Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|038780
Gene name
Locationscaffold_2:46933..48455
Strand+
Gene length (bp)1522
Transcript length (bp)1125
Coding sequence length (bp)1125
Protein length (aa) 375

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16 1.7E-05 75 161

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9USW3|YHZ7_SCHPO Probable glycosidase C21B10.07 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC21B10.07 PE=3 SV=1 9 322 3.0E-55
sp|A1DHY9|EGLX_NEOFI Probable endo-1,3(4)-beta-glucanase NFIA_089530 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NFIA_089530 PE=3 SV=1 6 322 6.0E-48
sp|Q4X084|EGLX_ASPFU Probable endo-1,3(4)-beta-glucanase AFUA_2G14360 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_2G14360 PE=3 SV=1 13 322 8.0E-47
sp|B0XTU6|EGLX_ASPFC Probable endo-1,3(4)-beta-glucanase AFUB_029980 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=AFUB_029980 PE=3 SV=1 13 322 8.0E-47
sp|D4AJR9|EGLX_ARTBC Endo-1,3(4)-beta-glucanase ARB_04519 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_04519 PE=3 SV=1 26 341 3.0E-41
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9USW3|YHZ7_SCHPO Probable glycosidase C21B10.07 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC21B10.07 PE=3 SV=1 9 322 3.0E-55
sp|A1DHY9|EGLX_NEOFI Probable endo-1,3(4)-beta-glucanase NFIA_089530 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NFIA_089530 PE=3 SV=1 6 322 6.0E-48
sp|Q4X084|EGLX_ASPFU Probable endo-1,3(4)-beta-glucanase AFUA_2G14360 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_2G14360 PE=3 SV=1 13 322 8.0E-47
sp|B0XTU6|EGLX_ASPFC Probable endo-1,3(4)-beta-glucanase AFUB_029980 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=AFUB_029980 PE=3 SV=1 13 322 8.0E-47
sp|D4AJR9|EGLX_ARTBC Endo-1,3(4)-beta-glucanase ARB_04519 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_04519 PE=3 SV=1 26 341 3.0E-41
sp|A1C7B5|EGLX_ASPCL Probable endo-1,3(4)-beta-glucanase ACLA_073210 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ACLA_073210 PE=3 SV=1 22 322 8.0E-40
sp|Q2UIE6|EGLX_ASPOR Probable endo-1,3(4)-beta-glucanase AO090023000083 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=AO090023000083 PE=3 SV=1 12 349 3.0E-39
sp|Q5BAP5|EGLX_EMENI Endo-1,3(4)-beta-glucanase xgeA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=xgeA PE=3 SV=1 10 332 4.0E-39
sp|A2QBQ3|EGLX_ASPNC Probable endo-1,3(4)-beta-glucanase An02g00850 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=An02g00850 PE=3 SV=1 12 322 2.0E-37
sp|B8N7S7|EGLX_ASPFN Probable endo-1,3(4)-beta-glucanase AFLA_105200 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=AFLA_105200 PE=3 SV=1 12 349 2.0E-37
[Show less]

GO

GO Term Description Terminal node
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0008152 metabolic process No
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 24 0.45

Transmembrane Domains

Domain # Start End Length
1 351 373 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 44.10 25.38 62.82
Initials Initials knots 42.46 24.29 60.63
Pileal_Stipeal_center Stage I stipe center 63.46 37.64 89.28
Pileal_Stipeal_shell Stage I stipe shell 22.69 12.06 33.32
DIF_stipe_center Stage II stipe center 60.90 36.01 85.80
DIF_stipe_shell Stage II stipe shell 62.64 36.62 88.66
DIF_stipe_skin Stage II stipe skin 62.46 36.05 88.88
DIF_cap_skin Stage II cap skin 21.89 11.62 32.16
DIF_cap_tissue Stage II cap tissue 31.91 17.75 46.06
DIF_gill_tissue Stage II gill tissue 36.42 20.10 52.73
YFB_stipe_center Young fruiting body stipe center 67.73 39.61 95.85
YFB_stipe_shell Young fruiting body stipe shell 51.93 30.40 73.46
YFB_stipe_skin Young fruiting body stipe skin 60.52 35.75 85.29
YFB_cap_skin Young fruiting body cap skin 26.03 14.16 37.91
YFB_cap_tissue Young fruiting body cap tissue 49.28 28.73 69.83
YFB_gill_tissue Young fruiting body gill tissue 19.53 9.80 29.27
YFB_veil Young fruiting body veil 22.04 11.33 32.75

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.654950 no
Casing YFB_stipe_center 0.153693 no
Casing YFB_stipe_shell 0.699107 no
Casing YFB_stipe_skin 0.337300 no
Casing YFB_cap_skin 0.087080 no
Casing YFB_cap_tissue 0.815553 no
Casing YFB_gill_tissue 0.007439 yes
Casing YFB_veil 0.023933 yes
Casing Initials 0.948195 no
Casing Pileal_Stipeal_center 0.244478 no
Casing Pileal_Stipeal_shell 0.027451 yes
Casing DIF_stipe_center 0.317155 no
Casing DIF_stipe_shell 0.275058 no
Casing DIF_stipe_skin 0.292131 no
Casing DIF_cap_skin 0.014956 yes
Casing DIF_cap_tissue 0.360018 no
DIF_gill_tissue YFB_stipe_center 0.029408 yes
DIF_gill_tissue YFB_stipe_shell 0.282600 no
DIF_gill_tissue YFB_stipe_skin 0.086070 no
DIF_gill_tissue YFB_cap_skin 0.348154 no
DIF_gill_tissue YFB_cap_tissue 0.385452 no
DIF_gill_tissue YFB_gill_tissue 0.056561 no
DIF_gill_tissue YFB_veil 0.131844 no
YFB_stipe_center YFB_stipe_shell 0.449718 no
YFB_stipe_center YFB_stipe_skin 0.806738 no
YFB_stipe_center YFB_cap_skin 0.000613 yes
YFB_stipe_center YFB_cap_tissue 0.336860 no
YFB_stipe_center YFB_gill_tissue 0.000613 yes
YFB_stipe_center YFB_veil 0.000613 yes
YFB_stipe_shell YFB_stipe_skin 0.714470 no
YFB_stipe_shell YFB_cap_skin 0.013485 yes
YFB_stipe_shell YFB_cap_tissue 0.922151 no
YFB_stipe_shell YFB_gill_tissue 0.000613 yes
YFB_stipe_shell YFB_veil 0.002951 yes
YFB_stipe_skin YFB_cap_skin 0.001625 yes
YFB_stipe_skin YFB_cap_tissue 0.595211 no
YFB_stipe_skin YFB_gill_tissue 0.000613 yes
YFB_stipe_skin YFB_veil 0.001140 yes
YFB_cap_skin YFB_cap_tissue 0.023676 yes
YFB_cap_skin YFB_gill_tissue 0.493593 no
YFB_cap_skin YFB_veil 0.736626 no
YFB_cap_tissue YFB_gill_tissue 0.001140 yes
YFB_cap_tissue YFB_veil 0.006032 yes
YFB_gill_tissue YFB_veil 0.835337 no
Initials DIF_gill_tissue 0.736087 no
Initials YFB_stipe_center 0.110080 no
Initials YFB_stipe_shell 0.607058 no
Initials YFB_stipe_skin 0.263398 no
Initials YFB_cap_skin 0.114583 no
Initials YFB_cap_tissue 0.733597 no
Initials YFB_gill_tissue 0.013782 yes
Initials YFB_veil 0.030851 yes
Initials Pileal_Stipeal_center 0.185943 no
Initials Pileal_Stipeal_shell 0.038720 yes
Initials DIF_stipe_center 0.247260 no
Initials DIF_stipe_shell 0.211475 no
Initials DIF_stipe_skin 0.223716 no
Initials DIF_cap_skin 0.021846 yes
Initials DIF_cap_tissue 0.438571 no
Pileal_Stipeal_center DIF_gill_tissue 0.047163 yes
Pileal_Stipeal_center YFB_stipe_center 0.897215 no
Pileal_Stipeal_center YFB_stipe_shell 0.593184 no
Pileal_Stipeal_center YFB_stipe_skin 0.929118 no
Pileal_Stipeal_center YFB_cap_skin 0.001140 yes
Pileal_Stipeal_center YFB_cap_tissue 0.466733 no
Pileal_Stipeal_center YFB_gill_tissue 0.000613 yes
Pileal_Stipeal_center YFB_veil 0.000613 yes
Pileal_Stipeal_center Pileal_Stipeal_shell 0.000613 yes
Pileal_Stipeal_center DIF_stipe_center 0.939407 no
Pileal_Stipeal_center DIF_stipe_shell 0.982217 no
Pileal_Stipeal_center DIF_stipe_skin 0.978459 no
Pileal_Stipeal_center DIF_cap_skin 0.000613 yes
Pileal_Stipeal_center DIF_cap_tissue 0.011968 yes
Pileal_Stipeal_shell DIF_gill_tissue 0.152325 no
Pileal_Stipeal_shell YFB_stipe_center 0.000613 yes
Pileal_Stipeal_shell YFB_stipe_shell 0.004548 yes
Pileal_Stipeal_shell YFB_stipe_skin 0.000613 yes
Pileal_Stipeal_shell YFB_cap_skin 0.787717 no
Pileal_Stipeal_shell YFB_cap_tissue 0.007782 yes
Pileal_Stipeal_shell YFB_gill_tissue 0.778671 no
Pileal_Stipeal_shell YFB_veil 0.965581 no
Pileal_Stipeal_shell DIF_stipe_center 0.000613 yes
Pileal_Stipeal_shell DIF_stipe_shell 0.000613 yes
Pileal_Stipeal_shell DIF_stipe_skin 0.000613 yes
Pileal_Stipeal_shell DIF_cap_skin 0.955124 no
Pileal_Stipeal_shell DIF_cap_tissue 0.358145 no
DIF_stipe_center DIF_gill_tissue 0.075382 no
DIF_stipe_center YFB_stipe_center 0.815553 no
DIF_stipe_center YFB_stipe_shell 0.699530 no
DIF_stipe_center YFB_stipe_skin 0.991415 no
DIF_stipe_center YFB_cap_skin 0.001140 yes
DIF_stipe_center YFB_cap_tissue 0.576815 no
DIF_stipe_center YFB_gill_tissue 0.000613 yes
DIF_stipe_center YFB_veil 0.000613 yes
DIF_stipe_center DIF_stipe_shell 0.961243 no
DIF_stipe_center DIF_stipe_skin 0.965367 no
DIF_stipe_center DIF_cap_skin 0.000613 yes
DIF_stipe_center DIF_cap_tissue 0.020790 yes
DIF_stipe_shell DIF_gill_tissue 0.058732 no
DIF_stipe_shell YFB_stipe_center 0.873137 no
DIF_stipe_shell YFB_stipe_shell 0.637102 no
DIF_stipe_shell YFB_stipe_skin 0.949856 no
DIF_stipe_shell YFB_cap_skin 0.001140 yes
DIF_stipe_shell YFB_cap_tissue 0.510459 no
DIF_stipe_shell YFB_gill_tissue 0.000613 yes
DIF_stipe_shell YFB_veil 0.000613 yes
DIF_stipe_shell DIF_stipe_skin 0.995767 no
DIF_stipe_shell DIF_cap_skin 0.000613 yes
DIF_stipe_shell DIF_cap_tissue 0.015242 yes
DIF_stipe_skin DIF_gill_tissue 0.058542 no
DIF_stipe_skin YFB_stipe_center 0.873595 no
DIF_stipe_skin YFB_stipe_shell 0.652497 no
DIF_stipe_skin YFB_stipe_skin 0.955697 no
DIF_stipe_skin YFB_cap_skin 0.001140 yes
DIF_stipe_skin YFB_cap_tissue 0.527988 no
DIF_stipe_skin YFB_gill_tissue 0.000613 yes
DIF_stipe_skin YFB_veil 0.000613 yes
DIF_stipe_skin DIF_cap_skin 0.000613 yes
DIF_stipe_skin DIF_cap_tissue 0.016386 yes
DIF_cap_skin DIF_gill_tissue 0.117779 no
DIF_cap_skin YFB_stipe_center 0.000613 yes
DIF_cap_skin YFB_stipe_shell 0.002084 yes
DIF_cap_skin YFB_stipe_skin 0.000613 yes
DIF_cap_skin YFB_cap_skin 0.715722 no
DIF_cap_skin YFB_cap_tissue 0.004548 yes
DIF_cap_skin YFB_gill_tissue 0.841123 no
DIF_cap_skin YFB_veil 0.990838 no
DIF_cap_skin DIF_cap_tissue 0.295038 no
DIF_cap_tissue DIF_gill_tissue 0.786306 no
DIF_cap_tissue YFB_stipe_center 0.003365 yes
DIF_cap_tissue YFB_stipe_shell 0.105537 no
DIF_cap_tissue YFB_stipe_skin 0.021322 yes
DIF_cap_tissue YFB_cap_skin 0.639534 no
DIF_cap_tissue YFB_cap_tissue 0.165288 no
DIF_cap_tissue YFB_gill_tissue 0.156383 no
DIF_cap_tissue YFB_veil 0.310199 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|038780
MAFRPSVLVVGALAAIMLPHARAEKYDMVKEYAGSTFFDDWAFYDHFDNLTNGDVVFVGAQQAAQNKLAFVDPST
NHAIIKIDNTTTVPFNEKRNAVRIQTNEMYSVGSLWTIDMYHVPYGCSVWPAFWSHSPNWPDGGEIDVFEGVNLQ
QRNQMALHTNPGCKQVNPNQSVDSSFIPNTDCSYLTNNNQGCIVNDPDVQSYGAEFANAGGGVWVTEYAESGISI
WFMPRAKVASVISSNSSTIDTSELGTPTANWPTGGCDMNTFFAPQNIILDITLCGDFAKPPQIFSQTCPGLCYED
WVVGNGSSYATAYFEIGSMRVFSKSGTTTTVGGQNSSDSSSATLNVDWVRMMMYVVSLWGIGLGGSFVVENFVF*
Coding >AgabiH97|038780
ATGGCTTTTCGACCATCGGTGTTGGTTGTTGGAGCGCTGGCCGCCATAATGCTCCCGCACGCGCGTGCGGAAAAA
TACGACATGGTGAAAGAATATGCTGGCTCGACCTTTTTCGACGATTGGGCGTTCTACGACCACTTTGACAATCTA
ACAAATGGAGACGTCGTTTTCGTAGGTGCCCAACAAGCAGCTCAAAACAAACTCGCCTTCGTAGACCCCTCGACA
AACCACGCTATCATCAAGATTGACAACACGACGACAGTTCCATTCAATGAAAAGCGAAACGCAGTCAGGATTCAG
ACAAACGAGATGTACAGCGTTGGAAGTTTGTGGACTATAGATATGTACCACGTACCATATGGGTGTTCAGTGTGG
CCGGCATTTTGGTCCCACTCTCCAAATTGGCCAGATGGCGGAGAAATCGATGTCTTTGAAGGCGTAAACCTTCAA
CAACGTAACCAAATGGCACTCCACACCAATCCAGGTTGTAAACAAGTCAACCCGAATCAATCAGTCGACTCCTCA
TTCATTCCTAATACCGATTGTTCTTACCTTACAAACAATAATCAAGGGTGTATCGTTAATGATCCGGACGTTCAA
TCTTATGGAGCTGAATTCGCTAATGCGGGCGGTGGAGTCTGGGTCACTGAATATGCCGAAAGTGGTATTTCGATT
TGGTTCATGCCGCGAGCGAAAGTCGCCAGTGTCATCTCCTCCAATTCATCTACAATTGACACTTCAGAACTTGGA
ACACCCACTGCGAATTGGCCAACAGGAGGCTGTGATATGAATACCTTCTTCGCTCCTCAAAACATCATTCTTGAT
ATCACGCTATGCGGCGATTTCGCTAAACCACCACAAATTTTCAGCCAAACCTGTCCTGGATTATGTTACGAAGAT
TGGGTAGTCGGAAATGGGTCCAGCTATGCCACGGCATATTTTGAAATCGGGTCAATGCGTGTGTTTAGCAAATCA
GGAACGACTACGACAGTTGGTGGTCAGAACAGTTCAGATTCGAGTTCAGCGACTTTGAATGTGGATTGGGTGCGG
ATGATGATGTATGTTGTGAGTTTGTGGGGCATTGGATTAGGAGGTAGTTTTGTGGTGGAAAATTTTGTGTTTTGA
Transcript >AgabiH97|038780
ATGGCTTTTCGACCATCGGTGTTGGTTGTTGGAGCGCTGGCCGCCATAATGCTCCCGCACGCGCGTGCGGAAAAA
TACGACATGGTGAAAGAATATGCTGGCTCGACCTTTTTCGACGATTGGGCGTTCTACGACCACTTTGACAATCTA
ACAAATGGAGACGTCGTTTTCGTAGGTGCCCAACAAGCAGCTCAAAACAAACTCGCCTTCGTAGACCCCTCGACA
AACCACGCTATCATCAAGATTGACAACACGACGACAGTTCCATTCAATGAAAAGCGAAACGCAGTCAGGATTCAG
ACAAACGAGATGTACAGCGTTGGAAGTTTGTGGACTATAGATATGTACCACGTACCATATGGGTGTTCAGTGTGG
CCGGCATTTTGGTCCCACTCTCCAAATTGGCCAGATGGCGGAGAAATCGATGTCTTTGAAGGCGTAAACCTTCAA
CAACGTAACCAAATGGCACTCCACACCAATCCAGGTTGTAAACAAGTCAACCCGAATCAATCAGTCGACTCCTCA
TTCATTCCTAATACCGATTGTTCTTACCTTACAAACAATAATCAAGGGTGTATCGTTAATGATCCGGACGTTCAA
TCTTATGGAGCTGAATTCGCTAATGCGGGCGGTGGAGTCTGGGTCACTGAATATGCCGAAAGTGGTATTTCGATT
TGGTTCATGCCGCGAGCGAAAGTCGCCAGTGTCATCTCCTCCAATTCATCTACAATTGACACTTCAGAACTTGGA
ACACCCACTGCGAATTGGCCAACAGGAGGCTGTGATATGAATACCTTCTTCGCTCCTCAAAACATCATTCTTGAT
ATCACGCTATGCGGCGATTTCGCTAAACCACCACAAATTTTCAGCCAAACCTGTCCTGGATTATGTTACGAAGAT
TGGGTAGTCGGAAATGGGTCCAGCTATGCCACGGCATATTTTGAAATCGGGTCAATGCGTGTGTTTAGCAAATCA
GGAACGACTACGACAGTTGGTGGTCAGAACAGTTCAGATTCGAGTTCAGCGACTTTGAATGTGGATTGGGTGCGG
ATGATGATGTATGTTGTGAGTTTGTGGGGCATTGGATTAGGAGGTAGTTTTGTGGTGGAAAATTTTGTGTTTTGA
Gene >AgabiH97|038780
ATGGCTTTTCGACCATCGGTGTTGGTTGTTGGAGCGCTGGCCGCCATAATGCTCCCGCACGCGCGTGCGGAAAAA
TACGACATGGTGAAAGAATATGCTGGCTCGACCTTTTTCGACGATTGGGCGTTCTACGACCACTGTGCGTATGCC
TCGAATCTCACCTCAAATTGCTGACTCACCAAATTATAGTTGACAATCTAACAAATGGAGACGTCGTGTACGCTT
GATTATCCATCCTCTTATCGTTCAGTAGACTGAAAACCAGAAAAAAGTTTCGTAGGTGCCCAACAAGCAGCTCAA
AACAAACTCGCCTTCGTAGACCCCTCGACAAACCACGCTATCATCAAGATTGACAACACGACGACAGTTCCATTC
AATGAAAAGCGAAACGCAGTCAGGATTCAGACAAACGAGATGTACAGCGTTGGAAGTTTGTGGACTATAGATATG
TACCACGTACCATATGGGGTACGCCTTCTTTCTGGTTAATCGGGCAGGTGTCCAGAAATTTTGACTTACAACTAG
GCAGTGTTCAGTGTGGCCGGCATTTTGGTCCCACTCTCCAAATTGGCCAGATGGCGGGTAAGTTGTTTAATATAT
AATCACTTTTTCTAAATTACCTTCCAACTTCGGGCATTACAGAGAAATCGATGTCTTTGAAGGCGTAAACCTTCA
ACAACGTAACCAAATGGCACTCCACACCAATCCAGGTTGTAAACAAGTCAACCCGAATCAATCAGTCGACTCCTC
ATTCATTCCTAATACCGATTGTTCTTACCTTACAAACAATAATCAAGGGTGTATCGTTAATGATCCGGACGTTCA
ATCTTATGGAGCTGAATTCGCTAATGCGGGCGGTGGAGTCTGGGTCACTGAATATGCCGAAAGTGGTATTTCGTA
CGTTCTTCAACCTTGTTTTTTCTTATTATCATTCTTTCGCTATAGCATCGAAGACTTATTCAAATTGATAGGATT
TGGTTCATGCCGCGAGCGAAAGTCGCCAGTGTCATCTCCTCCAATTCATCTACAATTGACACTTCAGAACTTGGA
ACACCCACTGCGAATTGGCCAACAGGAGGCTGTGATATGAATACCTTCTTCGCTCCTCAAAACATCATTCTTGAT
ATCACGCTATGCGGCGGTACGCCCCTCCCCTCATAATTGATCACTGTTTTCTAATTTATATCAAGATTTCGCTAA
ACCACCACAAATTTTCAGCCAAACCTGTCCTGGATTATGTTACGAAGATTGGGTAGTCGGAAATGGGTCCAGCTA
TGCCACGGCATATTTTGAAATCGGGTCAATGCGTGTGTTTAGCAAATCAGGAACGACTACGACAGTTGGTGGTCA
GAACAGTTCAGATTCGAGTTCAGGCTCGTCGGATTCATCAGGTTCATCGGGTCCGTCTGACAGTTCTGCAGCGAC
TTTGAATGTGGATTGGGTGCGGATGATGATGTATGTTGTGAGTTTGTGGGGCATTGGATTAGGAGGTAGTTTTGT
GGTGGAAAATTTTGTGTTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail