 PE=3 SV=2 1157 1478 2.0E-08
sp|Q8N9N7|LRC57_HUMAN Leucine-rich repeat-containing protein 57 OS=Homo sapiens GN=LRRC57 PE=1 SV=1 656 790 2.0E-08
sp|Q8N3J5|PPM1K_HUMAN Protein phosphatase 1K, mitochondrial OS=Homo sapiens GN=PPM1K PE=1 SV=1 1299 1459 2.0E-08
sp|Q52KR2|LRIG2_MOUSE Leucine-rich repeats and immunoglobulin-like domains protein 2 OS=Mus musculus GN=Lrig2 PE=1 SV=1 776 1082 2.0E-08
sp|Q9C7S5|PSYR1_ARATH Tyrosine-sulfated glycopeptide receptor 1 OS=Arabidopsis thaliana GN=PSYR1 PE=2 SV=1 544 1109 2.0E-08
sp|Q24K06|LRC10_BOVIN Leucine-rich repeat-containing protein 10 OS=Bos taurus GN=LRRC10 PE=2 SV=1 620 786 2.0E-08
sp|Q3V1N1|MFHA1_MOUSE Malignant fibrous histiocytoma-amplified sequence 1 homolog OS=Mus musculus GN=Mfhas1 PE=2 SV=2 556 828 3.0E-08
sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 628 929 3.0E-08
sp|A4IIK1|MFHA1_XENTR Malignant fibrous histiocytoma-amplified sequence 1 homolog OS=Xenopus tropicalis GN=mfhas1 PE=2 SV=1 774 1084 3.0E-08
sp|Q8BGR2|LRC8D_MOUSE Volume-regulated anion channel subunit LRRC8D OS=Mus musculus GN=Lrrc8d PE=1 SV=1 650 933 3.0E-08
sp|Q7L1W4|LRC8D_HUMAN Volume-regulated anion channel subunit LRRC8D OS=Homo sapiens GN=LRRC8D PE=1 SV=1 650 933 3.0E-08
sp|O64566|PIRL6_ARATH Plant intracellular Ras-group-related LRR protein 6 OS=Arabidopsis thaliana GN=PIRL6 PE=2 SV=1 685 934 3.0E-08
sp|Q2PC20|PPM1K_BOVIN Protein phosphatase 1K, mitochondrial OS=Bos taurus GN=PPM1K PE=2 SV=1 1299 1459 3.0E-08
sp|Q80ZD9|AMGO2_MOUSE Amphoterin-induced protein 2 OS=Mus musculus GN=Amigo2 PE=1 SV=1 611 766 3.0E-08
sp|Q5FVI3|LRC57_RAT Leucine-rich repeat-containing protein 57 OS=Rattus norvegicus GN=Lrrc57 PE=2 SV=1 659 790 3.0E-08
sp|Q5E9C0|RSU1_BOVIN Ras suppressor protein 1 OS=Bos taurus GN=RSU1 PE=2 SV=1 870 1069 3.0E-08
sp|Q7XK44|PIRL3_ORYSJ Plant intracellular Ras-group-related LRR protein 3 OS=Oryza sativa subsp. japonica GN=IRL3 PE=2 SV=3 852 1090 4.0E-08
sp|Q9RBS2|POPC_RALSO Protein PopC OS=Ralstonia solanacearum (strain GMI1000) GN=popC PE=4 SV=2 557 782 4.0E-08
sp|Q6P9F7|LRC8B_HUMAN Volume-regulated anion channel subunit LRRC8B OS=Homo sapiens GN=LRRC8B PE=1 SV=2 556 747 4.0E-08
sp|Q8RWE5|PIRL8_ARATH Plant intracellular Ras-group-related LRR protein 8 OS=Arabidopsis thaliana GN=PIRL8 PE=2 SV=1 846 1082 4.0E-08
sp|O64566|PIRL6_ARATH Plant intracellular Ras-group-related LRR protein 6 OS=Arabidopsis thaliana GN=PIRL6 PE=2 SV=1 548 747 4.0E-08
sp|Q5DU41|LRC8B_MOUSE Volume-regulated anion channel subunit LRRC8B OS=Mus musculus GN=Lrrc8b PE=1 SV=3 556 747 4.0E-08
sp|Q6GLE8|LRC28_XENTR Leucine-rich repeat-containing protein 28 OS=Xenopus tropicalis GN=lrrc28 PE=2 SV=1 835 933 4.0E-08
sp|Q9HB75|PIDD1_HUMAN p53-induced death domain-containing protein 1 OS=Homo sapiens GN=PIDD1 PE=1 SV=2 742 962 4.0E-08
sp|O02833|ALS_PAPHA Insulin-like growth factor-binding protein complex acid labile subunit OS=Papio hamadryas GN=IGFALS PE=2 SV=1 681 1084 4.0E-08
sp|Q7L985|LIGO2_HUMAN Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 2 OS=Homo sapiens GN=LINGO2 PE=2 SV=1 741 1080 4.0E-08
sp|O65440|BAME3_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM3 OS=Arabidopsis thaliana GN=BAM3 PE=2 SV=3 676 1080 4.0E-08
sp|A0BQL0|PP2C3_PARTE Probable protein phosphatase 2C 3 OS=Paramecium tetraurelia GN=GSPATT00031056001 PE=3 SV=1 1301 1422 4.0E-08
sp|Q3UV48|LRC30_MOUSE Leucine-rich repeat-containing protein 30 OS=Mus musculus GN=Lrrc30 PE=2 SV=1 516 750 4.0E-08
sp|Q9FLI3|P2C75_ARATH Probable protein phosphatase 2C 75 OS=Arabidopsis thaliana GN=AHG1 PE=2 SV=1 1262 1466 4.0E-08
sp|A6H6A4|LRIQ4_MOUSE Leucine-rich repeat and IQ domain-containing protein 4 OS=Mus musculus GN=Lrriq4 PE=2 SV=1 557 769 5.0E-08
sp|Q9RBS2|POPC_RALSO Protein PopC OS=Ralstonia solanacearum (strain GMI1000) GN=popC PE=4 SV=2 863 1083 5.0E-08
sp|Q8VDB8|LRRC2_MOUSE Leucine-rich repeat-containing protein 2 OS=Mus musculus GN=Lrrc2 PE=2 SV=1 863 1082 5.0E-08
sp|F1MLX5|LGR4_BOVIN Leucine-rich repeat-containing G-protein coupled receptor 4 OS=Bos taurus GN=LGR4 PE=3 SV=3 552 937 5.0E-08
sp|Q9ERV7|PIDD1_MOUSE p53-induced death domain-containing protein 1 OS=Mus musculus GN=Pidd1 PE=1 SV=1 812 934 5.0E-08
sp|P0C895|Y2010_ARATH LRR repeats and ubiquitin-like domain-containing protein At2g30105 OS=Arabidopsis thaliana GN=At2g30105 PE=1 SV=1 618 810 5.0E-08
sp|Q28888|PGS2_RABIT Decorin OS=Oryctolagus cuniculus GN=DCN PE=2 SV=1 798 1064 5.0E-08
sp|Q8BXN7|PPM1K_MOUSE Protein phosphatase 1K, mitochondrial OS=Mus musculus GN=Ppm1k PE=1 SV=1 1299 1459 5.0E-08
sp|P49593|PPM1F_HUMAN Protein phosphatase 1F OS=Homo sapiens GN=PPM1F PE=1 SV=3 1307 1466 5.0E-08
sp|Q65XG6|P2C49_ORYSJ Probable protein phosphatase 2C 49 OS=Oryza sativa subsp. japonica GN=Os05g0457200 PE=3 SV=1 1291 1435 5.0E-08
sp|Q9ZW21|P2C24_ARATH Probable protein phosphatase 2C 24 OS=Arabidopsis thaliana GN=At2g29380 PE=2 SV=1 1309 1462 5.0E-08
sp|Q5ZLN0|LRC40_CHICK Leucine-rich repeat-containing protein 40 OS=Gallus gallus GN=LRRC40 PE=2 SV=1 893 1082 6.0E-08
sp|Q5DU41|LRC8B_MOUSE Volume-regulated anion channel subunit LRRC8B OS=Mus musculus GN=Lrrc8b PE=1 SV=3 643 933 6.0E-08
sp|Q6XHA7|ROCO9_DICDI Probable serine/threonine-protein kinase roco9 OS=Dictyostelium discoideum GN=roco9 PE=3 SV=1 584 867 6.0E-08
sp|Q54Y32|MPL3_DICDI MAP kinase phosphatase with leucine-rich repeats protein 3 OS=Dictyostelium discoideum GN=mpl3 PE=3 SV=1 826 955 6.0E-08
sp|F1QBY1|NIPLB_DANRE Nipped-B-like protein B OS=Danio rerio GN=nipblb PE=2 SV=1 207 269 6.0E-08
sp|Q9LRT1|Y3804_ARATH Probably inactive leucine-rich repeat receptor-like protein kinase At3g28040 OS=Arabidopsis thaliana GN=At3g28040 PE=2 SV=1 617 1082 6.0E-08
sp|C0LGW6|ERL1_ARATH LRR receptor-like serine/threonine-protein kinase ERL1 OS=Arabidopsis thaliana GN=ERL1 PE=1 SV=1 564 930 6.0E-08
sp|P62046|LRCH1_MOUSE Leucine-rich repeat and calponin homology domain-containing protein 1 OS=Mus musculus GN=Lrch1 PE=1 SV=2 799 940 7.0E-08
sp|Q5G5D8|PIRL7_ARATH Plant intracellular Ras-group-related LRR protein 7 OS=Arabidopsis thaliana GN=PIRL7 PE=2 SV=1 674 913 7.0E-08
sp|Q5VUJ6|LRCH2_HUMAN Leucine-rich repeat and calponin homology domain-containing protein 2 OS=Homo sapiens GN=LRCH2 PE=2 SV=2 817 1091 7.0E-08
sp|Q8BVU0|LRCH3_MOUSE Leucine-rich repeat and calponin homology domain-containing protein 3 OS=Mus musculus GN=Lrch3 PE=1 SV=3 669 830 7.0E-08
sp|O94898|LRIG2_HUMAN Leucine-rich repeats and immunoglobulin-like domains protein 2 OS=Homo sapiens GN=LRIG2 PE=2 SV=3 802 1082 7.0E-08
sp|P36047|SDS22_YEAST Protein phosphatase 1 regulatory subunit SDS22 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SDS22 PE=1 SV=1 647 884 7.0E-08
sp|P22792|CPN2_HUMAN Carboxypeptidase N subunit 2 OS=Homo sapiens GN=CPN2 PE=1 SV=3 544 746 8.0E-08
sp|Q9D1G5|LRC57_MOUSE Leucine-rich repeat-containing protein 57 OS=Mus musculus GN=Lrrc57 PE=1 SV=1 659 790 8.0E-08
sp|P0DJM0|INLA_LISMO Internalin-A OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=inlA PE=1 SV=1 702 1076 8.0E-08
sp|P62046|LRCH1_MOUSE Leucine-rich repeat and calponin homology domain-containing protein 1 OS=Mus musculus GN=Lrch1 PE=1 SV=2 675 896 9.0E-08
sp|Q6XAT2|ERL2_ARATH LRR receptor-like serine/threonine-protein kinase ERL2 OS=Arabidopsis thaliana GN=ERL2 PE=2 SV=1 564 988 9.0E-08
sp|E5DHB5|LGR5A_XENLA Leucine-rich repeat-containing G-protein coupled receptor 5A OS=Xenopus laevis GN=lgr5-a PE=2 SV=1 556 937 9.0E-08
sp|Q0J2R1|P2C67_ORYSJ Probable protein phosphatase 2C 67 OS=Oryza sativa subsp. japonica GN=Os09g0314400 PE=2 SV=1 1304 1431 9.0E-08
sp|Q9Z1S7|OMD_RAT Osteomodulin OS=Rattus norvegicus GN=Omd PE=2 SV=1 696 935 9.0E-08
sp|Q723K6|INLA_LISMF Internalin-A OS=Listeria monocytogenes serotype 4b (strain F2365) GN=inlA PE=3 SV=1 707 1076 9.0E-08
sp|Q54AX5|LRRA_DICDI Leucine-rich repeat protein lrrA OS=Dictyostelium discoideum GN=lrrA PE=1 SV=1 720 1110 1.0E-07
sp|Q5G5D8|PIRL7_ARATH Plant intracellular Ras-group-related LRR protein 7 OS=Arabidopsis thaliana GN=PIRL7 PE=2 SV=1 548 747 1.0E-07
sp|Q8RWE5|PIRL8_ARATH Plant intracellular Ras-group-related LRR protein 8 OS=Arabidopsis thaliana GN=PIRL8 PE=2 SV=1 534 764 1.0E-07
sp|O64566|PIRL6_ARATH Plant intracellular Ras-group-related LRR protein 6 OS=Arabidopsis thaliana GN=PIRL6 PE=2 SV=1 825 1080 1.0E-07
sp|O49318|Y2317_ARATH Probable leucine-rich repeat receptor-like protein kinase At2g33170 OS=Arabidopsis thaliana GN=At2g33170 PE=2 SV=1 824 1082 1.0E-07
sp|Q6NU09|LRC8E_XENLA Volume-regulated anion channel subunit LRRC8E OS=Xenopus laevis GN=lrrc8e PE=2 SV=1 576 779 1.0E-07
sp|Q8K3W2|LRC10_MOUSE Leucine-rich repeat-containing protein 10 OS=Mus musculus GN=Lrrc10 PE=1 SV=1 761 933 1.0E-07
sp|Q6NSJ5|LRC8E_HUMAN Volume-regulated anion channel subunit LRRC8E OS=Homo sapiens GN=LRRC8E PE=1 SV=2 549 750 1.0E-07
sp|Q723X5|INLI_LISMF Internalin-I OS=Listeria monocytogenes serotype 4b (strain F2365) GN=inlI PE=3 SV=1 638 927 1.0E-07
sp|Q3KRC6|LRC8E_RAT Volume-regulated anion channel subunit LRRC8E OS=Rattus norvegicus GN=Lrrc8e PE=2 SV=1 865 1073 1.0E-07
sp|P0C895|Y2010_ARATH LRR repeats and ubiquitin-like domain-containing protein At2g30105 OS=Arabidopsis thaliana GN=At2g30105 PE=1 SV=1 594 760 1.0E-07
sp|Q9SSL9|PEPR1_ARATH Leucine-rich repeat receptor-like protein kinase PEPR1 OS=Arabidopsis thaliana GN=PEPR1 PE=1 SV=1 612 1110 1.0E-07
sp|C0LGW6|ERL1_ARATH LRR receptor-like serine/threonine-protein kinase ERL1 OS=Arabidopsis thaliana GN=ERL1 PE=1 SV=1 716 1082 1.0E-07
sp|Q9LME4|P2C09_ARATH Probable protein phosphatase 2C 9 OS=Arabidopsis thaliana GN=At1g22280 PE=1 SV=1 1306 1462 1.0E-07
sp|Q96CX6|LRC58_HUMAN Leucine-rich repeat-containing protein 58 OS=Homo sapiens GN=LRRC58 PE=1 SV=2 612 743 1.0E-07
sp|O82318|Y2579_ARATH Probably inactive leucine-rich repeat receptor-like protein kinase At2g25790 OS=Arabidopsis thaliana GN=At2g25790 PE=2 SV=1 556 904 1.0E-07
sp|Q8TF66|LRC15_HUMAN Leucine-rich repeat-containing protein 15 OS=Homo sapiens GN=LRRC15 PE=2 SV=2 558 900 1.0E-07
sp|C0LGT6|EFR_ARATH LRR receptor-like serine/threonine-protein kinase EFR OS=Arabidopsis thaliana GN=EFR PE=1 SV=1 621 927 1.0E-07
sp|Q5UPZ7|YR307_MIMIV PP2C-like domain-containing protein R307 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R307 PE=1 SV=1 1326 1459 1.0E-07
sp|O75473|LGR5_HUMAN Leucine-rich repeat-containing G-protein coupled receptor 5 OS=Homo sapiens GN=LGR5 PE=1 SV=1 711 1060 1.0E-07
sp|Q7TNJ4|AMGO2_RAT Amphoterin-induced protein 2 OS=Rattus norvegicus GN=Amigo2 PE=1 SV=1 611 769 1.0E-07
sp|Q86X40|LRC28_HUMAN Leucine-rich repeat-containing protein 28 OS=Homo sapiens GN=LRRC28 PE=2 SV=1 563 759 1.0E-07
sp|P70389|ALS_MOUSE Insulin-like growth factor-binding protein complex acid labile subunit OS=Mus musculus GN=Igfals PE=1 SV=1 826 1149 2.0E-07
sp|Q96DD0|LRC39_HUMAN Leucine-rich repeat-containing protein 39 OS=Homo sapiens GN=LRRC39 PE=2 SV=1 834 1086 2.0E-07
sp|Q3ZC49|LRC39_BOVIN Leucine-rich repeat-containing protein 39 OS=Bos taurus GN=LRRC39 PE=2 SV=1 851 1086 2.0E-07
sp|Q3ZC49|LRC39_BOVIN Leucine-rich repeat-containing protein 39 OS=Bos taurus GN=LRRC39 PE=2 SV=1 556 764 2.0E-07
sp|Q9Y2L9|LRCH1_HUMAN Leucine-rich repeat and calponin homology domain-containing protein 1 OS=Homo sapiens GN=LRCH1 PE=1 SV=3 800 933 2.0E-07
sp|Q6K7R2|PIRL6_ORYSJ Plant intracellular Ras-group-related LRR protein 6 OS=Oryza sativa subsp. japonica GN=IRL6 PE=2 SV=1 850 1083 2.0E-07
sp|Q5DU41|LRC8B_MOUSE Volume-regulated anion channel subunit LRRC8B OS=Mus musculus GN=Lrrc8b PE=1 SV=3 720 1073 2.0E-07
sp|Q6GLE8|LRC28_XENTR Leucine-rich repeat-containing protein 28 OS=Xenopus tropicalis GN=lrrc28 PE=2 SV=1 855 1092 2.0E-07
sp|Q8L899|BRI1_SOLPE Systemin receptor SR160 OS=Solanum peruvianum PE=1 SV=1 681 1132 2.0E-07
sp|Q6DHL5|LRC57_DANRE Leucine-rich repeat-containing protein 57 OS=Danio rerio GN=lrrc57 PE=2 SV=1 971 1083 2.0E-07
sp|P35858|ALS_HUMAN Insulin-like growth factor-binding protein complex acid labile subunit OS=Homo sapiens GN=IGFALS PE=1 SV=1 875 1074 2.0E-07
sp|Q15404|RSU1_HUMAN Ras suppressor protein 1 OS=Homo sapiens GN=RSU1 PE=1 SV=3 839 1058 2.0E-07
sp|Q1ZXD6|ROCO5_DICDI Probable serine/threonine-protein kinase roco5 OS=Dictyostelium discoideum GN=roco5 PE=3 SV=1 824 1085 2.0E-07
sp|Q54Y32|MPL3_DICDI MAP kinase phosphatase with leucine-rich repeats protein 3 OS=Dictyostelium discoideum GN=mpl3 PE=3 SV=1 590 769 2.0E-07
sp|C0LGT6|EFR_ARATH LRR receptor-like serine/threonine-protein kinase EFR OS=Arabidopsis thaliana GN=EFR PE=1 SV=1 622 1031 2.0E-07
sp|Q5R1V9|PGS2_PANTR Decorin OS=Pan troglodytes GN=DCN PE=2 SV=1 798 1039 2.0E-07
sp|P07585|PGS2_HUMAN Decorin OS=Homo sapiens GN=DCN PE=1 SV=1 798 1039 2.0E-07
sp|P40197|GPV_HUMAN Platelet glycoprotein V OS=Homo sapiens GN=GP5 PE=1 SV=1 774 1078 2.0E-07
sp|Q3UGP9|LRC58_MOUSE Leucine-rich repeat-containing protein 58 OS=Mus musculus GN=Lrrc58 PE=2 SV=1 566 743 2.0E-07
sp|G2K3G6|INLA_LISM4 Internalin-A OS=Listeria monocytogenes serotype 1/2a (strain 10403S) GN=inlA PE=3 SV=1 707 1076 2.0E-07
sp|Q0JLP9|P2C06_ORYSJ Probable protein phosphatase 2C 6 OS=Oryza sativa subsp. japonica GN=Os01g0583100 PE=1 SV=1 1309 1466 2.0E-07
sp|Q86SJ2|AMGO2_HUMAN Amphoterin-induced protein 2 OS=Homo sapiens GN=AMIGO2 PE=1 SV=1 611 766 2.0E-07
sp|Q80ZI6|LRSM1_MOUSE E3 ubiquitin-protein ligase LRSAM1 OS=Mus musculus GN=Lrsam1 PE=1 SV=1 810 948 2.0E-07
sp|Q9MYW3|TLR4_HORSE Toll-like receptor 4 OS=Equus caballus GN=TLR4 PE=2 SV=1 621 878 2.0E-07
sp|Q5N9N2|P2C09_ORYSJ Probable protein phosphatase 2C 9 OS=Oryza sativa subsp. japonica GN=Os01g0846300 PE=2 SV=1 1309 1427 2.0E-07
sp|Q9FIF5|P2C78_ARATH Probable protein phosphatase 2C 78 OS=Arabidopsis thaliana GN=At5g59220 PE=2 SV=1 1309 1427 2.0E-07
sp|Q9LNP9|P2C07_ARATH Protein phosphatase 2C 7 OS=Arabidopsis thaliana GN=HAB2 PE=1 SV=2 1308 1462 2.0E-07
sp|Q5R7M3|AMGO2_PONAB Amphoterin-induced protein 2 OS=Pongo abelii GN=AMIGO2 PE=2 SV=1 611 766 2.0E-07
sp|Q29393|PGS2_CANLF Decorin OS=Canis lupus familiaris GN=DCN PE=2 SV=2 798 1062 2.0E-07
sp|P47735|RLK5_ARATH Receptor-like protein kinase 5 OS=Arabidopsis thaliana GN=RLK5 PE=1 SV=1 661 1080 2.0E-07
sp|Q96II8|LRCH3_HUMAN Leucine-rich repeat and calponin homology domain-containing protein 3 OS=Homo sapiens GN=LRCH3 PE=1 SV=2 711 890 3.0E-07
sp|Q9LRV8|PIRL2_ARATH Plant intracellular Ras-group-related LRR protein 2 OS=Arabidopsis thaliana GN=PIRL2 PE=2 SV=1 899 1083 3.0E-07
sp|Q54XZ5|Y0138_DICDI Probable serine/threonine-protein kinase DDB_G0278509 OS=Dictyostelium discoideum GN=DDB_G0278509 PE=3 SV=1 858 1083 3.0E-07
sp|P35859|ALS_RAT Insulin-like growth factor-binding protein complex acid labile subunit OS=Rattus norvegicus GN=Igfals PE=1 SV=1 541 867 3.0E-07
sp|Q9LHP4|RCH2_ARATH Receptor-like protein kinase 2 OS=Arabidopsis thaliana GN=RCH2 PE=1 SV=1 699 1088 3.0E-07
sp|A5PK13|LRC8C_BOVIN Volume-regulated anion channel subunit LRRC8C OS=Bos taurus GN=LRRC8C PE=2 SV=1 556 735 3.0E-07
sp|Q8TDW0|LRC8C_HUMAN Volume-regulated anion channel subunit LRRC8C OS=Homo sapiens GN=LRRC8C PE=1 SV=2 556 735 3.0E-07
sp|Q8RZV7|MSP1_ORYSJ Leucine-rich repeat receptor protein kinase MSP1 OS=Oryza sativa subsp. japonica GN=MSP1 PE=1 SV=1 544 929 3.0E-07
sp|Q9LVT4|DRL37_ARATH Probable disease resistance protein At5g47250 OS=Arabidopsis thaliana GN=At5g47250 PE=2 SV=1 669 839 3.0E-07
sp|P28675|PGS2_CHICK Decorin OS=Gallus gallus GN=DCN PE=1 SV=1 798 1062 3.0E-07
sp|Q32KX5|LRC28_BOVIN Leucine-rich repeat-containing protein 28 OS=Bos taurus GN=LRRC28 PE=2 SV=1 563 759 3.0E-07
sp|Q9FXE4|P2C14_ARATH Probable protein phosphatase 2C 14 OS=Arabidopsis thaliana GN=At1g67820 PE=2 SV=2 1308 1425 3.0E-07
sp|P24014|SLIT_DROME Protein slit OS=Drosophila melanogaster GN=sli PE=1 SV=2 775 1064 3.0E-07
sp|Q93373|LET4_CAEEL Leucine-rich repeat-containing protein let-4 OS=Caenorhabditis elegans GN=let-4 PE=2 SV=2 618 930 3.0E-07
sp|Q96JA1|LRIG1_HUMAN Leucine-rich repeats and immunoglobulin-like domains protein 1 OS=Homo sapiens GN=LRIG1 PE=1 SV=2 639 1029 3.0E-07
sp|Q6NU09|LRC8E_XENLA Volume-regulated anion channel subunit LRRC8E OS=Xenopus laevis GN=lrrc8e PE=2 SV=1 713 933 4.0E-07
sp|Q9HB75|PIDD1_HUMAN p53-induced death domain-containing protein 1 OS=Homo sapiens GN=PIDD1 PE=1 SV=2 859 1083 4.0E-07
sp|Q68F79|LRC8E_XENTR Volume-regulated anion channel subunit LRRC8E OS=Xenopus tropicalis GN=lrrc8e PE=2 SV=1 713 933 4.0E-07
sp|Q55FD8|GEFV_DICDI Ras guanine nucleotide exchange factor V OS=Dictyostelium discoideum GN=gefV PE=2 SV=1 804 1084 4.0E-07
sp|Q1ZXD6|ROCO5_DICDI Probable serine/threonine-protein kinase roco5 OS=Dictyostelium discoideum GN=roco5 PE=3 SV=1 563 766 4.0E-07
sp|C0LGS2|Y4361_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g36180 OS=Arabidopsis thaliana GN=At4g36180 PE=2 SV=1 690 1078 4.0E-07
sp|Q9FZ59|PEPR2_ARATH Leucine-rich repeat receptor-like protein kinase PEPR2 OS=Arabidopsis thaliana GN=PEPR2 PE=1 SV=1 568 1080 4.0E-07
sp|Q9TTE2|PGS2_SHEEP Decorin OS=Ovis aries GN=DCN PE=2 SV=1 798 1062 4.0E-07
sp|Q9TTE2|PGS2_SHEEP Decorin OS=Ovis aries GN=DCN PE=2 SV=1 616 886 4.0E-07
sp|O74473|CDC11_SCHPO Septation initiation network scaffold protein cdc11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc11 PE=1 SV=1 684 1086 4.0E-07
sp|Q5R6B1|LRRT1_PONAB Leucine-rich repeat transmembrane neuronal protein 1 OS=Pongo abelii GN=LRRTM1 PE=2 SV=1 824 1057 4.0E-07
sp|Q9FN37|PSKR2_ARATH Phytosulfokine receptor 2 OS=Arabidopsis thaliana GN=PSKR2 PE=2 SV=1 671 1086 4.0E-07
sp|O46542|PGS2_HORSE Decorin OS=Equus caballus GN=DCN PE=2 SV=1 798 1062 4.0E-07
sp|Q6DF55|VASN_XENTR Vasorin OS=Xenopus tropicalis GN=vasn PE=2 SV=1 977 1082 4.0E-07
sp|Q9XSD9|PGS2_PIG Decorin OS=Sus scrofa GN=DCN PE=2 SV=1 798 1062 4.0E-07
sp|Q9BTT6|LRRC1_HUMAN Leucine-rich repeat-containing protein 1 OS=Homo sapiens GN=LRRC1 PE=1 SV=1 557 781 5.0E-07
sp|Q5E9C0|RSU1_BOVIN Ras suppressor protein 1 OS=Bos taurus GN=RSU1 PE=2 SV=1 839 1058 5.0E-07
sp|Q86UE6|LRRT1_HUMAN Leucine-rich repeat transmembrane neuronal protein 1 OS=Homo sapiens GN=LRRTM1 PE=2 SV=2 824 1057 5.0E-07
sp|P21793|PGS2_BOVIN Decorin OS=Bos taurus GN=DCN PE=1 SV=2 616 886 5.0E-07
sp|P21793|PGS2_BOVIN Decorin OS=Bos taurus GN=DCN PE=1 SV=2 798 1062 5.0E-07
sp|Q6XHA6|ROC10_DICDI Probable inactive serine/threonine-protein kinase roco10 OS=Dictyostelium discoideum GN=roco10 PE=3 SV=1 690 927 5.0E-07
sp|O77742|OMD_BOVIN Osteomodulin OS=Bos taurus GN=OMD PE=1 SV=1 591 785 5.0E-07
sp|P0CE12|SSPH2_SALTY E3 ubiquitin-protein ligase sspH2 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=sspH2 PE=1 SV=1 851 1063 6.0E-07
sp|D0ZPH9|SSPH2_SALT1 E3 ubiquitin-protein ligase sspH2 OS=Salmonella typhimurium (strain 14028s / SGSC 2262) GN=sspH2 PE=1 SV=1 851 1063 6.0E-07
sp|Q13045|FLII_HUMAN Protein flightless-1 homolog OS=Homo sapiens GN=FLII PE=1 SV=2 557 831 7.0E-07
sp|Q9FIZ3|GSO2_ARATH LRR receptor-like serine/threonine-protein kinase GSO2 OS=Arabidopsis thaliana GN=GSO2 PE=2 SV=2 671 1091 7.0E-07
sp|Q8R5M3|LRC15_RAT Leucine-rich repeat-containing protein 15 OS=Rattus norvegicus GN=Lrrc15 PE=2 SV=1 524 881 7.0E-07
sp|Q3UMG5|LRCH2_MOUSE Leucine-rich repeat and calponin homology domain-containing protein 2 OS=Mus musculus GN=Lrch2 PE=2 SV=2 852 1091 7.0E-07
sp|Q8R502|LRC8C_MOUSE Volume-regulated anion channel subunit LRRC8C OS=Mus musculus GN=Lrrc8c PE=1 SV=1 556 735 7.0E-07
sp|O70210|CHAD_RAT Chondroadherin OS=Rattus norvegicus GN=Chad PE=2 SV=1 572 786 7.0E-07
sp|Q9SYQ8|CLV1_ARATH Receptor protein kinase CLAVATA1 OS=Arabidopsis thaliana GN=CLV1 PE=1 SV=3 556 930 7.0E-07
sp|Q9DE68|PGS2_COTJA Decorin OS=Coturnix coturnix japonica GN=DCN PE=2 SV=1 798 1062 7.0E-07
sp|Q7XNY1|PIRL1_ORYSJ Plant intracellular Ras-group-related LRR protein 1 OS=Oryza sativa subsp. japonica GN=IRL1 PE=2 SV=2 801 1038 8.0E-07
sp|Q6DHL5|LRC57_DANRE Leucine-rich repeat-containing protein 57 OS=Danio rerio GN=lrrc57 PE=2 SV=1 826 933 8.0E-07
sp|F1QBY1|NIPLB_DANRE Nipped-B-like protein B OS=Danio rerio GN=nipblb PE=2 SV=1 206 269 8.0E-07
sp|Q96JA1|LRIG1_HUMAN Leucine-rich repeats and immunoglobulin-like domains protein 1 OS=Homo sapiens GN=LRIG1 PE=1 SV=2 568 899 8.0E-07
sp|A2Q9L0|CCR4_ASPNC Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=ccr4 PE=3 SV=1 674 769 8.0E-07
sp|C0LGP9|IMK3_ARATH Probable leucine-rich repeat receptor-like protein kinase IMK3 OS=Arabidopsis thaliana GN=IMK3 PE=1 SV=1 661 938 8.0E-07
sp|P08953|TOLL_DROME Protein toll OS=Drosophila melanogaster GN=Tl PE=1 SV=1 563 839 8.0E-07
sp|A0BLX0|PP2C2_PARTE Probable protein phosphatase 2C 2 OS=Paramecium tetraurelia GN=GSPATT00030171001 PE=3 SV=1 1233 1445 8.0E-07
sp|Q96DD0|LRC39_HUMAN Leucine-rich repeat-containing protein 39 OS=Homo sapiens GN=LRRC39 PE=2 SV=1 556 744 9.0E-07
sp|Q498T9|LRC8C_RAT Volume-regulated anion channel subunit LRRC8C OS=Rattus norvegicus GN=Lrrc8c PE=1 SV=1 556 735 9.0E-07
sp|Q1ZXD6|ROCO5_DICDI Probable serine/threonine-protein kinase roco5 OS=Dictyostelium discoideum GN=roco5 PE=3 SV=1 730 933 9.0E-07
sp|Q80ZI6|LRSM1_MOUSE E3 ubiquitin-protein ligase LRSAM1 OS=Mus musculus GN=Lrsam1 PE=1 SV=1 667 788 9.0E-07
sp|Q7F8Q9|MSL1_ORYSJ Leucine-rich repeat receptor protein kinase MSL1 OS=Oryza sativa subsp. japonica GN=MSL1 PE=2 SV=1 556 1066 9.0E-07
sp|Q9JJ28|FLII_MOUSE Protein flightless-1 homolog OS=Mus musculus GN=Flii PE=1 SV=1 557 831 1.0E-06
sp|Q80X72|LRC15_MOUSE Leucine-rich repeat-containing protein 15 OS=Mus musculus GN=Lrrc15 PE=2 SV=1 671 1076 1.0E-06
sp|O64566|PIRL6_ARATH Plant intracellular Ras-group-related LRR protein 6 OS=Arabidopsis thaliana GN=PIRL6 PE=2 SV=1 815 1050 1.0E-06
sp|O75427|LRCH4_HUMAN Leucine-rich repeat and calponin homology domain-containing protein 4 OS=Homo sapiens GN=LRCH4 PE=1 SV=2 799 933 1.0E-06
sp|Q7XNY1|PIRL1_ORYSJ Plant intracellular Ras-group-related LRR protein 1 OS=Oryza sativa subsp. japonica GN=IRL1 PE=2 SV=2 557 756 1.0E-06
sp|Q921G6|LRCH4_MOUSE Leucine-rich repeat and calponin homology domain-containing protein 4 OS=Mus musculus GN=Lrch4 PE=1 SV=1 751 934 1.0E-06
sp|A2ARI4|LGR4_MOUSE Leucine-rich repeat-containing G-protein coupled receptor 4 OS=Mus musculus GN=Lgr4 PE=1 SV=1 801 1083 1.0E-06
sp|A8JAM0|DRC7_CHLRE Dynein regulatory complex subunit 7 (Fragment) OS=Chlamydomonas reinhardtii GN=DRC7 PE=1 SV=1 829 1085 1.0E-06
sp|Q8K3W2|LRC10_MOUSE Leucine-rich repeat-containing protein 10 OS=Mus musculus GN=Lrrc10 PE=1 SV=1 881 1084 1.0E-06
sp|Q66JT1|LRC8E_MOUSE Volume-regulated anion channel subunit LRRC8E OS=Mus musculus GN=Lrrc8e PE=2 SV=2 850 933 1.0E-06
sp|Q9ERV7|PIDD1_MOUSE p53-induced death domain-containing protein 1 OS=Mus musculus GN=Pidd1 PE=1 SV=1 790 962 1.0E-06
sp|Q24K06|LRC10_BOVIN Leucine-rich repeat-containing protein 10 OS=Bos taurus GN=LRRC10 PE=2 SV=1 899 1084 1.0E-06
sp|F1QBY1|NIPLB_DANRE Nipped-B-like protein B OS=Danio rerio GN=nipblb PE=2 SV=1 206 269 1.0E-06
sp|O94898|LRIG2_HUMAN Leucine-rich repeats and immunoglobulin-like domains protein 2 OS=Homo sapiens GN=LRIG2 PE=2 SV=3 524 766 1.0E-06
sp|P0DJM0|INLA_LISMO Internalin-A OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=inlA PE=1 SV=1 589 912 1.0E-06
sp|O75473|LGR5_HUMAN Leucine-rich repeat-containing G-protein coupled receptor 5 OS=Homo sapiens GN=LGR5 PE=1 SV=1 564 937 1.0E-06
sp|P40197|GPV_HUMAN Platelet glycoprotein V OS=Homo sapiens GN=GP5 PE=1 SV=1 567 867 1.0E-06
sp|Q7Z5L7|PODN_HUMAN Podocan OS=Homo sapiens GN=PODN PE=1 SV=2 558 934 1.0E-06
sp|C0LGK9|Y2242_ARATH Probable LRR receptor-like serine/threonine-protein kinase At2g24230 OS=Arabidopsis thaliana GN=At2g24230 PE=2 SV=1 661 930 1.0E-06
sp|P23515|OMGP_HUMAN Oligodendrocyte-myelin glycoprotein OS=Homo sapiens GN=OMG PE=1 SV=2 685 882 1.0E-06
sp|Q9LVP0|Y5639_ARATH Probable leucine-rich repeat receptor-like protein kinase At5g63930 OS=Arabidopsis thaliana GN=At5g63930 PE=2 SV=1 617 1082 1.0E-06
sp|Q9LDA7|P2C39_ARATH Probable protein phosphatase 2C 39 OS=Arabidopsis thaliana GN=At3g15260 PE=2 SV=1 1315 1462 1.0E-06
sp|Q09172|PP2C2_SCHPO Protein phosphatase 2C homolog 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ptc2 PE=3 SV=1 1308 1487 1.0E-06
sp|Q9LNW3|P2C03_ARATH Protein phosphatase 2C 3 OS=Arabidopsis thaliana GN=AIP1 PE=1 SV=1 1309 1425 1.0E-06
sp|Q6L5H6|P2C50_ORYSJ Probable protein phosphatase 2C 50 OS=Oryza sativa subsp. japonica GN=Os05g0537400 PE=3 SV=1 1309 1462 1.0E-06
sp|Q9QUK6|TLR4_MOUSE Toll-like receptor 4 OS=Mus musculus GN=Tlr4 PE=1 SV=1 564 878 1.0E-06
sp|P49595|PP2C1_CAEEL Probable protein phosphatase 2C F42G9.1 OS=Caenorhabditis elegans GN=F42G9.1 PE=3 SV=2 1293 1426 1.0E-06
sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 681 1091 2.0E-06
sp|Q6ZVD8|PHLP2_HUMAN PH domain leucine-rich repeat-containing protein phosphatase 2 OS=Homo sapiens GN=PHLPP2 PE=1 SV=3 871 1139 2.0E-06
sp|Q9CRC8|LRC40_MOUSE Leucine-rich repeat-containing protein 40 OS=Mus musculus GN=Lrrc40 PE=1 SV=2 476 867 2.0E-06
sp|A6NIV6|LRIQ4_HUMAN Leucine-rich repeat and IQ domain-containing protein 4 OS=Homo sapiens GN=LRRIQ4 PE=3 SV=2 549 769 2.0E-06
sp|Q9Y2L9|LRCH1_HUMAN Leucine-rich repeat and calponin homology domain-containing protein 1 OS=Homo sapiens GN=LRCH1 PE=1 SV=3 675 896 2.0E-06
sp|O08770|GPV_RAT Platelet glycoprotein V OS=Rattus norvegicus GN=Gp5 PE=3 SV=1 564 727 2.0E-06
sp|Q68F79|LRC8E_XENTR Volume-regulated anion channel subunit LRRC8E OS=Xenopus tropicalis GN=lrrc8e PE=2 SV=1 851 1082 2.0E-06
sp|Q6UWE0|LRSM1_HUMAN E3 ubiquitin-protein ligase LRSAM1 OS=Homo sapiens GN=LRSAM1 PE=1 SV=1 810 933 2.0E-06
sp|Q66JT1|LRC8E_MOUSE Volume-regulated anion channel subunit LRRC8E OS=Mus musculus GN=Lrrc8e PE=2 SV=2 690 1073 2.0E-06
sp|Q5BKY1|LRC10_HUMAN Leucine-rich repeat-containing protein 10 OS=Homo sapiens GN=LRRC10 PE=2 SV=1 797 933 2.0E-06
sp|Q3UMG5|LRCH2_MOUSE Leucine-rich repeat and calponin homology domain-containing protein 2 OS=Mus musculus GN=Lrch2 PE=2 SV=2 801 967 2.0E-06
sp|Q3UMG5|LRCH2_MOUSE Leucine-rich repeat and calponin homology domain-containing protein 2 OS=Mus musculus GN=Lrch2 PE=2 SV=2 666 890 2.0E-06
sp|Q38SD2|LRRK1_HUMAN Leucine-rich repeat serine/threonine-protein kinase 1 OS=Homo sapiens GN=LRRK1 PE=1 SV=3 686 1079 2.0E-06
sp|Q5VUJ6|LRCH2_HUMAN Leucine-rich repeat and calponin homology domain-containing protein 2 OS=Homo sapiens GN=LRCH2 PE=2 SV=2 690 890 2.0E-06
sp|Q5VUJ6|LRCH2_HUMAN Leucine-rich repeat and calponin homology domain-containing protein 2 OS=Homo sapiens GN=LRCH2 PE=2 SV=2 801 967 2.0E-06
sp|Q6INV3|LRC57_XENLA Leucine-rich repeat-containing protein 57 OS=Xenopus laevis GN=lrrc57 PE=2 SV=1 778 938 2.0E-06
sp|Q24K06|LRC10_BOVIN Leucine-rich repeat-containing protein 10 OS=Bos taurus GN=LRRC10 PE=2 SV=1 674 876 2.0E-06
sp|F1QBY1|NIPLB_DANRE Nipped-B-like protein B OS=Danio rerio GN=nipblb PE=2 SV=1 207 269 2.0E-06
sp|O94898|LRIG2_HUMAN Leucine-rich repeats and immunoglobulin-like domains protein 2 OS=Homo sapiens GN=LRIG2 PE=2 SV=3 643 909 2.0E-06
sp|Q96CX6|LRC58_HUMAN Leucine-rich repeat-containing protein 58 OS=Homo sapiens GN=LRRC58 PE=1 SV=2 599 795 2.0E-06
sp|Q9XSD9|PGS2_PIG Decorin OS=Sus scrofa GN=DCN PE=2 SV=1 616 883 2.0E-06
sp|O94769|ECM2_HUMAN Extracellular matrix protein 2 OS=Homo sapiens GN=ECM2 PE=2 SV=1 798 1127 2.0E-06
sp|O04719|P2C77_ARATH Protein phosphatase 2C 77 OS=Arabidopsis thaliana GN=ABI2 PE=1 SV=1 1308 1462 2.0E-06
sp|P0DL10|TD1_MAIZE Leucine-rich repeat receptor-like kinase protein THICK TASSEL DWARF1 OS=Zea mays GN=TD1 PE=2 SV=1 614 1043 2.0E-06
sp|B0BLW3|LGR4_XENTR Leucine-rich repeat-containing G-protein coupled receptor 4 OS=Xenopus tropicalis GN=lgr4 PE=1 SV=1 671 1080 2.0E-06
sp|P28654|PGS2_MOUSE Decorin OS=Mus musculus GN=Dcn PE=1 SV=1 616 883 2.0E-06
sp|Q9N008|LIGO1_MACFA Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1 OS=Macaca fascicularis GN=LINGO1 PE=2 SV=1 777 1062 2.0E-06
sp|Q54WS5|ROCO6_DICDI Probable serine/threonine-protein kinase roco6 OS=Dictyostelium discoideum GN=roco6 PE=3 SV=1 638 934 2.0E-06
sp|P02750|A2GL_HUMAN Leucine-rich alpha-2-glycoprotein OS=Homo sapiens GN=LRG1 PE=1 SV=2 894 1082 2.0E-06
sp|Q9TSP2|TLR4_PAPAN Toll-like receptor 4 OS=Papio anubis GN=TLR4 PE=3 SV=1 555 931 2.0E-06
sp|Q27972|CHAD_BOVIN Chondroadherin OS=Bos taurus GN=CHAD PE=1 SV=1 566 786 2.0E-06
sp|Q13045|FLII_HUMAN Protein flightless-1 homolog OS=Homo sapiens GN=FLII PE=1 SV=2 799 1066 3.0E-06
sp|Q9RBS2|POPC_RALSO Protein PopC OS=Ralstonia solanacearum (strain GMI1000) GN=popC PE=4 SV=2 697 1112 3.0E-06
sp|Q3UHC2|LRRK1_MOUSE Leucine-rich repeat serine/threonine-protein kinase 1 OS=Mus musculus GN=Lrrk1 PE=1 SV=1 664 934 3.0E-06
sp|A6NM36|LRC30_HUMAN Leucine-rich repeat-containing protein 30 OS=Homo sapiens GN=LRRC30 PE=4 SV=1 1003 1082 3.0E-06
sp|Q9D9Q0|LRC69_MOUSE Leucine-rich repeat-containing protein 69 OS=Mus musculus GN=Lrrc69 PE=2 SV=1 618 791 3.0E-06
sp|Q6XAT2|ERL2_ARATH LRR receptor-like serine/threonine-protein kinase ERL2 OS=Arabidopsis thaliana GN=ERL2 PE=2 SV=1 591 1070 3.0E-06
sp|Q9Z1S7|OMD_RAT Osteomodulin OS=Rattus norvegicus GN=Omd PE=2 SV=1 641 785 3.0E-06
sp|Q86VH4|LRRT4_HUMAN Leucine-rich repeat transmembrane neuronal protein 4 OS=Homo sapiens GN=LRRTM4 PE=2 SV=2 825 1057 3.0E-06
sp|O55226|CHAD_MOUSE Chondroadherin OS=Mus musculus GN=Chad PE=2 SV=1 572 786 3.0E-06
sp|O64583|P2C28_ARATH Probable protein phosphatase 2C 28 OS=Arabidopsis thaliana GN=At2g34740 PE=2 SV=2 1307 1459 3.0E-06
sp|P49444|PP2C1_PARTE Protein phosphatase 2C 1 OS=Paramecium tetraurelia GN=GSPATT00029903001 PE=1 SV=2 1233 1422 3.0E-06
sp|Q9BXR5|TLR10_HUMAN Toll-like receptor 10 OS=Homo sapiens GN=TLR10 PE=1 SV=2 621 1080 3.0E-06
sp|P18009|IPA4_SHIFL Probable E3 ubiquitin-protein ligase ipaH4.5 OS=Shigella flexneri GN=ipaH4.5 PE=1 SV=3 774 971 3.0E-06
sp|Q08817|SOG2_YEAST Leucine-rich repeat-containing protein SOG2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SOG2 PE=1 SV=1 872 1044 3.0E-06
sp|O15743|SPNA_DICDI Protein spalten OS=Dictyostelium discoideum GN=spnA PE=1 SV=1 1307 1461 3.0E-06
sp|A3A8W2|P2C21_ORYSJ Probable protein phosphatase 2C 21 OS=Oryza sativa subsp. japonica GN=Os02g0606900 PE=2 SV=2 1309 1468 3.0E-06
sp|Q8R5M3|LRC15_RAT Leucine-rich repeat-containing protein 15 OS=Rattus norvegicus GN=Lrrc15 PE=2 SV=1 713 1063 4.0E-06
sp|Q8RWE5|PIRL8_ARATH Plant intracellular Ras-group-related LRR protein 8 OS=Arabidopsis thaliana GN=PIRL8 PE=2 SV=1 729 933 4.0E-06
sp|Q4V8I7|LRC8A_RAT Volume-regulated anion channel subunit LRRC8A OS=Rattus norvegicus GN=Lrrc8a PE=1 SV=1 865 1073 4.0E-06
sp|Q80WG5|LRC8A_MOUSE Volume-regulated anion channel subunit LRRC8A OS=Mus musculus GN=Lrrc8a PE=1 SV=1 865 1073 4.0E-06
sp|Q3UHC2|LRRK1_MOUSE Leucine-rich repeat serine/threonine-protein kinase 1 OS=Mus musculus GN=Lrrk1 PE=1 SV=1 686 933 4.0E-06
sp|Q9BYS8|LRRC2_HUMAN Leucine-rich repeat-containing protein 2 OS=Homo sapiens GN=LRRC2 PE=2 SV=2 863 1076 4.0E-06
sp|Q9BXB1|LGR4_HUMAN Leucine-rich repeat-containing G-protein coupled receptor 4 OS=Homo sapiens GN=LGR4 PE=1 SV=2 801 1126 4.0E-06
sp|Q6UXM1|LRIG3_HUMAN Leucine-rich repeats and immunoglobulin-like domains protein 3 OS=Homo sapiens GN=LRIG3 PE=2 SV=1 802 1084 4.0E-06
sp|Q6UWE0|LRSM1_HUMAN E3 ubiquitin-protein ligase LRSAM1 OS=Homo sapiens GN=LRSAM1 PE=1 SV=1 618 757 4.0E-06
sp|Q5BKY1|LRC10_HUMAN Leucine-rich repeat-containing protein 10 OS=Homo sapiens GN=LRRC10 PE=2 SV=1 881 1084 4.0E-06
sp|P0C895|Y2010_ARATH LRR repeats and ubiquitin-like domain-containing protein At2g30105 OS=Arabidopsis thaliana GN=At2g30105 PE=1 SV=1 978 1167 4.0E-06
sp|Q498T9|LRC8C_RAT Volume-regulated anion channel subunit LRRC8C OS=Rattus norvegicus GN=Lrrc8c PE=1 SV=1 602 933 4.0E-06
sp|Q8N9N7|LRC57_HUMAN Leucine-rich repeat-containing protein 57 OS=Homo sapiens GN=LRRC57 PE=1 SV=1 826 933 4.0E-06
sp|O77742|OMD_BOVIN Osteomodulin OS=Bos taurus GN=OMD PE=1 SV=1 631 816 4.0E-06
sp|Q99983|OMD_HUMAN Osteomodulin OS=Homo sapiens GN=OMD PE=1 SV=1 733 935 4.0E-06
sp|Q8Y3L4|INLJ_LISMO Internalin-J OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=inlJ PE=1 SV=1 706 912 4.0E-06
sp|Q4V8G0|LRC63_RAT Leucine-rich repeat-containing protein 63 OS=Rattus norvegicus GN=Lrrc63 PE=2 SV=1 663 783 4.0E-06
sp|Q9ZUI0|Y2241_ARATH Putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g24130 OS=Arabidopsis thaliana GN=At2g24130 PE=3 SV=1 582 1080 4.0E-06
sp|Q8VZG8|Y4885_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g08850 OS=Arabidopsis thaliana GN=At4g08850 PE=2 SV=3 628 888 5.0E-06
sp|Q8IWT6|LRC8A_HUMAN Volume-regulated anion channel subunit LRRC8A OS=Homo sapiens GN=LRRC8A PE=1 SV=1 669 933 5.0E-06
sp|Q3KRC6|LRC8E_RAT Volume-regulated anion channel subunit LRRC8E OS=Rattus norvegicus GN=Lrrc8e PE=2 SV=1 850 933 5.0E-06
sp|Q8R502|LRC8C_MOUSE Volume-regulated anion channel subunit LRRC8C OS=Mus musculus GN=Lrrc8c PE=1 SV=1 602 933 5.0E-06
sp|F1QBY1|NIPLB_DANRE Nipped-B-like protein B OS=Danio rerio GN=nipblb PE=2 SV=1 207 270 5.0E-06
sp|Q8BVU0|LRCH3_MOUSE Leucine-rich repeat and calponin homology domain-containing protein 3 OS=Mus musculus GN=Lrch3 PE=1 SV=3 881 1091 5.0E-06
sp|G2K3G6|INLA_LISM4 Internalin-A OS=Listeria monocytogenes serotype 1/2a (strain 10403S) GN=inlA PE=3 SV=1 589 912 5.0E-06
sp|Q99983|OMD_HUMAN Osteomodulin OS=Homo sapiens GN=OMD PE=1 SV=1 588 785 5.0E-06
sp|Q5FW85|ECM2_MOUSE Extracellular matrix protein 2 OS=Mus musculus GN=Ecm2 PE=1 SV=1 696 1083 5.0E-06
sp|A1A4H9|LRRT1_BOVIN Leucine-rich repeat transmembrane neuronal protein 1 OS=Bos taurus GN=LRRTM1 PE=2 SV=1 824 1057 5.0E-06
sp|Q6R5N8|TLR13_MOUSE Toll-like receptor 13 OS=Mus musculus GN=Tlr13 PE=1 SV=1 594 1135 5.0E-06
sp|Q55CS7|MPL1_DICDI MAP kinase phosphatase with leucine-rich repeats protein 1 OS=Dictyostelium discoideum GN=mpl1 PE=2 SV=1 543 748 6.0E-06
sp|O75427|LRCH4_HUMAN Leucine-rich repeat and calponin homology domain-containing protein 4 OS=Homo sapiens GN=LRCH4 PE=1 SV=2 751 934 6.0E-06
sp|F7D3V9|LGR5_XENTR Leucine-rich repeat-containing G-protein coupled receptor 5 OS=Xenopus tropicalis GN=lgr5 PE=2 SV=2 992 1084 6.0E-06
sp|A5PK13|LRC8C_BOVIN Volume-regulated anion channel subunit LRRC8C OS=Bos taurus GN=LRRC8C PE=2 SV=1 602 933 6.0E-06
sp|Q6UWE0|LRSM1_HUMAN E3 ubiquitin-protein ligase LRSAM1 OS=Homo sapiens GN=LRSAM1 PE=1 SV=1 667 788 6.0E-06
sp|P0C895|Y2010_ARATH LRR repeats and ubiquitin-like domain-containing protein At2g30105 OS=Arabidopsis thaliana GN=At2g30105 PE=1 SV=1 713 930 6.0E-06
sp|Q9FZ59|PEPR2_ARATH Leucine-rich repeat receptor-like protein kinase PEPR2 OS=Arabidopsis thaliana GN=PEPR2 PE=1 SV=1 557 1011 6.0E-06
sp|B4F7C5|LRRT4_RAT Leucine-rich repeat transmembrane neuronal protein 4 OS=Rattus norvegicus GN=Lrrtm4 PE=1 SV=1 825 1057 6.0E-06
sp|Q8R0F6|ILKAP_MOUSE Integrin-linked kinase-associated serine/threonine phosphatase 2C OS=Mus musculus GN=Ilkap PE=1 SV=1 1307 1461 6.0E-06
sp|C0LGE4|Y1124_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g12460 OS=Arabidopsis thaliana GN=At1g12460 PE=2 SV=1 656 1013 6.0E-06
sp|Q1EA11|CCR4_COCIM Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Coccidioides immitis (strain RS) GN=CCR4 PE=3 SV=2 674 769 6.0E-06
sp|Q0IIF0|ILKAP_BOVIN Integrin-linked kinase-associated serine/threonine phosphatase 2C OS=Bos taurus GN=ILKAP PE=2 SV=1 1307 1461 6.0E-06
sp|Q6P9F7|LRC8B_HUMAN Volume-regulated anion channel subunit LRRC8B OS=Homo sapiens GN=LRRC8B PE=1 SV=2 643 933 7.0E-06
sp|Q9LYN8|EMS1_ARATH Leucine-rich repeat receptor protein kinase EMS1 OS=Arabidopsis thaliana GN=EMS1 PE=1 SV=1 556 929 7.0E-06
sp|Q6NU09|LRC8E_XENLA Volume-regulated anion channel subunit LRRC8E OS=Xenopus laevis GN=lrrc8e PE=2 SV=1 851 1082 7.0E-06
sp|Q8TDW0|LRC8C_HUMAN Volume-regulated anion channel subunit LRRC8C OS=Homo sapiens GN=LRRC8C PE=1 SV=2 602 933 7.0E-06
sp|Q3UMG5|LRCH2_MOUSE Leucine-rich repeat and calponin homology domain-containing protein 2 OS=Mus musculus GN=Lrch2 PE=2 SV=2 508 747 7.0E-06
sp|E5DHB5|LGR5A_XENLA Leucine-rich repeat-containing G-protein coupled receptor 5A OS=Xenopus laevis GN=lgr5-a PE=2 SV=1 992 1084 7.0E-06
sp|Q723K6|INLA_LISMF Internalin-A OS=Listeria monocytogenes serotype 4b (strain F2365) GN=inlA PE=3 SV=1 589 912 7.0E-06
sp|O77742|OMD_BOVIN Osteomodulin OS=Bos taurus GN=OMD PE=1 SV=1 733 935 7.0E-06
sp|P49597|P2C56_ARATH Protein phosphatase 2C 56 OS=Arabidopsis thaliana GN=ABI1 PE=1 SV=2 1308 1462 7.0E-06
sp|Q8IWT6|LRC8A_HUMAN Volume-regulated anion channel subunit LRRC8A OS=Homo sapiens GN=LRRC8A PE=1 SV=1 865 1073 8.0E-06
sp|Q6NSJ5|LRC8E_HUMAN Volume-regulated anion channel subunit LRRC8E OS=Homo sapiens GN=LRRC8E PE=1 SV=2 850 933 8.0E-06
sp|Q66JT1|LRC8E_MOUSE Volume-regulated anion channel subunit LRRC8E OS=Mus musculus GN=Lrrc8e PE=2 SV=2 974 1082 8.0E-06
sp|Q3UV48|LRC30_MOUSE Leucine-rich repeat-containing protein 30 OS=Mus musculus GN=Lrrc30 PE=2 SV=1 1003 1082 8.0E-06
sp|F1QBY1|NIPLB_DANRE Nipped-B-like protein B OS=Danio rerio GN=nipblb PE=2 SV=1 207 269 8.0E-06
sp|Q80XG9|LRRT4_MOUSE Leucine-rich repeat transmembrane neuronal protein 4 OS=Mus musculus GN=Lrrtm4 PE=1 SV=2 825 1057 8.0E-06
sp|Q9LRZ4|P2C41_ARATH Probable protein phosphatase 2C 41 OS=Arabidopsis thaliana GN=At3g16800 PE=2 SV=1 1308 1447 8.0E-06
sp|Q96FE5|LIGO1_HUMAN Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1 OS=Homo sapiens GN=LINGO1 PE=1 SV=2 777 1062 8.0E-06
sp|Q5RDJ4|LIGO1_PONAB Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1 OS=Pongo abelii GN=LINGO1 PE=2 SV=1 777 1062 8.0E-06
sp|P22792|CPN2_HUMAN Carboxypeptidase N subunit 2 OS=Homo sapiens GN=CPN2 PE=1 SV=3 975 1082 9.0E-06
sp|Q9ERV7|PIDD1_MOUSE p53-induced death domain-containing protein 1 OS=Mus musculus GN=Pidd1 PE=1 SV=1 570 747 9.0E-06
sp|Q52KR2|LRIG2_MOUSE Leucine-rich repeats and immunoglobulin-like domains protein 2 OS=Mus musculus GN=Lrig2 PE=1 SV=1 643 876 9.0E-06
sp|P40197|GPV_HUMAN Platelet glycoprotein V OS=Homo sapiens GN=GP5 PE=1 SV=1 563 745 9.0E-06
sp|D4A6D8|LRRT1_RAT Leucine-rich repeat transmembrane neuronal protein 1 OS=Rattus norvegicus GN=Lrrtm1 PE=3 SV=1 824 1057 9.0E-06
sp|Q8K377|LRRT1_MOUSE Leucine-rich repeat transmembrane neuronal protein 1 OS=Mus musculus GN=Lrrtm1 PE=2 SV=1 824 1057 9.0E-06
sp|Q8AVS8|LRC59_XENLA Leucine-rich repeat-containing protein 59 OS=Xenopus laevis GN=lrrc59 PE=2 SV=1 690 772 9.0E-06
sp|Q6NSJ5|LRC8E_HUMAN Volume-regulated anion channel subunit LRRC8E OS=Homo sapiens GN=LRRC8E PE=1 SV=2 865 1073 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0035556 intracellular signal transduction Yes
GO:0009190 cyclic nucleotide biosynthetic process Yes
GO:0004722 protein serine/threonine phosphatase activity Yes
GO:0006793 phosphorus metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0008152 metabolic process No
GO:0019438 aromatic compound biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0044281 small molecule metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0009165 nucleotide biosynthetic process No
GO:0008150 biological_process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0055086 nucleobase-containing small molecule metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0005488 binding No
GO:0009058 biosynthetic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0016787 hydrolase activity No
GO:1901293 nucleoside phosphate biosynthetic process No
GO:0065007 biological regulation No
GO:0004721 phosphoprotein phosphatase activity No
GO:0090407 organophosphate biosynthetic process No
GO:0042578 phosphoric ester hydrolase activity No
GO:0140096 catalytic activity, acting on a protein No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0016791 phosphatase activity No
GO:0044237 cellular metabolic process No
GO:0003824 catalytic activity No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0009987 cellular process No
GO:0050789 regulation of biological process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0044238 primary metabolic process No
GO:0006753 nucleoside phosphate metabolic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0009187 cyclic nucleotide metabolic process No
GO:0003674 molecular_function No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:0009117 nucleotide metabolic process No
GO:0018130 heterocycle biosynthetic process No
GO:0006807 nitrogen compound metabolic process No
GO:0007165 signal transduction No
GO:0050794 regulation of cellular process No
GO:0019637 organophosphate metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 67 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|038940
MTIAAVGVSSEVRLQIDDLIDDRGQVIEDVLADPQLAQMDPIDPTIAPFLVDEPPSPASTTFLPAPDHERSPSHS
FTSSKGFSKSSFTSFLSFRQSSSASRSFRASDSTAHLPSPDSKHRSSYDDWDASTVNSSTTQQTELRKKSSMFNI
LKRKASKVHLRHTSQEDSPPPPVPPKPADNYVFNLPVDPPHPFVQPPPSLHHPSSSKDKGKGKEKEREREQERDR
EREREKEKEKDRNRDRDRDKDRDKDGEKSREKDKEKKSKKRRIKGPPVPPKDDPLFPLDTNLDRMEGIVSAENLI
PLTNHAPENSLTDPPTFNNPFSSSDPQAGAINYGPSHISPTASMPFLNGQTPDPKEARPSFSTIRKDDGEWVTPQ
SWIVVGKDDTKDDMTAPDDDVSTDDETRAKSGPNSIIQSSLHPPSFRIGGSIKPSRRDKTREGKDELVMKIYRPN
GAPIQTAMGISLTVYDLIPTLLKRMVGDERRLNRLFLMERGKERIMDIRELPLNLICRRMTEAGYSWNDGRILLS
GDRLAFLLKFIFRDPDMGLGRRSLTADAPYQIPESELRLHNFETLDLSGRSLRTIPVALHQHADQIISLKLSRNP
MIDLPLDFVEACTSLCDLRLSNMSMRKIPANLVAAKALKRLDLSSNHIKIKELENANLQLIPELRGLLLHNNLLK
DLPQKFADFENLLNLNISSNRLPTIPDVVLQIKTLTELDVSFNYITDLPTNVGDMTSLQRFLFVGNSIKSIPNSF
WKLRNLEHVDCRRNQIGDLGIVMNLPRLETLNADHNAIHLLDLSMGKHVMKIDLSNNEITKVMVSLPPFGSTSLQ
LTTLDVSYASLTTLDGAVLRNLPTLVTLRIQHNSLAYLPDSIEELVHLETLICYENRLQRLPDTIGKLSKLITLD
AHSNNLREVPVAIWQCPSLCILNLSSNFLTTFPVPPLIPLYPMPDQTGRIADPPKIYDASHVISSILHPPLMFSL
ENLSISENKISSIDSLRNISFFRSLLSLNLSYNDISDLPKGFFRKMYRLEEFHICGNDLTMIPGHEEFSNLRELR
RLFLSGNKLTSLPAELGRLKRLKVMDVSNNCLRYNINNYGYDWNWNNNEDLYYLNLSGNKRFQVKRDNRHTFGSS
RSSRELHNPLSGFSSVPKLRILGLMDVTVTASDLPDEHEDRRVRSTSSLVGGLGYGIADSLNIDDSMTMLDLVHE
FPPINGTSRALFAMFGNAKPPKLPIGVSPNKHAKFLHDHFIPFFQNQLDHPYLQESNHFAVDVLRRSFLGLHQTI
HDMWFPPVQRKASMASVAGGLPTVNVDSGTARTGCSGLVVYIEGNRLFAANVGSAHGVISRKGQPFLVTRIHCPW
DEDELKRMRKSEGWVSPEGLVNNEVDVSRSFGYYQLLPVVNASPDIVEYEISETDEYLVLGNRALWDFVSYQTAV
DIASGRGEPSMIAQKLRDFAISYGSTGNIMVMVVRLKDYHERPLVRTPSMIESDSPFSPALYIPKSNHMVVDKSV
RRAEPEVPPPTGHIALVFTDIRNSTPLWELNPGMPAAIQIHNDLMRRRLRECGGYEFKTEGDAFLCSFPTIMAAV
WFCLSVQNQLLQENWPKEILECEDGKVIVDSEGNVLWKGISVRMGIHSGTPVCLQDPVTHRMDYYGPVINRAARV
SGLAKGGQIFCSAEVVQEIKASVLEAIEKTSLSKLQPAKAIAEVKQLGVIIKEVGEMKLKGLEVPEFISAIYTPG
LEGRHDFDAEEDPAPASVYLDVAHVREIGMLCLRLEALTSGRIFKPSNTARDLNLTIPLEDDPEDEDNPELWRDL
EVDPENLLPPMTTRWTDHDLLTTLDSFTCRIQNALQTLIKAYEADRINAPNIMNVLSNAGLDADTLLVMAELIGH
S*
Coding >AgabiH97|038940
ATGACCATCGCCGCCGTCGGCGTCAGCAGCGAGGTGAGGCTGCAGATAGACGATCTCATCGACGACCGCGGACAG
GTCATTGAGGATGTTCTCGCCGACCCGCAACTCGCACAGATGGACCCCATTGACCCAACAATTGCACCATTCCTC
GTGGACGAGCCTCCATCTCCTGCCTCGACGACGTTTCTGCCGGCGCCGGACCATGAGCGCTCGCCGTCGCACTCG
TTCACATCCTCCAAAGGCTTTTCCAAATCCTCCTTCACCTCCTTCCTCTCCTTCCGCCAGAGTAGTTCCGCCAGC
AGGTCTTTCCGTGCCTCGGACTCGACAGCACATCTCCCCAGTCCGGACTCTAAGCATCGATCTTCCTATGACGAC
TGGGACGCCTCTACCGTCAACTCGTCTACCACTCAGCAGACTGAACTCCGCAAGAAGAGCTCCATGTTTAATATC
CTCAAGCGCAAGGCGAGCAAGGTGCATCTTCGCCATACCTCTCAGGAAGATAGTCCACCACCACCCGTACCCCCC
AAACCTGCTGACAATTATGTATTCAACCTTCCTGTCGATCCTCCACATCCCTTCGTCCAACCCCCTCCATCCCTA
CACCACCCCAGCTCTTCAAAGGATAAAGGGAAGGGCAAGGAAAAAGAAAGAGAAAGAGAGCAAGAACGAGACAGG
GAGAGGGAGAGAGAGAAAGAAAAAGAAAAGGACAGGAACAGGGATAGGGATAGGGATAAAGACCGGGACAAAGAC
GGGGAAAAGTCGAGGGAGAAAGACAAAGAAAAAAAGAGCAAGAAGAGGCGCATCAAAGGTCCACCAGTTCCACCA
AAAGATGATCCTCTCTTTCCTCTTGACACCAACCTGGATCGCATGGAGGGTATCGTTTCTGCAGAAAACCTGATT
CCTCTTACAAATCACGCACCTGAAAACTCATTGACGGATCCACCCACTTTCAACAACCCCTTCTCTTCCTCCGAC
CCCCAGGCAGGCGCCATAAATTATGGTCCCTCACATATATCGCCGACAGCCTCCATGCCCTTCCTCAACGGTCAA
ACTCCTGATCCTAAAGAAGCCAGGCCCTCCTTTTCTACTATACGAAAAGACGATGGCGAATGGGTAACACCTCAG
AGTTGGATCGTCGTAGGTAAAGACGATACGAAAGACGACATGACCGCTCCCGACGACGACGTATCGACCGACGAC
GAAACGCGAGCAAAGAGCGGTCCGAACAGTATCATTCAGAGCAGCCTTCATCCACCGAGTTTCCGTATTGGCGGA
TCGATAAAACCGTCAAGAAGGGACAAAACCAGAGAAGGGAAAGATGAACTTGTTATGAAGATTTACCGCCCGAAT
GGTGCCCCCATTCAGACTGCAATGGGTATCAGTTTGACGGTATATGATTTGATACCAACGCTGCTCAAAAGAATG
GTTGGAGATGAAAGGCGTTTGAATCGGTTGTTTCTAATGGAACGTGGAAAGGAGCGCATCATGGATATCAGAGAA
TTACCCCTCAATCTTATTTGTCGTCGAATGACGGAAGCTGGATATTCATGGAACGATGGTCGGATTCTTCTCAGC
GGCGATCGTCTAGCCTTTCTTCTCAAATTCATCTTCCGAGATCCAGACATGGGACTCGGTCGTCGATCACTCACC
GCCGACGCCCCATACCAAATCCCCGAAAGCGAACTTCGACTACACAATTTTGAAACTCTCGATCTGTCAGGTCGA
AGTCTACGTACTATCCCCGTCGCCCTACATCAACACGCTGATCAAATCATTTCATTGAAACTTTCCCGAAATCCG
ATGATTGATTTACCTTTGGATTTTGTAGAGGCTTGTACGTCGTTATGTGACTTGCGGCTGTCCAATATGTCGATG
CGGAAGATTCCTGCGAATTTGGTTGCGGCTAAGGCGTTGAAGAGACTGGACCTTTCGTCGAACCATATCAAGATC
AAAGAACTCGAGAATGCGAATTTGCAACTTATACCGGAGCTGAGGGGGTTGCTGTTGCATAACAACCTGCTCAAG
GATCTACCGCAGAAGTTTGCTGATTTCGAAAATCTACTGAATCTCAATATCTCGAGTAATCGGTTACCGACGATA
CCGGATGTTGTGTTACAGATCAAGACACTCACCGAGCTTGATGTTTCCTTCAATTACATCACTGACCTTCCAACC
AATGTTGGTGATATGACGAGCTTGCAACGGTTTTTGTTCGTCGGCAACTCCATCAAAAGTATTCCTAATAGCTTT
TGGAAACTACGCAATCTGGAGCATGTTGATTGTCGAAGAAATCAAATTGGGGATTTGGGTATCGTGATGAATTTG
CCTCGGCTCGAGACATTGAACGCCGATCATAATGCCATTCACCTACTCGACCTCTCCATGGGAAAACATGTCATG
AAAATCGACCTGTCGAATAACGAGATTACGAAAGTCATGGTTTCGTTACCGCCTTTTGGTTCGACATCACTTCAA
CTTACGACCTTGGACGTTTCGTATGCGAGTTTAACGACATTGGATGGGGCGGTTTTGCGTAACCTTCCGACATTG
GTCACTCTTCGAATTCAACACAATTCCCTTGCCTATCTACCTGATTCTATCGAAGAACTCGTTCACCTGGAAACC
CTCATCTGTTATGAAAATCGATTACAACGACTTCCGGATACCATTGGAAAACTTTCAAAATTGATTACCTTGGAT
GCGCATAGCAACAACCTTCGTGAAGTTCCTGTTGCAATCTGGCAATGCCCTTCGCTGTGTATACTTAATCTTTCA
TCAAACTTTCTAACGACTTTTCCTGTACCGCCATTAATTCCTTTATACCCCATGCCGGATCAAACAGGTCGTATA
GCTGACCCGCCAAAAATTTATGATGCTTCGCACGTCATTTCAAGTATCCTCCATCCGCCACTCATGTTCTCCCTC
GAAAATCTCTCTATATCCGAAAACAAAATTTCGTCAATCGACAGTCTACGCAATATCTCATTTTTCCGTTCCCTG
CTCTCATTAAACCTCTCCTACAATGATATCAGCGATTTGCCCAAAGGGTTCTTTCGAAAGATGTATAGGTTGGAG
GAGTTTCATATTTGTGGGAACGATTTGACTATGATTCCTGGTCATGAGGAATTTAGCAATTTGAGGGAGTTGAGG
AGGTTGTTTTTGAGTGGGAATAAATTGACGAGTTTGCCGGCGGAGTTGGGGAGGTTGAAGAGGTTGAAGGTGATG
GATGTGAGCAATAATTGTTTGAGGTATAATATTAATAATTATGGATATGATTGGAATTGGAACAATAACGAGGAC
CTTTATTATCTCAATTTATCGGGAAACAAGCGGTTCCAGGTGAAACGTGACAATCGACATACGTTTGGATCTTCG
AGGAGCAGTCGTGAACTCCATAATCCTCTTTCTGGATTTTCGAGTGTGCCCAAGTTACGGATTCTGGGATTGATG
GACGTTACGGTCACCGCTAGTGATCTTCCAGATGAACATGAGGATCGTCGAGTTCGTTCCACGTCTTCTCTCGTT
GGGGGTCTTGGATACGGAATCGCCGACAGTCTGAATATAGATGACTCGATGACAATGCTCGACCTCGTACATGAA
TTTCCTCCCATCAATGGTACCAGTCGCGCCTTGTTCGCCATGTTTGGTAATGCCAAACCGCCGAAACTCCCAATA
GGCGTCTCACCCAATAAGCATGCGAAATTCCTCCACGATCATTTTATTCCCTTTTTTCAAAATCAATTGGATCAT
CCGTATTTGCAAGAAAGTAATCATTTTGCGGTGGATGTTTTGAGGAGATCGTTTTTGGGGTTGCATCAGACGATA
CATGATATGTGGTTTCCACCGGTTCAGAGAAAAGCGTCTATGGCGAGTGTGGCTGGTGGTTTACCGACTGTGAAT
GTCGATTCTGGGACTGCTAGGACGGGTTGTTCGGGTTTGGTGGTTTATATTGAGGGGAACAGATTGTTTGCGGCG
AATGTGGGTTCGGCGCATGGTGTTATTTCGAGGAAGGGTCAACCGTTTTTGGTTACGAGGATTCATTGTCCTTGG
GATGAGGATGAGTTGAAGAGGATGAGGAAGTCGGAAGGTTGGGTGTCACCTGAAGGATTGGTGAATAATGAAGTT
GACGTTTCGAGGTCGTTTGGCTATTATCAACTTTTACCCGTCGTCAATGCTTCTCCTGACATTGTGGAATACGAG
ATTTCGGAGACGGATGAGTATTTGGTTTTGGGGAATAGGGCTTTGTGGGACTTTGTGAGTTATCAGACGGCGGTG
GATATCGCTAGTGGGAGAGGTGAACCGTCGATGATTGCGCAGAAGTTGAGAGATTTTGCGATAAGCTATGGATCG
ACAGGCAATATTATGGTGATGGTGGTAAGGCTGAAGGATTATCATGAAAGGCCGCTTGTTCGGACACCATCGATG
ATTGAATCGGATTCACCCTTCTCTCCGGCCTTGTATATCCCCAAATCGAACCATATGGTGGTGGACAAGAGTGTA
CGACGAGCCGAACCAGAAGTCCCTCCACCAACAGGTCATATCGCGTTGGTATTCACTGACATCCGAAACTCGACT
CCTTTATGGGAACTGAACCCTGGTATGCCAGCGGCCATTCAAATTCACAACGATTTGATGAGGAGACGATTGAGG
GAGTGTGGTGGGTACGAATTCAAAACAGAAGGAGACGCTTTTTTGTGCAGTTTTCCGACTATCATGGCTGCTGTG
TGGTTCTGTCTTTCGGTGCAGAATCAATTGTTGCAGGAGAACTGGCCAAAGGAGATCTTAGAATGCGAGGATGGG
AAGGTTATCGTGGATTCGGAGGGGAATGTGCTTTGGAAAGGTATCTCGGTCAGGATGGGTATCCATAGTGGGACG
CCGGTGTGTTTGCAGGATCCTGTGACACATAGGATGGATTATTATGGTCCGGTTATTAATCGAGCGGCGAGGGTT
AGCGGATTGGCGAAGGGAGGACAGATTTTTTGTAGTGCGGAGGTGGTACAAGAGATCAAGGCATCGGTTTTGGAG
GCTATAGAAAAGACGTCTCTGTCGAAATTACAACCTGCAAAAGCGATCGCGGAAGTCAAGCAGTTGGGGGTCATT
ATCAAGGAGGTCGGAGAGATGAAACTCAAGGGTTTGGAGGTACCTGAATTTATTTCAGCGATTTATACCCCGGGA
CTGGAGGGCAGACATGATTTCGACGCGGAGGAAGATCCTGCACCTGCGAGCGTATACTTGGATGTTGCTCATGTA
CGCGAGATAGGTATGTTGTGTCTTCGACTGGAGGCGTTGACATCTGGACGGATATTCAAACCTTCAAATACCGCG
AGGGACCTGAATTTGACCATTCCTCTCGAGGATGATCCTGAAGACGAAGACAACCCTGAGCTATGGAGAGATCTG
GAGGTGGATCCTGAAAACCTGTTACCTCCGATGACGACGAGATGGACTGATCATGACCTCCTCACGACGCTGGAC
TCATTTACTTGTCGAATTCAGAACGCCCTTCAGACGCTTATCAAGGCATACGAAGCGGATCGAATTAATGCACCG
AATATCATGAATGTTCTCAGTAATGCTGGACTCGATGCTGATACGCTACTGGTCATGGCAGAACTTATTGGACAT
TCTTAA
Transcript >AgabiH97|038940
ATGACCATCGCCGCCGTCGGCGTCAGCAGCGAGGTGAGGCTGCAGATAGACGATCTCATCGACGACCGCGGACAG
GTCATTGAGGATGTTCTCGCCGACCCGCAACTCGCACAGATGGACCCCATTGACCCAACAATTGCACCATTCCTC
GTGGACGAGCCTCCATCTCCTGCCTCGACGACGTTTCTGCCGGCGCCGGACCATGAGCGCTCGCCGTCGCACTCG
TTCACATCCTCCAAAGGCTTTTCCAAATCCTCCTTCACCTCCTTCCTCTCCTTCCGCCAGAGTAGTTCCGCCAGC
AGGTCTTTCCGTGCCTCGGACTCGACAGCACATCTCCCCAGTCCGGACTCTAAGCATCGATCTTCCTATGACGAC
TGGGACGCCTCTACCGTCAACTCGTCTACCACTCAGCAGACTGAACTCCGCAAGAAGAGCTCCATGTTTAATATC
CTCAAGCGCAAGGCGAGCAAGGTGCATCTTCGCCATACCTCTCAGGAAGATAGTCCACCACCACCCGTACCCCCC
AAACCTGCTGACAATTATGTATTCAACCTTCCTGTCGATCCTCCACATCCCTTCGTCCAACCCCCTCCATCCCTA
CACCACCCCAGCTCTTCAAAGGATAAAGGGAAGGGCAAGGAAAAAGAAAGAGAAAGAGAGCAAGAACGAGACAGG
GAGAGGGAGAGAGAGAAAGAAAAAGAAAAGGACAGGAACAGGGATAGGGATAGGGATAAAGACCGGGACAAAGAC
GGGGAAAAGTCGAGGGAGAAAGACAAAGAAAAAAAGAGCAAGAAGAGGCGCATCAAAGGTCCACCAGTTCCACCA
AAAGATGATCCTCTCTTTCCTCTTGACACCAACCTGGATCGCATGGAGGGTATCGTTTCTGCAGAAAACCTGATT
CCTCTTACAAATCACGCACCTGAAAACTCATTGACGGATCCACCCACTTTCAACAACCCCTTCTCTTCCTCCGAC
CCCCAGGCAGGCGCCATAAATTATGGTCCCTCACATATATCGCCGACAGCCTCCATGCCCTTCCTCAACGGTCAA
ACTCCTGATCCTAAAGAAGCCAGGCCCTCCTTTTCTACTATACGAAAAGACGATGGCGAATGGGTAACACCTCAG
AGTTGGATCGTCGTAGGTAAAGACGATACGAAAGACGACATGACCGCTCCCGACGACGACGTATCGACCGACGAC
GAAACGCGAGCAAAGAGCGGTCCGAACAGTATCATTCAGAGCAGCCTTCATCCACCGAGTTTCCGTATTGGCGGA
TCGATAAAACCGTCAAGAAGGGACAAAACCAGAGAAGGGAAAGATGAACTTGTTATGAAGATTTACCGCCCGAAT
GGTGCCCCCATTCAGACTGCAATGGGTATCAGTTTGACGGTATATGATTTGATACCAACGCTGCTCAAAAGAATG
GTTGGAGATGAAAGGCGTTTGAATCGGTTGTTTCTAATGGAACGTGGAAAGGAGCGCATCATGGATATCAGAGAA
TTACCCCTCAATCTTATTTGTCGTCGAATGACGGAAGCTGGATATTCATGGAACGATGGTCGGATTCTTCTCAGC
GGCGATCGTCTAGCCTTTCTTCTCAAATTCATCTTCCGAGATCCAGACATGGGACTCGGTCGTCGATCACTCACC
GCCGACGCCCCATACCAAATCCCCGAAAGCGAACTTCGACTACACAATTTTGAAACTCTCGATCTGTCAGGTCGA
AGTCTACGTACTATCCCCGTCGCCCTACATCAACACGCTGATCAAATCATTTCATTGAAACTTTCCCGAAATCCG
ATGATTGATTTACCTTTGGATTTTGTAGAGGCTTGTACGTCGTTATGTGACTTGCGGCTGTCCAATATGTCGATG
CGGAAGATTCCTGCGAATTTGGTTGCGGCTAAGGCGTTGAAGAGACTGGACCTTTCGTCGAACCATATCAAGATC
AAAGAACTCGAGAATGCGAATTTGCAACTTATACCGGAGCTGAGGGGGTTGCTGTTGCATAACAACCTGCTCAAG
GATCTACCGCAGAAGTTTGCTGATTTCGAAAATCTACTGAATCTCAATATCTCGAGTAATCGGTTACCGACGATA
CCGGATGTTGTGTTACAGATCAAGACACTCACCGAGCTTGATGTTTCCTTCAATTACATCACTGACCTTCCAACC
AATGTTGGTGATATGACGAGCTTGCAACGGTTTTTGTTCGTCGGCAACTCCATCAAAAGTATTCCTAATAGCTTT
TGGAAACTACGCAATCTGGAGCATGTTGATTGTCGAAGAAATCAAATTGGGGATTTGGGTATCGTGATGAATTTG
CCTCGGCTCGAGACATTGAACGCCGATCATAATGCCATTCACCTACTCGACCTCTCCATGGGAAAACATGTCATG
AAAATCGACCTGTCGAATAACGAGATTACGAAAGTCATGGTTTCGTTACCGCCTTTTGGTTCGACATCACTTCAA
CTTACGACCTTGGACGTTTCGTATGCGAGTTTAACGACATTGGATGGGGCGGTTTTGCGTAACCTTCCGACATTG
GTCACTCTTCGAATTCAACACAATTCCCTTGCCTATCTACCTGATTCTATCGAAGAACTCGTTCACCTGGAAACC
CTCATCTGTTATGAAAATCGATTACAACGACTTCCGGATACCATTGGAAAACTTTCAAAATTGATTACCTTGGAT
GCGCATAGCAACAACCTTCGTGAAGTTCCTGTTGCAATCTGGCAATGCCCTTCGCTGTGTATACTTAATCTTTCA
TCAAACTTTCTAACGACTTTTCCTGTACCGCCATTAATTCCTTTATACCCCATGCCGGATCAAACAGGTCGTATA
GCTGACCCGCCAAAAATTTATGATGCTTCGCACGTCATTTCAAGTATCCTCCATCCGCCACTCATGTTCTCCCTC
GAAAATCTCTCTATATCCGAAAACAAAATTTCGTCAATCGACAGTCTACGCAATATCTCATTTTTCCGTTCCCTG
CTCTCATTAAACCTCTCCTACAATGATATCAGCGATTTGCCCAAAGGGTTCTTTCGAAAGATGTATAGGTTGGAG
GAGTTTCATATTTGTGGGAACGATTTGACTATGATTCCTGGTCATGAGGAATTTAGCAATTTGAGGGAGTTGAGG
AGGTTGTTTTTGAGTGGGAATAAATTGACGAGTTTGCCGGCGGAGTTGGGGAGGTTGAAGAGGTTGAAGGTGATG
GATGTGAGCAATAATTGTTTGAGGTATAATATTAATAATTATGGATATGATTGGAATTGGAACAATAACGAGGAC
CTTTATTATCTCAATTTATCGGGAAACAAGCGGTTCCAGGTGAAACGTGACAATCGACATACGTTTGGATCTTCG
AGGAGCAGTCGTGAACTCCATAATCCTCTTTCTGGATTTTCGAGTGTGCCCAAGTTACGGATTCTGGGATTGATG
GACGTTACGGTCACCGCTAGTGATCTTCCAGATGAACATGAGGATCGTCGAGTTCGTTCCACGTCTTCTCTCGTT
GGGGGTCTTGGATACGGAATCGCCGACAGTCTGAATATAGATGACTCGATGACAATGCTCGACCTCGTACATGAA
TTTCCTCCCATCAATGGTACCAGTCGCGCCTTGTTCGCCATGTTTGGTAATGCCAAACCGCCGAAACTCCCAATA
GGCGTCTCACCCAATAAGCATGCGAAATTCCTCCACGATCATTTTATTCCCTTTTTTCAAAATCAATTGGATCAT
CCGTATTTGCAAGAAAGTAATCATTTTGCGGTGGATGTTTTGAGGAGATCGTTTTTGGGGTTGCATCAGACGATA
CATGATATGTGGTTTCCACCGGTTCAGAGAAAAGCGTCTATGGCGAGTGTGGCTGGTGGTTTACCGACTGTGAAT
GTCGATTCTGGGACTGCTAGGACGGGTTGTTCGGGTTTGGTGGTTTATATTGAGGGGAACAGATTGTTTGCGGCG
AATGTGGGTTCGGCGCATGGTGTTATTTCGAGGAAGGGTCAACCGTTTTTGGTTACGAGGATTCATTGTCCTTGG
GATGAGGATGAGTTGAAGAGGATGAGGAAGTCGGAAGGTTGGGTGTCACCTGAAGGATTGGTGAATAATGAAGTT
GACGTTTCGAGGTCGTTTGGCTATTATCAACTTTTACCCGTCGTCAATGCTTCTCCTGACATTGTGGAATACGAG
ATTTCGGAGACGGATGAGTATTTGGTTTTGGGGAATAGGGCTTTGTGGGACTTTGTGAGTTATCAGACGGCGGTG
GATATCGCTAGTGGGAGAGGTGAACCGTCGATGATTGCGCAGAAGTTGAGAGATTTTGCGATAAGCTATGGATCG
ACAGGCAATATTATGGTGATGGTGGTAAGGCTGAAGGATTATCATGAAAGGCCGCTTGTTCGGACACCATCGATG
ATTGAATCGGATTCACCCTTCTCTCCGGCCTTGTATATCCCCAAATCGAACCATATGGTGGTGGACAAGAGTGTA
CGACGAGCCGAACCAGAAGTCCCTCCACCAACAGGTCATATCGCGTTGGTATTCACTGACATCCGAAACTCGACT
CCTTTATGGGAACTGAACCCTGGTATGCCAGCGGCCATTCAAATTCACAACGATTTGATGAGGAGACGATTGAGG
GAGTGTGGTGGGTACGAATTCAAAACAGAAGGAGACGCTTTTTTGTGCAGTTTTCCGACTATCATGGCTGCTGTG
TGGTTCTGTCTTTCGGTGCAGAATCAATTGTTGCAGGAGAACTGGCCAAAGGAGATCTTAGAATGCGAGGATGGG
AAGGTTATCGTGGATTCGGAGGGGAATGTGCTTTGGAAAGGTATCTCGGTCAGGATGGGTATCCATAGTGGGACG
CCGGTGTGTTTGCAGGATCCTGTGACACATAGGATGGATTATTATGGTCCGGTTATTAATCGAGCGGCGAGGGTT
AGCGGATTGGCGAAGGGAGGACAGATTTTTTGTAGTGCGGAGGTGGTACAAGAGATCAAGGCATCGGTTTTGGAG
GCTATAGAAAAGACGTCTCTGTCGAAATTACAACCTGCAAAAGCGATCGCGGAAGTCAAGCAGTTGGGGGTCATT
ATCAAGGAGGTCGGAGAGATGAAACTCAAGGGTTTGGAGGTACCTGAATTTATTTCAGCGATTTATACCCCGGGA
CTGGAGGGCAGACATGATTTCGACGCGGAGGAAGATCCTGCACCTGCGAGCGTATACTTGGATGTTGCTCATGTA
CGCGAGATAGGTATGTTGTGTCTTCGACTGGAGGCGTTGACATCTGGACGGATATTCAAACCTTCAAATACCGCG
AGGGACCTGAATTTGACCATTCCTCTCGAGGATGATCCTGAAGACGAAGACAACCCTGAGCTATGGAGAGATCTG
GAGGTGGATCCTGAAAACCTGTTACCTCCGATGACGACGAGATGGACTGATCATGACCTCCTCACGACGCTGGAC
TCATTTACTTGTCGAATTCAGAACGCCCTTCAGACGCTTATCAAGGCATACGAAGCGGATCGAATTAATGCACCG
AATATCATGAATGTTCTCAGTAATGCTGGACTCGATGCTGATACGCTACTGGTCATGGCAGAACTTATTGGACAT
TCTTAA
Gene >AgabiH97|038940
ATGACCATCGCCGCCGTCGGCGTCAGCAGCGAGGTGAGGCTGCAGATAGACGATCTCATCGACGACCGCGGACAG
GTCATTGAGGATGTTCTCGCCGACCCGCAACTCGCACAGATGGACCCCATTGACCCAACAATTGCACCATTCCTC
GTGGACGAGCCTGTGTGTCGACTTTTGCTGCTCTTTCCAATGACTGACGCTGTTTGCGTATAGCCATCTCCTGCC
TCGACGACGTTTCTGCCGGCGCCGGACCATGAGCGCTCGCCGTCGCACTCGTTCACATCCTCCAAAGGCTTTTCC
AAATCCTCCTTCACCTCCTTCCTCTCCTTCCGCCAGAGTAGTTCCGCCAGCAGGTCTTTCCGTGCCTCGGACTCG
ACAGCACATCTCCCCAGTCCGGACTCTAAGCATCGATCTTCCTATGACGACTGGGACGCCTCTACCGTCAACTCG
TCTACCACTCAGCAGACTGAACTCCGCAAGAAGAGCTCCATGTTTAATATCCTCAAGCGCAAGGCGAGCAAGGTG
CATCTTCGCCATACCTCTCAGGAAGATAGTCCACCACCACCCGTACCCCCCAAACCTGCTGACAATTATGTATTC
AACCTTCCTGTCGATCCTCCACATCCCTTCGTCCAACCCCCTCCATCCCTACACCACCCCAGCTCTTCAAAGGAT
AAAGGGAAGGGCAAGGAAAAAGAAAGAGAAAGAGAGCAAGAACGAGACAGGGAGAGGGAGAGAGAGAAAGAAAAA
GAAAAGGACAGGAACAGGGATAGGGATAGGGATAAAGACCGGGACAAAGACGGGGAAAAGTCGAGGGAGAAAGAC
AAAGAAAAAAAGAGCAAGAAGAGGCGCATCAAAGGTCCACCAGTTCCACCAAAAGATGATCCTCTCTTTCCTCTT
GACACCAACCTGGATCGCATGGAGGGTATCGTTTCTGCAGAAAACCTGATTCCTCTTACAAATCACGCACCTGAA
AACTCATTGACGGATCCACCCACTTTCAACAACCCCTTCTCTTCCTCCGACCCCCAGGCAGGCGCCATAAATTAT
GGTCCCTCACATATATCGCCGACAGCCTCCATGCCCTTCCTCAACGGTCAAACTCCTGATCCTAAAGAAGCCAGG
CCCTCCTTTTCTACTATACGAAAAGACGATGGCGAATGGGTAACACCTCAGAGTTGGATCGTCGTAGGTAAAGAC
GATACGAAAGACGACATGACCGCTCCCGACGACGACGTATCGACCGACGACGAAACGCGAGCAAAGAGCGGTCCG
AACAGTATCATTCAGAGCAGCCTTCATCCACCGAGTTTCCGTATTGGCGGATCGATAAAACCGTCAAGAAGGGAC
AAAACCAGAGAAGGGAAAGATGAACTTGTTATGAAGATTTACCGCCCGAATGGTGCCCCCATTCAGACTGCAATG
GGTATCAGTTTGACGGTATATGATTTGATACCAACGCTGCTCAAAAGAATGGTTGGAGATGAAAGGCGTTTGAAT
CGGTTGTTTCTAATGGAACGTGGAAAGGGTGAGTTGAAAATATCTCTACCCACACTGTTGAGTAACGTTTGTCAT
GAACAGAGCGCATCATGGATATCAGAGAATTACCCCTCAATCTTATTTGTCGTCGAATGACGGAAGCTGGATATT
CATGGAACGATGGTCGGATTCTTCTCAGCGGCGATCGTCTAGCCTTTCTTCTCAAATTCATCTTCCGAGATCCAG
ACATGGGACTCGGTCGTCGATCACTCACCGCCGACGCCCCATACCAAATCCCCGAAAGCGAACTTCGACTACACA
ATTTTGAAACTCTCGATCTGTCAGGTCGAAGTCTACGTACTATCCCCGTCGCCCTACATCAACACGCTGATCAAA
TCATTTCATTGAAACTTTCCCGAAATCCGATGATTGATTTACCTTTGGATTTTGTAGAGGCTTGTACGTCGTTAT
GTGACTTGCGGCTGTCCAATATGTCGATGCGGAAGATTCCTGCGAATTTGGTTGCGGCTAAGGCGTTGAAGAGAC
TGGACCTTTCGTCGAACCATATCAAGATCAAAGAACTCGAGAATGCGAATTTGCAACTTATACCGGAGCTGAGGG
GGTTGCTGTTGCATAACAACCTGCTCAAGGATCTACCGCAGAAGTTTGCTGATTTCGAAAATCTACTGAATCTCA
ATATCTCGAGTAATCGGTTACCGACGATACCGGATGTTGTGTTACAGATCAAGACACTCACCGAGCTTGATGTTT
CCTTCAATTACATCACTGACCTTCCAACCAATGTTGGTGATATGACGAGCTTGCAACGGTTTTTGTTCGTCGGCA
ACTCCATCAAAAGTATTCCTAATAGCTTTTGGAAACTACGCAATCTGGAGCATGTTGATTGTCGAAGAAATCAAA
TTGGGGATTTGGGTATCGTGATGAATTTGCCTCGGCTCGAGACATTGAACGCCGATCATAATGCCATTCACCTAC
TCGACCTCTCCATGGGAAAACATGTCATGAAAATCGACCTGTCGAATAACGAGATTACGAAAGTCATGGTTTCGT
TACCGCCTTTTGGTTCGACATCACTTCAACTTACGACCTTGGACGTTTCGTATGCGAGTTTAACGACATTGGATG
GGGCGGTTTTGCGTAACCTTCCGACATTGGTCACTCTTCGAATTCAACACAATTCCCTTGCCTATCTACCTGATT
CTATCGAAGAACTCGTTCACCTGGAAACCCTCATCTGTTATGAAAATCGATTACAACGACTTCCGGATACCATTG
GAAAACTTTCAAAATTGATTACCTTGGATGCGCATAGCAACAACCTTCGTGAAGTTCCTGTTGCAATCTGGCAAT
GCCCTTCGCTGTGTATACTTAATCTTTCATCAAACTTTCTAACGACTTTTCCTGTACCGCCATTAATTCCTTTAT
ACCCCATGCCGGATCAAACAGGTCGTATAGCTGACCCGCCAAAAATTTATGATGCTTCGCACGTCATTTCAAGTA
TCCTCCATCCGCCACTCATGTTCTCCCTCGAAAATCTCTCTATATCCGAAAACAAAATTTCGTCAATCGACAGTC
TACGCAATATCTCATTTTTCCGTTCCCTGCTCTCATTAAACCTCTCCTACAATGATATCAGCGATTTGCCCAAAG
GGTTCTTTCGAAAGATGTATAGGTTGGAGGAGTTTCATATTTGTGGGAACGATTTGACTATGATTCCTGGTCATG
AGGAATTTAGCAATTTGAGGGAGTTGAGGAGGTTGTTTTTGAGTGGGAATAAATTGACGAGTTTGCCGGCGGAGT
TGGGGAGGTTGAAGAGGTTGAAGGTGATGGATGTGAGCAATAATTGTTTGAGGTATAATATTAATAATTATGGAT
ATGATTGGAATTGGTGAGTTCTCGGTTCGCCTGGTCTTTGAATTGTTTTTTTTCTGAAGAGGTTTTTTTTTGGTT
TGTAGGAACAATAACGAGGACCTTTATTATCTCAATTTATCGGGAAACAAGCGGTTCCAGGTGAAACGTGACAAT
CGACATACGTTTGGATCTTCGAGGAGCAGTCGTGAACTCCATAATCCTCTTTCTGGATTTTCGAGTGTGCCCAAG
TTACGGATTCTGGGATTGATGGACGTTACGGTCACCGCTAGTGATCTTCCAGATGAACATGAGGATCGTCGAGTT
CGTTCCACGTCTTCTCTCGTTGGGGGTCTTGGATACGGAATCGCCGACAGTCTGAATATAGATGACTCGATGACA
ATGCTCGACCTCGTACATGAATTTCCTCCCATCAATGGTACCAGTCGCGCCTTGTTCGCCATGTTTGGTAATGCC
AAACCGCCGAAACTCCCAATAGGCGTCTCACCCAATAAGCATGCGAAATTCCTCCACGATCATTTTATTCCCTTT
TTTCAAAATCAATTGGATCATCCGTATTTGCAAGAAAGTAATCATTTTGCGGTGGATGTTTTGAGGAGATCGTTT
TTGGGGTTGCATCAGACGATACATGATATGTGGTTTCCACCGGTTCAGAGAAAAGCGTCTATGGCGAGTGTGGCT
GGTGGTTTACCGACTGTGAATGTCGATTCTGGGACTGCTAGGACGGGTTGTTCGGGTTTGGTGGTTTATATTGAG
GGGAACAGATTGTTTGCGGCGAATGTGGGTTCGGCGCATGGTGTTATTTCGAGGAAGGGTCAACCGTTTTTGGTT
ACGAGGATTCATTGTCCTTGGGATGAGGATGAGTTGAAGAGGATGAGGAAGTCGGAAGGTTGGGTGTCACCTGAA
GGATTGGTGAATAATGAAGTTGACGTTTCGAGGTCGTTTGGCTATTATCAACTTTTACCCGTCGTCAATGCTTCT
CCTGACATTGTGGAATACGAGATTTCGGAGACGGATGAGTATTTGGTTTTGGGGAATAGGGCTTTGTGGGACTTT
GTGAGTTATCAGACGGCGGTGGATATCGCTAGTGGGAGAGGTGAACCGTCGATGATTGCGCAGAAGTTGAGAGAT
TTTGCGATAAGCTATGGATCGACAGGCAATATTATGGTGATGGTGGTAAGGCTGAAGGATTATCATGAAAGGCCG
CTTGTTCGGACACCATCGATGATTGAATCGGATTCACCCTTCTCTCCGGCCTTGTATATCCCCAAATCGAACCAT
ATGGTGGTGGACAAGAGTGTACGACGAGCCGAACCAGAAGTCCCTCCACCAACAGGTCATATCGCGTTGGTATTC
ACTGACATCCGAAACTCGACTCCTTTATGGGAACTGAACCCTGGTATGCCAGCGGCCATTCAAATTCACAACGAT
TTGATGAGGAGACGATTGAGGGAGTGTGGTGGGTACGAATTCAAAACAGAAGGAGACGCTTTTTTGTGCAGTTTT
CCGACTATCATGGCTGCTGTGTGGTTCTGTCTTTCGGTGCAGAATCAATTGTTGCAGGAGAACTGGCCAAAGGAG
ATCTTAGAATGCGAGGATGGGAAGGTTATCGTGGATTCGGAGGGGAATGTGCTTTGGAAAGGTATCTCGGTCAGG
ATGGGTATCCATAGTGGGACGCCGGTGTGTTTGCAGGATCCTGTGACACATAGGATGGATTATTATGGTCCGGTT
ATTAATCGAGCGGCGAGGGTTAGCGGATTGGCGAAGGGAGGACAGATTTTTTGTAGTGCGGAGGTGGTACAAGAG
ATCAAGGCATCGGTTTTGGAGGCTATAGAAAAGACGTCTCTGTCGAAATTACAACCTGCAAAAGCGATCGCGGAA
GTCAAGCAGTTGGGGGTCATTATCAAGGAGGTCGGAGAGATGAAACTCAAGGGTTTGGAGGTACCTGAATTTATT
TCAGCGATTTATACCCCGGGACTGGAGGGCAGACATGATTTCGACGCGGAGGAAGATCCTGCACCTGCGAGCGTA
TACTTGGATGTTGCTCATGTACGCGAGATAGGTATGTTGTGTCTTCGACTGGAGGCGTTGACATCTGGACGGATA
TTCAAACCTTCAAATACCGCGAGGGACCTGAATTTGACCATTCCTCTCGAGGATGATCCTGAAGACGAAGACAAC
CCTGAGCTATGGAGAGATCTGGAGGTGGATCCTGAAAACCTGTTACCTCCGATGACGACGAGATGGACTGATCAT
GACCTCCTCACGACGCTGGACTCATTTACTTGTCGAATTCAGAACGCCCTTCAGACGCTTATCAAGGCATACGAA
GCGGATCGAATTAATGCACCGAATATCATGAATGTTCTCAGTAATGCTGGACTCGATGCTGATACGCTACTGGTC
ATGGCAGAACTTATTGGACATTCTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail