Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|038900
Gene name
Locationscaffold_2:77964..79018
Strand-
Gene length (bp)1054
Transcript length (bp)1005
Coding sequence length (bp)1005
Protein length (aa) 335

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.759 0.5212 0.1283 0.0448 0.2264 0.0516 0.3378 0.1521 0.2664 0.0192

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Orthologs

Orthofinder run ID1
Orthogroup1266
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|038860
Agaricus bisporus var bisporus H39 AgabiH39|038870
Agaricus bisporus var bisporus H39 AgabiH39|038890
Agaricus bisporus var bisporus H39 AgabiH39|038930
Agaricus bisporus var bisporus H39 AgabiH39|039040
Agaricus bisporus var bisporus H39 AgabiH39|238500
Agaricus bisporus var bisporus H39 AgabiH39|295900
Agaricus bisporus var bisporus H97 AgabiH97|038930
Agaricus bisporus var bisporus H97 AgabiH97|038920
Agaricus bisporus var bisporus H97 AgabiH97|038910
Agaricus bisporus var bisporus H97 AgabiH97|038900 (this protein)
Agaricus bisporus var bisporus H97 AgabiH97|038860
Agaricus bisporus var bisporus H97 AgabiH97|038870
Agaricus bisporus var bisporus H97 AgabiH97|039040
Agaricus bisporus var bisporus H97 AgabiH97|038850
Agaricus bisporus var bisporus H97 AgabiH97|038890
Agaricus bisporus var bisporus H97 AgabiH97|063380

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|038900
MTLMAVEEDTEAEMLSFKIALVHILFADWMIGPHGQPEVTGDSRVDVWSGCVILDEEGQGTGLQVEQLASVRISV
HLGKPLFGVSLRGSLVAFTVQWRLFGTTVYGCDAIIIDWMSQLSQSQLFRRKTVNYLTDSAGERRVEVMLLPDDR
LLTVPSPDLCIYDLSLVPWSSEERPVCVDMSVPERQSCSVTVPGTSVQHPCGFSKVFHLPDNEYRLVFNTLAGIR
GLIVRYTDTGSLEARAVELLHWREKMDKYIREFRSDFSYNYGVARSKSGLLLRVRFSWPDEESSFETGTSLILDE
TNEMPLVMNMDVAAGRLAWIAAESGRVAMLDFNS*
Coding >AgabiH97|038900
ATGACTCTGATGGCTGTTGAAGAGGATACCGAGGCTGAAATGTTGTCTTTCAAAATCGCCCTGGTCCATATTCTG
TTTGCCGACTGGATGATAGGGCCACATGGACAACCTGAGGTGACTGGGGATTCGCGGGTTGATGTGTGGTCGGGT
TGTGTTATCCTGGACGAGGAGGGCCAGGGAACAGGTTTACAAGTTGAGCAGCTTGCATCAGTTCGCATATCTGTG
CATCTTGGCAAACCTTTATTCGGTGTATCACTACGCGGTTCCCTTGTTGCCTTCACTGTGCAATGGCGTTTGTTT
GGTACGACAGTCTATGGATGCGATGCGATAATTATCGACTGGATGTCGCAACTGAGCCAGAGTCAGTTGTTCAGA
CGCAAAACCGTCAACTATCTAACTGATTCTGCCGGAGAACGGAGGGTCGAAGTAATGTTGCTTCCCGACGACCGA
TTGCTTACCGTTCCCTCGCCAGACCTTTGCATTTACGACCTTTCATTAGTTCCATGGTCCTCAGAGGAGAGGCCT
GTGTGCGTCGACATGTCTGTACCGGAACGGCAGTCATGTAGTGTCACTGTGCCTGGAACTTCCGTCCAGCATCCT
TGTGGTTTCTCCAAGGTGTTCCATCTGCCAGACAATGAGTATCGACTGGTATTCAATACCTTGGCCGGGATACGG
GGGCTTATTGTGCGCTATACAGACACAGGTAGCTTAGAGGCAAGGGCAGTGGAGCTCCTCCACTGGAGGGAGAAA
ATGGATAAATATATCAGGGAATTTCGATCCGATTTCTCGTATAATTACGGGGTTGCCCGTTCTAAATCGGGTCTC
CTTTTACGCGTTCGTTTTTCCTGGCCTGACGAGGAAAGCTCGTTCGAAACAGGGACGTCTCTCATCTTGGACGAG
ACAAACGAGATGCCTTTGGTTATGAACATGGATGTCGCAGCTGGAAGGCTGGCATGGATTGCGGCCGAGAGCGGC
CGAGTGGCTATGCTGGATTTTAATTCGTGA
Transcript >AgabiH97|038900
ATGACTCTGATGGCTGTTGAAGAGGATACCGAGGCTGAAATGTTGTCTTTCAAAATCGCCCTGGTCCATATTCTG
TTTGCCGACTGGATGATAGGGCCACATGGACAACCTGAGGTGACTGGGGATTCGCGGGTTGATGTGTGGTCGGGT
TGTGTTATCCTGGACGAGGAGGGCCAGGGAACAGGTTTACAAGTTGAGCAGCTTGCATCAGTTCGCATATCTGTG
CATCTTGGCAAACCTTTATTCGGTGTATCACTACGCGGTTCCCTTGTTGCCTTCACTGTGCAATGGCGTTTGTTT
GGTACGACAGTCTATGGATGCGATGCGATAATTATCGACTGGATGTCGCAACTGAGCCAGAGTCAGTTGTTCAGA
CGCAAAACCGTCAACTATCTAACTGATTCTGCCGGAGAACGGAGGGTCGAAGTAATGTTGCTTCCCGACGACCGA
TTGCTTACCGTTCCCTCGCCAGACCTTTGCATTTACGACCTTTCATTAGTTCCATGGTCCTCAGAGGAGAGGCCT
GTGTGCGTCGACATGTCTGTACCGGAACGGCAGTCATGTAGTGTCACTGTGCCTGGAACTTCCGTCCAGCATCCT
TGTGGTTTCTCCAAGGTGTTCCATCTGCCAGACAATGAGTATCGACTGGTATTCAATACCTTGGCCGGGATACGG
GGGCTTATTGTGCGCTATACAGACACAGGTAGCTTAGAGGCAAGGGCAGTGGAGCTCCTCCACTGGAGGGAGAAA
ATGGATAAATATATCAGGGAATTTCGATCCGATTTCTCGTATAATTACGGGGTTGCCCGTTCTAAATCGGGTCTC
CTTTTACGCGTTCGTTTTTCCTGGCCTGACGAGGAAAGCTCGTTCGAAACAGGGACGTCTCTCATCTTGGACGAG
ACAAACGAGATGCCTTTGGTTATGAACATGGATGTCGCAGCTGGAAGGCTGGCATGGATTGCGGCCGAGAGCGGC
CGAGTGGCTATGCTGGATTTTAATTCGTGA
Gene >AgabiH97|038900
ATGACTCTGATGGCTGTTGAAGAGGATACCGAGGCTGAAATGTTGTCTTTCAAAATCGCCCTGGTCCATATTCTG
TTTGCCGACTGGATGATAGGGCCACATGGACAACCTGAGGTGACTGGGGATTCGCGGGTTGATGTGTGGTCGGGT
TGTGTTATCCTGGACGAGGAGGGCCAGGGAACAGGTTTACAAGTTGAGCAGCTTGCATCAGTTCGCATATCTGTG
CATCTTGGCAAACCTTTATTCGGTGTATCACTACGCGGTTCCCTTGTTGCCTTCACTGTGCAATGGCGTTTGTTT
GGTACGACAGTCTATGGATGCGATGCGATAATTATCGACTGGATGTCGCAACTGAGCCAGAGTCAGTTGTTCAGA
CGCAAAACCGTCAACTATCTAACTGATTCTGCCGGAGAACGGAGGGTGAGTTAACCTCTGATTCCAAAATACATT
ACTGACCTGCTTACTTTAGGTCGAAGTAATGTTGCTTCCCGACGACCGATTGCTTACCGTTCCCTCGCCAGACCT
TTGCATTTACGACCTTTCATTAGTTCCATGGTCCTCAGAGGAGAGGCCTGTGTGCGTCGACATGTCTGTACCGGA
ACGGCAGTCATGTAGTGTCACTGTGCCTGGAACTTCCGTCCAGCATCCTTGTGGTTTCTCCAAGGTGTTCCATCT
GCCAGACAATGAGTATCGACTGGTATTCAATACCTTGGCCGGGATACGGGGGCTTATTGTGCGCTATACAGACAC
AGGTAGCTTAGAGGCAAGGGCAGTGGAGCTCCTCCACTGGAGGGAGAAAATGGATAAATATATCAGGGAATTTCG
ATCCGATTTCTCGTATAATTACGGGGTTGCCCGTTCTAAATCGGGTCTCCTTTTACGCGTTCGTTTTTCCTGGCC
TGACGAGGAAAGCTCGTTCGAAACAGGGACGTCTCTCATCTTGGACGAGACAAACGAGATGCCTTTGGTTATGAA
CATGGATGTCGCAGCTGGAAGGCTGGCATGGATTGCGGCCGAGAGCGGCCGAGTGGCTATGCTGGATTTTAATTC
GTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail