Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|038850
Gene name
Locationscaffold_2:64085..65745
Strand+
Gene length (bp)1660
Transcript length (bp)1503
Coding sequence length (bp)1503
Protein length (aa) 501

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.5905 0.4452 0.0677 0.0548 0.1981 0.025 0.14 0.18 0.2535 0.0063

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Orthologs

Orthofinder run ID1
Orthogroup1266
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|038860
Agaricus bisporus var bisporus H39 AgabiH39|038870
Agaricus bisporus var bisporus H39 AgabiH39|038890
Agaricus bisporus var bisporus H39 AgabiH39|038930
Agaricus bisporus var bisporus H39 AgabiH39|039040
Agaricus bisporus var bisporus H39 AgabiH39|238500
Agaricus bisporus var bisporus H39 AgabiH39|295900
Agaricus bisporus var bisporus H97 AgabiH97|038930
Agaricus bisporus var bisporus H97 AgabiH97|038920
Agaricus bisporus var bisporus H97 AgabiH97|038910
Agaricus bisporus var bisporus H97 AgabiH97|038900
Agaricus bisporus var bisporus H97 AgabiH97|038860
Agaricus bisporus var bisporus H97 AgabiH97|038870
Agaricus bisporus var bisporus H97 AgabiH97|039040
Agaricus bisporus var bisporus H97 AgabiH97|038850 (this protein)
Agaricus bisporus var bisporus H97 AgabiH97|038890
Agaricus bisporus var bisporus H97 AgabiH97|063380

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|038850
MLMTCQTAEGSKTGFSLLPPELVVEVFKRLHWRDLLKARQTCALFYSISKSRDIWENLIQIHAAATHGPPTTLEK
PMRMYTAGKLEEHFLRGAKNESEWLDEVRFEERSIPSPHRLRHCHLLRGGRWFLCSAVGGETLYCDLESPGSGLV
PLIPYPFLYPCDSITSMAIEEDNEAEILCFKIALVHVLEEDWLYRSSGETAVTGDSRVDVWFGKVVLDEDGTATH
LHAEKLASVPLPVYLGKPILGASLRGSLVAFTVEWKSLDGFGMQCDAIILDWKAPPRNKHQPCIRKTVHYSSSWA
QPGVKMDVILLPEGHLLTALQDLIRIYDHSFVPWASERRHWREALSLSEQCPYTINIPKSFGTVPRDFSPLFPLS
SDRYRVVFNSLRGIRGLKLQYRDGSVSKATLVDLLEWPKAMDVFIEDRQSHFSYNYGVTLGSYDSLFRSHFTWPD
EEGSSPSRLSVMAGNLSQLPDVMNMDVSTGRVLWVSNRGELKEASFTAPS*
Coding >AgabiH97|038850
ATGTTAATGACTTGCCAAACAGCTGAAGGTTCGAAGACTGGGTTCAGCTTGCTACCGCCTGAGCTTGTTGTTGAA
GTATTCAAACGATTACATTGGAGAGACCTACTGAAGGCGCGCCAAACCTGTGCGCTCTTTTACAGTATTTCTAAA
TCTAGGGATATATGGGAGAACTTGATTCAAATTCACGCTGCTGCCACGCATGGCCCCCCGACAACGTTGGAAAAA
CCTATGCGTATGTATACCGCTGGCAAACTCGAAGAGCATTTCCTTCGTGGTGCGAAAAATGAGTCCGAGTGGCTG
GACGAGGTTCGGTTTGAAGAAAGGAGTATTCCGTCTCCTCACAGGTTGAGGCATTGTCATCTCCTCCGAGGCGGA
CGGTGGTTCCTCTGCTCCGCCGTTGGAGGCGAGACGCTCTATTGTGACCTCGAATCGCCTGGATCTGGATTAGTT
CCTTTGATCCCATATCCATTCCTATACCCATGCGACTCTATCACTTCAATGGCTATCGAAGAAGACAACGAGGCG
GAAATTCTATGTTTTAAAATTGCTCTAGTCCATGTTTTGGAAGAAGATTGGTTATATAGATCGAGTGGCGAAACG
GCGGTGACTGGAGACTCCCGGGTTGACGTGTGGTTTGGAAAGGTCGTTTTGGATGAAGATGGGACTGCTACGCAT
TTGCACGCTGAGAAGCTTGCCTCCGTTCCCTTGCCTGTTTACCTTGGTAAACCAATATTGGGTGCATCTTTGCGC
GGCTCCCTGGTTGCTTTTACTGTTGAATGGAAATCTCTGGATGGATTTGGTATGCAATGCGACGCGATCATTTTA
GACTGGAAAGCGCCGCCAAGGAATAAACATCAGCCCTGTATCCGTAAGACTGTCCATTATTCTTCTTCCTGGGCT
CAACCTGGCGTCAAGATGGATGTGATACTCCTCCCTGAAGGTCATCTCCTTACCGCATTGCAAGACCTGATCCGC
ATTTATGACCACTCCTTCGTTCCGTGGGCCTCAGAAAGGCGGCACTGGCGTGAGGCACTTTCGCTATCTGAGCAA
TGTCCATACACTATCAATATACCCAAATCCTTTGGCACCGTTCCTCGAGATTTCTCGCCCTTATTTCCCCTCTCT
TCAGATCGATATCGCGTAGTGTTCAATAGCTTGCGTGGGATAAGGGGTTTGAAGTTGCAATATAGAGACGGGAGT
GTATCCAAAGCCACTTTGGTTGACCTTTTGGAGTGGCCCAAAGCGATGGATGTATTCATCGAGGATCGCCAGTCC
CACTTCTCATATAACTATGGCGTAACTCTTGGCAGCTATGACTCTCTTTTCCGTTCTCATTTTACTTGGCCAGAT
GAGGAGGGATCATCACCAAGCAGGCTCTCAGTCATGGCCGGAAACCTGAGTCAGCTTCCTGATGTCATGAACATG
GATGTTAGTACAGGGAGAGTGTTATGGGTATCAAACCGCGGTGAACTGAAAGAGGCTTCGTTCACAGCGCCGTCG
TAA
Transcript >AgabiH97|038850
ATGTTAATGACTTGCCAAACAGCTGAAGGTTCGAAGACTGGGTTCAGCTTGCTACCGCCTGAGCTTGTTGTTGAA
GTATTCAAACGATTACATTGGAGAGACCTACTGAAGGCGCGCCAAACCTGTGCGCTCTTTTACAGTATTTCTAAA
TCTAGGGATATATGGGAGAACTTGATTCAAATTCACGCTGCTGCCACGCATGGCCCCCCGACAACGTTGGAAAAA
CCTATGCGTATGTATACCGCTGGCAAACTCGAAGAGCATTTCCTTCGTGGTGCGAAAAATGAGTCCGAGTGGCTG
GACGAGGTTCGGTTTGAAGAAAGGAGTATTCCGTCTCCTCACAGGTTGAGGCATTGTCATCTCCTCCGAGGCGGA
CGGTGGTTCCTCTGCTCCGCCGTTGGAGGCGAGACGCTCTATTGTGACCTCGAATCGCCTGGATCTGGATTAGTT
CCTTTGATCCCATATCCATTCCTATACCCATGCGACTCTATCACTTCAATGGCTATCGAAGAAGACAACGAGGCG
GAAATTCTATGTTTTAAAATTGCTCTAGTCCATGTTTTGGAAGAAGATTGGTTATATAGATCGAGTGGCGAAACG
GCGGTGACTGGAGACTCCCGGGTTGACGTGTGGTTTGGAAAGGTCGTTTTGGATGAAGATGGGACTGCTACGCAT
TTGCACGCTGAGAAGCTTGCCTCCGTTCCCTTGCCTGTTTACCTTGGTAAACCAATATTGGGTGCATCTTTGCGC
GGCTCCCTGGTTGCTTTTACTGTTGAATGGAAATCTCTGGATGGATTTGGTATGCAATGCGACGCGATCATTTTA
GACTGGAAAGCGCCGCCAAGGAATAAACATCAGCCCTGTATCCGTAAGACTGTCCATTATTCTTCTTCCTGGGCT
CAACCTGGCGTCAAGATGGATGTGATACTCCTCCCTGAAGGTCATCTCCTTACCGCATTGCAAGACCTGATCCGC
ATTTATGACCACTCCTTCGTTCCGTGGGCCTCAGAAAGGCGGCACTGGCGTGAGGCACTTTCGCTATCTGAGCAA
TGTCCATACACTATCAATATACCCAAATCCTTTGGCACCGTTCCTCGAGATTTCTCGCCCTTATTTCCCCTCTCT
TCAGATCGATATCGCGTAGTGTTCAATAGCTTGCGTGGGATAAGGGGTTTGAAGTTGCAATATAGAGACGGGAGT
GTATCCAAAGCCACTTTGGTTGACCTTTTGGAGTGGCCCAAAGCGATGGATGTATTCATCGAGGATCGCCAGTCC
CACTTCTCATATAACTATGGCGTAACTCTTGGCAGCTATGACTCTCTTTTCCGTTCTCATTTTACTTGGCCAGAT
GAGGAGGGATCATCACCAAGCAGGCTCTCAGTCATGGCCGGAAACCTGAGTCAGCTTCCTGATGTCATGAACATG
GATGTTAGTACAGGGAGAGTGTTATGGGTATCAAACCGCGGTGAACTGAAAGAGGCTTCGTTCACAGCGCCGTCG
TAA
Gene >AgabiH97|038850
ATGTTAATGACTTGCCAAACAGCTGTGAGTCTTCGCGTAAAACAAACTCTTGTGTACTTTTTCACAAATCTACCA
GGAAGGTTCGAAGACTGGGTTCAGCTTGCTACCGCCTGAGCTTGTTGTTGAAGTATTCAAACGATTACATTGGAG
AGACCTACTGAAGGCGCGCCAAGTGAGTCTCTAACTCAGGTGTACGATTCTATATGTACGATTCTAATCCTGTAG
ACCTGTGCGCTCTTTTACAGTATTTCTAAATCTAGGGATATATGGGAGAACTTGATTCAAATTCACGCTGCTGCC
ACGCATGGCCCCCCGACAACGTTGGAAAAACCTATGCGTATGTATACCGCTGGCAAACTCGAAGAGCATTTCCTT
CGTGGTGCGAAAAATGAGTCCGAGTGGCTGGACGAGGTTCGGTTTGAAGAAAGGAGTATTCCGTCTCCTCACAGG
TTGAGGCATTGTCATCTCCTCCGAGGCGGACGGTGGTTCCTCTGCTCCGCCGTTGGAGGCGAGACGCTCTATTGT
GACCTCGAATCGCCTGGATCTGGATTAGTTCCTTTGATCCCATATCCATTCCTATACCCATGCGACTCTATCACT
TCAATGGCTATCGAAGAAGACAACGAGGCGGAAATTCTATGTTTTAAAATTGCTCTAGTCCATGTTTTGGAAGAA
GATTGGTTATATAGATCGAGTGGCGAAACGGCGGTGACTGGAGACTCCCGGGTTGACGTGTGGTTTGGAAAGGTC
GTTTTGGATGAAGATGGGACTGCTACGCATTTGCACGCTGAGAAGCTTGCCTCCGTTCCCTTGCCTGTTTACCTT
GGTAAACCAATATTGGGTGCATCTTTGCGCGGCTCCCTGGTTGCTTTTACTGTTGAATGGAAATCTCTGGATGGA
TTTGGTATGCAATGCGACGCGATCATTTTAGACTGGAAAGCGCCGCCAAGGAATAAACATCAGCCCTGTATCCGT
AAGACTGTCCATTATTCTTCTTCCTGGGCTCAACCTGGCGTCAAGGTAAGCTCGTTCGGTTATTTTATCAACTCT
TATTCAAACACAGTTCTGTTAGATGGATGTGATACTCCTCCCTGAAGGTCATCTCCTTACCGCATTGCAAGACCT
GATCCGCATTTATGACCACTCCTTCGTTCCGTGGGCCTCAGAAAGGCGGCACTGGCGTGAGGCACTTTCGCTATC
TGAGCAATGTCCATACACTATCAATATACCCAAATCCTTTGGCACCGTTCCTCGAGATTTCTCGCCCTTATTTCC
CCTCTCTTCAGATCGATATCGCGTAGTGTTCAATAGCTTGCGTGGGATAAGGGGTTTGAAGTTGCAATATAGAGA
CGGGAGTGTATCCAAAGCCACTTTGGTTGACCTTTTGGAGTGGCCCAAAGCGATGGATGTATTCATCGAGGATCG
CCAGTCCCACTTCTCATATAACTATGGCGTAACTCTTGGCAGCTATGACTCTCTTTTCCGTTCTCATTTTACTTG
GCCAGATGAGGAGGGATCATCACCAAGCAGGCTCTCAGTCATGGCCGGAAACCTGAGTCAGCTTCCTGATGTCAT
GAACATGGATGTTAGTACAGGGAGAGTGTTATGGGTATCAAACCGCGGTGAACTGAAAGAGGCTTCGTTCACAGC
GCCGTCGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail