Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|038890
Gene name
Locationscaffold_2:76030..77696
Strand-
Gene length (bp)1666
Transcript length (bp)1443
Coding sequence length (bp)1443
Protein length (aa) 481

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12937 F-box-like F-box-like 4.9E-06 21 64

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.638 0.4661 0.0961 0.0665 0.1933 0.0242 0.1797 0.2076 0.2228 0.0038

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Orthologs

Orthofinder run ID1
Orthogroup1266
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|038860
Agaricus bisporus var bisporus H39 AgabiH39|038870
Agaricus bisporus var bisporus H39 AgabiH39|038890
Agaricus bisporus var bisporus H39 AgabiH39|038930
Agaricus bisporus var bisporus H39 AgabiH39|039040
Agaricus bisporus var bisporus H39 AgabiH39|238500
Agaricus bisporus var bisporus H39 AgabiH39|295900
Agaricus bisporus var bisporus H97 AgabiH97|038930
Agaricus bisporus var bisporus H97 AgabiH97|038920
Agaricus bisporus var bisporus H97 AgabiH97|038910
Agaricus bisporus var bisporus H97 AgabiH97|038900
Agaricus bisporus var bisporus H97 AgabiH97|038860
Agaricus bisporus var bisporus H97 AgabiH97|038870
Agaricus bisporus var bisporus H97 AgabiH97|039040
Agaricus bisporus var bisporus H97 AgabiH97|038850
Agaricus bisporus var bisporus H97 AgabiH97|038890 (this protein)
Agaricus bisporus var bisporus H97 AgabiH97|063380

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|038890
MGSMTPACQKDKKESPKTGFSSLPAEIVAEIFKQLHWKDLLNARQTSALLYNASKTREIWKTLIRTHADAAHGPP
TIFDKPMRMYNTGKLEERFLRWMKTESTWLNEIPLNEKYIPDSSHEFLYSHLLRGGRWLICSDSGGEVLYCDLES
PETGFVPLIPYPFSCRPLVHILFADWMKGPHGQPEVTGDSRVDVWSGRVILDEDGQVMGLQVEQLASVRISLYLG
QPLFGVSLRGSLVAFTVQWRLFGTTIYACDAIIIDWKSQPSRNQSFRRKIVNFLSSFAGDGRKLEVMLLPGDRVL
TVPPPGLRIYDHSLVPWSSEERPLCVDMSIPKQHACTVNVPGTSIQHPCGFSELFSLPDNEYRVVFNTIAGIRGL
IMRYSEAGEFQATALELLNWSEKMDFTISEYRSHFLYTCGVARSKSDHLLRVRFSWPDEEGSFETGMAPILDEPN
ETPLVMNMDVAAGRLVWIATESGRVAMMDL*
Coding >AgabiH97|038890
ATGGGAAGTATGACACCAGCCTGCCAGAAAGATAAGAAGGAATCACCAAAGACTGGATTCAGCTCGTTGCCAGCA
GAAATCGTCGCGGAAATTTTCAAGCAGTTACATTGGAAGGATCTACTAAACGCACGCCAGACTTCTGCTCTCCTT
TATAACGCGTCCAAAACCAGAGAGATATGGAAAACTCTGATTAGAACCCACGCTGATGCTGCTCATGGGCCTCCG
ACGATATTCGACAAACCCATGCGCATGTACAACACTGGCAAACTCGAGGAGCGGTTTCTCCGTTGGATGAAAACC
GAGTCCACCTGGCTCAATGAAATCCCTTTGAATGAAAAGTACATCCCGGATTCTTCACACGAATTCCTGTACTCT
CATCTCCTTCGAGGAGGCCGATGGCTCATCTGCTCCGACTCTGGAGGCGAGGTGCTCTACTGCGATCTCGAATCA
CCTGAGACTGGTTTTGTTCCTCTGATCCCTTATCCGTTCTCGTGCCGGCCCCTGGTCCATATTCTGTTTGCCGAC
TGGATGAAAGGTCCACATGGACAACCTGAGGTGACTGGGGATTCGCGGGTTGATGTGTGGTCGGGTCGGGTTATC
TTAGACGAGGACGGCCAGGTAATGGGTTTGCAAGTTGAGCAACTTGCATCCGTTCGCATATCCTTGTATCTTGGT
CAACCTTTATTCGGCGTATCTTTACGTGGTTCCCTTGTTGCCTTCACTGTGCAATGGCGCTTGTTTGGCACGACA
ATTTATGCATGTGATGCGATAATTATCGACTGGAAGTCGCAACCGAGCAGGAATCAATCGTTCAGACGCAAAATC
GTAAATTTTCTATCTAGTTTCGCTGGTGATGGTCGGAAGCTCGAAGTGATGTTACTTCCTGGAGACCGAGTGCTT
ACCGTGCCTCCCCCAGGCCTTCGCATCTATGACCATTCATTGGTTCCATGGTCCTCAGAGGAGAGGCCTCTGTGC
GTTGATATGTCTATACCCAAACAACATGCATGTACCGTCAATGTACCCGGGACTTCTATCCAACATCCTTGTGGC
TTCTCAGAGTTATTTTCTCTCCCGGATAATGAATATCGAGTGGTGTTCAACACCATAGCTGGGATAAGAGGACTC
ATCATGCGTTATTCGGAAGCAGGCGAATTTCAGGCAACAGCACTGGAACTCCTCAACTGGAGTGAGAAGATGGAC
TTCACTATCAGTGAATACCGATCACATTTCTTGTATACTTGTGGGGTTGCCCGCTCTAAATCGGATCACCTTTTA
CGTGTTCGTTTTTCCTGGCCTGACGAGGAAGGCTCGTTCGAAACAGGAATGGCTCCTATCTTAGACGAGCCAAAC
GAGACGCCTTTGGTTATGAACATGGATGTCGCAGCTGGAAGGCTGGTATGGATAGCCACTGAGAGTGGTCGAGTG
GCTATGATGGATTTATAG
Transcript >AgabiH97|038890
ATGGGAAGTATGACACCAGCCTGCCAGAAAGATAAGAAGGAATCACCAAAGACTGGATTCAGCTCGTTGCCAGCA
GAAATCGTCGCGGAAATTTTCAAGCAGTTACATTGGAAGGATCTACTAAACGCACGCCAGACTTCTGCTCTCCTT
TATAACGCGTCCAAAACCAGAGAGATATGGAAAACTCTGATTAGAACCCACGCTGATGCTGCTCATGGGCCTCCG
ACGATATTCGACAAACCCATGCGCATGTACAACACTGGCAAACTCGAGGAGCGGTTTCTCCGTTGGATGAAAACC
GAGTCCACCTGGCTCAATGAAATCCCTTTGAATGAAAAGTACATCCCGGATTCTTCACACGAATTCCTGTACTCT
CATCTCCTTCGAGGAGGCCGATGGCTCATCTGCTCCGACTCTGGAGGCGAGGTGCTCTACTGCGATCTCGAATCA
CCTGAGACTGGTTTTGTTCCTCTGATCCCTTATCCGTTCTCGTGCCGGCCCCTGGTCCATATTCTGTTTGCCGAC
TGGATGAAAGGTCCACATGGACAACCTGAGGTGACTGGGGATTCGCGGGTTGATGTGTGGTCGGGTCGGGTTATC
TTAGACGAGGACGGCCAGGTAATGGGTTTGCAAGTTGAGCAACTTGCATCCGTTCGCATATCCTTGTATCTTGGT
CAACCTTTATTCGGCGTATCTTTACGTGGTTCCCTTGTTGCCTTCACTGTGCAATGGCGCTTGTTTGGCACGACA
ATTTATGCATGTGATGCGATAATTATCGACTGGAAGTCGCAACCGAGCAGGAATCAATCGTTCAGACGCAAAATC
GTAAATTTTCTATCTAGTTTCGCTGGTGATGGTCGGAAGCTCGAAGTGATGTTACTTCCTGGAGACCGAGTGCTT
ACCGTGCCTCCCCCAGGCCTTCGCATCTATGACCATTCATTGGTTCCATGGTCCTCAGAGGAGAGGCCTCTGTGC
GTTGATATGTCTATACCCAAACAACATGCATGTACCGTCAATGTACCCGGGACTTCTATCCAACATCCTTGTGGC
TTCTCAGAGTTATTTTCTCTCCCGGATAATGAATATCGAGTGGTGTTCAACACCATAGCTGGGATAAGAGGACTC
ATCATGCGTTATTCGGAAGCAGGCGAATTTCAGGCAACAGCACTGGAACTCCTCAACTGGAGTGAGAAGATGGAC
TTCACTATCAGTGAATACCGATCACATTTCTTGTATACTTGTGGGGTTGCCCGCTCTAAATCGGATCACCTTTTA
CGTGTTCGTTTTTCCTGGCCTGACGAGGAAGGCTCGTTCGAAACAGGAATGGCTCCTATCTTAGACGAGCCAAAC
GAGACGCCTTTGGTTATGAACATGGATGTCGCAGCTGGAAGGCTGGTATGGATAGCCACTGAGAGTGGTCGAGTG
GCTATGATGGATTTATAG
Gene >AgabiH97|038890
ATGGGAAGTATGACACCAGCCTGCCAGAAAGATGTGAGTCTTTATGGGATACCTGAGTGCCTACTCACGAATAAG
TATAGAAGAAGGAATCACCAAAGACTGGATTCAGCTCGTTGCCAGCAGAAATCGTCGCGGAAATTTTCAAGCAGT
TACATTGGAAGGATCTACTAAACGCACGCCAGGTGGGTGTGGCTGCACCTGCCAGATACGCCGTATTGATCTAAC
CTGGTAGACTTCTGCTCTCCTTTATAACGCGTCCAAAACCAGAGAGATATGGAAAACTCTGATTAGAACCCACGC
TGATGCTGCTCATGGGCCTCCGACGATATTCGACAAACCCATGCGCATGTACAACACTGGCAAACTCGAGGAGCG
GTTTCTCCGTTGGATGAAAACCGAGTCCACCTGGCTCAATGAAATCCCTTTGAATGAAAAGTACATCCCGGATTC
TTCACACGAATTCCTGTACTCTCATCTCCTTCGAGGAGGCCGATGGCTCATCTGCTCCGACTCTGGAGGCGAGGT
GCTCTACTGCGATCTCGAATCACCTGAGACTGGTTTTGTTCCTCTGATCCCTTATCCGTTCTCGTGCCGGCGTAA
ATCTATGGCTATGATGGCTGTCGAAGAGGATCCCGAGGCTGACCCGAGGCTGAAATTTTGTCTTTCAAAATAGCC
CTGGTCCATATTCTGTTTGCCGACTGGATGAAAGGTCCACATGGACAACCTGAGGTGACTGGGGATTCGCGGGTT
GATGTGTGGTCGGGTCGGGTTATCTTAGACGAGGACGGCCAGGTAATGGGTTTGCAAGTTGAGCAACTTGCATCC
GTTCGCATATCCTTGTATCTTGGTCAACCTTTATTCGGCGTATCTTTACGTGGTTCCCTTGTTGCCTTCACTGTG
CAATGGCGCTTGTTTGGCACGACAATTTATGCATGTGATGCGATAATTATCGACTGGAAGTCGCAACCGAGCAGG
AATCAATCGTTCAGACGCAAAATCGTAAATTTTCTATCTAGTTTCGCTGGTGATGGTCGGAAGGTGAGGTGGGCT
CTGATTCCAGAATACGCTCTTGACCTGCCTATTCTAGCTCGAAGTGATGTTACTTCCTGGAGACCGAGTGCTTAC
CGTGCCTCCCCCAGGCCTTCGCATCTATGACCATTCATTGGTTCCATGGTCCTCAGAGGAGAGGCCTCTGTGCGT
TGATATGTCTATACCCAAACAACATGCATGTACCGTCAATGTACCCGGGACTTCTATCCAACATCCTTGTGGCTT
CTCAGAGTTATTTTCTCTCCCGGATAATGAATATCGAGTGGTGTTCAACACCATAGCTGGGATAAGAGGACTCAT
CATGCGTTATTCGGAAGCAGGCGAATTTCAGGCAACAGCACTGGAACTCCTCAACTGGAGTGAGAAGATGGACTT
CACTATCAGTGAATACCGATCACATTTCTTGTATACTTGTGGGGTTGCCCGCTCTAAATCGGATCACCTTTTACG
TGTTCGTTTTTCCTGGCCTGACGAGGAAGGCTCGTTCGAAACAGGAATGGCTCCTATCTTAGACGAGCCAAACGA
GACGCCTTTGGTTATGAACATGGATGTCGCAGCTGGAAGGCTGGTATGGATAGCCACTGAGAGTGGTCGAGTGGC
TATGATGGATTTATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail