Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|038460
Gene name
Locationscaffold_13:1308776..1310924
Strand-
Gene length (bp)2148
Transcript length (bp)1674
Coding sequence length (bp)1674
Protein length (aa) 558

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00728 Glyco_hydro_20 Glycosyl hydrolase family 20, catalytic domain 2.1E-92 180 512
PF14845 Glycohydro_20b2 beta-acetyl hexosaminidase like 8.1E-16 19 157
PF02838 Glyco_hydro_20b Glycosyl hydrolase family 20, domain 2 2.1E-07 18 167

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9SYK0|HEXO2_ARATH Beta-hexosaminidase 2 OS=Arabidopsis thaliana GN=HEXO2 PE=1 SV=1 3 554 2.0E-98
sp|D4AUH6|HEX1_ARTBC Beta-hexosaminidase ARB_07893 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07893 PE=1 SV=1 9 554 8.0E-84
sp|E9DFH0|HEX1_COCPS Beta-hexosaminidase 1 OS=Coccidioides posadasii (strain RMSCC 757 / Silveira) GN=HEX1 PE=1 SV=1 122 554 8.0E-82
sp|P49010|HEXC_BOMMO Chitooligosaccharidolytic beta-N-acetylglucosaminidase OS=Bombyx mori PE=1 SV=1 122 553 7.0E-80
sp|P43077|HEX1_CANAX Beta-hexosaminidase OS=Candida albicans GN=HEX1 PE=1 SV=1 117 554 1.0E-76
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9SYK0|HEXO2_ARATH Beta-hexosaminidase 2 OS=Arabidopsis thaliana GN=HEXO2 PE=1 SV=1 3 554 2.0E-98
sp|D4AUH6|HEX1_ARTBC Beta-hexosaminidase ARB_07893 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07893 PE=1 SV=1 9 554 8.0E-84
sp|E9DFH0|HEX1_COCPS Beta-hexosaminidase 1 OS=Coccidioides posadasii (strain RMSCC 757 / Silveira) GN=HEX1 PE=1 SV=1 122 554 8.0E-82
sp|P49010|HEXC_BOMMO Chitooligosaccharidolytic beta-N-acetylglucosaminidase OS=Bombyx mori PE=1 SV=1 122 553 7.0E-80
sp|P43077|HEX1_CANAX Beta-hexosaminidase OS=Candida albicans GN=HEX1 PE=1 SV=1 117 554 1.0E-76
sp|A7WM73|HEXO1_ARATH Beta-hexosaminidase 1 OS=Arabidopsis thaliana GN=HEXO1 PE=1 SV=1 19 555 4.0E-75
sp|D4AYT4|HEX2_ARTBC Probable beta-hexosaminidase ARB_01353 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01353 PE=1 SV=1 122 554 1.0E-74
sp|Q8WSF3|FDL_DROME Probable beta-hexosaminidase fdl OS=Drosophila melanogaster GN=fdl PE=1 SV=1 84 553 7.0E-74
sp|P49614|HEXB_FELCA Beta-hexosaminidase subunit beta OS=Felis catus GN=HEXB PE=2 SV=2 18 546 4.0E-68
sp|Q8L7S6|HEXO3_ARATH Beta-hexosaminidase 3 OS=Arabidopsis thaliana GN=HEXO3 PE=1 SV=1 6 541 1.0E-67
sp|P13723|HEXA1_DICDI Beta-hexosaminidase subunit A1 OS=Dictyostelium discoideum GN=hexa1 PE=1 SV=1 107 549 4.0E-67
sp|P07686|HEXB_HUMAN Beta-hexosaminidase subunit beta OS=Homo sapiens GN=HEXB PE=1 SV=3 120 546 6.0E-66
sp|P20060|HEXB_MOUSE Beta-hexosaminidase subunit beta OS=Mus musculus GN=Hexb PE=1 SV=2 120 546 3.0E-64
sp|Q5RC84|HEXA_PONAB Beta-hexosaminidase subunit alpha OS=Pongo abelii GN=HEXA PE=3 SV=1 123 546 4.0E-63
sp|P06865|HEXA_HUMAN Beta-hexosaminidase subunit alpha OS=Homo sapiens GN=HEXA PE=1 SV=2 123 546 1.0E-62
sp|Q0V8R6|HEXA_BOVIN Beta-hexosaminidase subunit alpha OS=Bos taurus GN=HEXA PE=2 SV=1 123 548 4.0E-62
sp|Q641X3|HEXA_RAT Beta-hexosaminidase subunit alpha OS=Rattus norvegicus GN=Hexa PE=2 SV=1 123 546 8.0E-62
sp|Q6AXR4|HEXB_RAT Beta-hexosaminidase subunit beta OS=Rattus norvegicus GN=Hexb PE=2 SV=1 120 546 9.0E-62
sp|Q54K55|HEXB1_DICDI Beta-hexosaminidase subunit B1 OS=Dictyostelium discoideum GN=hexb1 PE=3 SV=1 19 542 1.0E-61
sp|Q54K56|HEXB2_DICDI Beta-hexosaminidase subunit B2 OS=Dictyostelium discoideum GN=hexb2 PE=3 SV=1 15 553 4.0E-61
sp|P29416|HEXA_MOUSE Beta-hexosaminidase subunit alpha OS=Mus musculus GN=Hexa PE=1 SV=2 123 546 6.0E-61
sp|Q29548|HEXB_PIG Beta-hexosaminidase subunit beta OS=Sus scrofa GN=HEXB PE=1 SV=2 120 546 1.0E-60
sp|Q54SC9|HEXA2_DICDI Beta-hexosaminidase subunit A2 OS=Dictyostelium discoideum GN=hexa2 PE=3 SV=1 111 548 3.0E-58
sp|Q619W7|HEXA_CAEBR Beta-hexosaminidase A OS=Caenorhabditis briggsae GN=hex-1 PE=3 SV=2 16 548 1.0E-52
sp|Q22492|HEXA_CAEEL Beta-hexosaminidase A OS=Caenorhabditis elegans GN=hex-1 PE=1 SV=1 16 548 1.0E-49
sp|P49008|HEXA_PORGI Beta-hexosaminidase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=nahA PE=3 SV=2 87 543 2.0E-43
sp|Q86M34|HEXB_ENTHI Beta-hexosaminidase subunit beta OS=Entamoeba histolytica GN=HEXB PE=1 SV=1 122 533 2.0E-40
sp|P49009|HEXA_ENTHI Beta-hexosaminidase subunit alpha OS=Entamoeba histolytica GN=HEXA PE=1 SV=2 122 511 8.0E-40
sp|P96155|HEX1_VIBFU Beta-hexosaminidase OS=Vibrio furnissii GN=exo I PE=1 SV=1 120 518 7.0E-38
sp|Q7WUL4|HEX20_CELFI Beta-N-acetylhexosaminidase OS=Cellulomonas fimi GN=hex20 PE=1 SV=1 57 531 2.0E-31
sp|Q54468|CHB_SERMA Chitobiase OS=Serratia marcescens GN=chb PE=1 SV=1 146 339 3.0E-18
sp|P13670|CHB_VIBHA N,N'-diacetylchitobiase OS=Vibrio harveyi GN=chb PE=1 SV=1 159 434 6.0E-16
sp|Q04786|HEX_VIBVL Beta-hexosaminidase OS=Vibrio vulnificus GN=hex PE=3 SV=1 172 281 5.0E-14
sp|P49007|HEXB_PSEO7 Beta-hexosaminidase B OS=Pseudoalteromonas piscicida GN=nag096 PE=3 SV=1 41 275 2.0E-12
[Show less]

GO

GO Term Description Terminal node
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0008152 metabolic process No
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|038460
MNILLIFPIFLLYSRVFAIWPRPQKLATGDTPLRLDQDFTIQTSGIDNVPSDVSDAIERTTGFLKTDKLQLLVPD
RGASLSDTVNSANTLRSLTLTLTSSSTGSGGVKSISEEAIQELGTQDESYTLQVPGDDGGNAVLNANTTLGLFRG
LTTFEQLWFDLEGTVYTLQAPVQIEDAPTYPYRGFMLDTSRHFFPADDIKRTLDAMSWVKINHFHWHVVDSQSFP
IVVPGFEEISQKGAYSSSKIYTPDDVEDIVQYAAARGIDVMVEIDTPGHTSVISKSHPEHIACPESTPWSRFAGE
PPAGQLRLATPSTVNFTANLIGAVSSMFPSKLFHTGGDEINTNCYDQDEQTQMDLNSQGKTFEQALDAFTQATHS
VLVEEGKTPVVWEEMALEHQVQLRNNTIVLVWISSQHVGAVAQKGFKIIHAASDFFYLDCGAGGWIGDNVDGDSS
CGVYKTWQRAYSFNPVAGLESDQEDLILGGQQLLWAEQSGPSNLDSIAWPRSASSAELFWSGPGGDVKTALPRLH
ETGFRFVQRGVNAIPLQPEWCALRPNACDAGA*
Coding >AgabiH97|038460
ATGAATATTCTTCTTATCTTCCCTATATTTCTCCTCTACTCCCGCGTATTCGCTATATGGCCAAGGCCACAAAAG
CTAGCCACAGGAGATACACCTCTCAGACTCGACCAGGACTTCACTATTCAAACTTCTGGAATCGACAATGTACCA
TCAGATGTTTCTGACGCTATTGAACGTACTACCGGTTTTCTCAAAACTGATAAACTTCAACTGCTCGTACCTGAT
CGTGGAGCTTCACTGTCCGACACAGTAAATTCTGCGAACACACTACGATCCCTCACACTTACTTTGACGAGCTCG
TCCACGGGGTCCGGAGGCGTGAAGAGTATTAGTGAGGAAGCGATTCAAGAACTCGGAACTCAAGATGAGAGTTAT
ACCTTGCAAGTTCCGGGTGACGATGGTGGGAATGCTGTATTGAATGCGAATACGACATTGGGGTTGTTTAGAGGG
TTGACGACGTTTGAACAGTTGTGGTTTGATCTGGAGGGGACGGTCTACACGCTTCAGGCTCCGGTCCAGATCGAA
GATGCTCCTACCTATCCATATCGCGGGTTCATGCTGGATACTTCGCGCCATTTTTTCCCAGCTGACGACATCAAA
CGCACTCTGGATGCAATGAGTTGGGTTAAAATCAACCATTTTCATTGGCACGTCGTCGATTCCCAGTCGTTCCCC
ATCGTCGTTCCTGGATTTGAAGAGATATCGCAAAAGGGGGCATACTCGTCTTCGAAAATTTATACACCCGATGAC
GTCGAAGATATTGTACAGTACGCTGCTGCGAGAGGAATCGATGTTATGGTAGAAATCGATACTCCAGGGCATACG
TCCGTCATTTCAAAATCGCATCCCGAGCACATAGCATGTCCTGAATCTACTCCTTGGTCTCGGTTTGCCGGCGAG
CCACCGGCTGGACAACTTCGACTTGCAACTCCTTCGACAGTAAACTTCACCGCCAATTTGATTGGGGCTGTTTCT
TCAATGTTTCCTTCCAAGTTGTTCCATACTGGTGGAGATGAGATTAACACAAATTGTTATGATCAAGATGAGCAG
ACCCAAATGGACCTTAACTCGCAAGGGAAAACTTTTGAACAAGCATTAGATGCGTTCACGCAAGCCACGCATTCA
GTGCTTGTAGAAGAAGGAAAGACGCCGGTGGTTTGGGAAGAAATGGCGCTCGAACACCAGGTTCAGCTCCGAAAT
AACACCATCGTCTTGGTTTGGATTTCATCGCAACACGTCGGAGCAGTCGCTCAAAAAGGATTCAAAATTATCCAC
GCGGCTTCTGATTTTTTCTACCTCGATTGCGGCGCCGGAGGATGGATTGGAGATAATGTCGATGGGGATAGCTCA
TGCGGTGTTTACAAGACCTGGCAGAGAGCTTACTCGTTCAATCCAGTAGCTGGTCTGGAAAGTGACCAAGAAGAT
TTGATCCTGGGAGGTCAACAATTACTGTGGGCTGAACAGTCCGGCCCATCAAATTTGGATTCTATCGCTTGGCCT
CGTTCCGCTTCGTCGGCGGAACTATTTTGGTCTGGACCTGGCGGCGATGTGAAGACCGCTTTACCGAGGTTACAC
GAAACAGGGTTTAGATTTGTCCAGCGAGGTGTCAACGCTATACCCTTACAGCCTGAATGGTGCGCCTTGAGACCT
AACGCTTGTGACGCTGGTGCGTAG
Transcript >AgabiH97|038460
ATGAATATTCTTCTTATCTTCCCTATATTTCTCCTCTACTCCCGCGTATTCGCTATATGGCCAAGGCCACAAAAG
CTAGCCACAGGAGATACACCTCTCAGACTCGACCAGGACTTCACTATTCAAACTTCTGGAATCGACAATGTACCA
TCAGATGTTTCTGACGCTATTGAACGTACTACCGGTTTTCTCAAAACTGATAAACTTCAACTGCTCGTACCTGAT
CGTGGAGCTTCACTGTCCGACACAGTAAATTCTGCGAACACACTACGATCCCTCACACTTACTTTGACGAGCTCG
TCCACGGGGTCCGGAGGCGTGAAGAGTATTAGTGAGGAAGCGATTCAAGAACTCGGAACTCAAGATGAGAGTTAT
ACCTTGCAAGTTCCGGGTGACGATGGTGGGAATGCTGTATTGAATGCGAATACGACATTGGGGTTGTTTAGAGGG
TTGACGACGTTTGAACAGTTGTGGTTTGATCTGGAGGGGACGGTCTACACGCTTCAGGCTCCGGTCCAGATCGAA
GATGCTCCTACCTATCCATATCGCGGGTTCATGCTGGATACTTCGCGCCATTTTTTCCCAGCTGACGACATCAAA
CGCACTCTGGATGCAATGAGTTGGGTTAAAATCAACCATTTTCATTGGCACGTCGTCGATTCCCAGTCGTTCCCC
ATCGTCGTTCCTGGATTTGAAGAGATATCGCAAAAGGGGGCATACTCGTCTTCGAAAATTTATACACCCGATGAC
GTCGAAGATATTGTACAGTACGCTGCTGCGAGAGGAATCGATGTTATGGTAGAAATCGATACTCCAGGGCATACG
TCCGTCATTTCAAAATCGCATCCCGAGCACATAGCATGTCCTGAATCTACTCCTTGGTCTCGGTTTGCCGGCGAG
CCACCGGCTGGACAACTTCGACTTGCAACTCCTTCGACAGTAAACTTCACCGCCAATTTGATTGGGGCTGTTTCT
TCAATGTTTCCTTCCAAGTTGTTCCATACTGGTGGAGATGAGATTAACACAAATTGTTATGATCAAGATGAGCAG
ACCCAAATGGACCTTAACTCGCAAGGGAAAACTTTTGAACAAGCATTAGATGCGTTCACGCAAGCCACGCATTCA
GTGCTTGTAGAAGAAGGAAAGACGCCGGTGGTTTGGGAAGAAATGGCGCTCGAACACCAGGTTCAGCTCCGAAAT
AACACCATCGTCTTGGTTTGGATTTCATCGCAACACGTCGGAGCAGTCGCTCAAAAAGGATTCAAAATTATCCAC
GCGGCTTCTGATTTTTTCTACCTCGATTGCGGCGCCGGAGGATGGATTGGAGATAATGTCGATGGGGATAGCTCA
TGCGGTGTTTACAAGACCTGGCAGAGAGCTTACTCGTTCAATCCAGTAGCTGGTCTGGAAAGTGACCAAGAAGAT
TTGATCCTGGGAGGTCAACAATTACTGTGGGCTGAACAGTCCGGCCCATCAAATTTGGATTCTATCGCTTGGCCT
CGTTCCGCTTCGTCGGCGGAACTATTTTGGTCTGGACCTGGCGGCGATGTGAAGACCGCTTTACCGAGGTTACAC
GAAACAGGGTTTAGATTTGTCCAGCGAGGTGTCAACGCTATACCCTTACAGCCTGAATGGTGCGCCTTGAGACCT
AACGCTTGTGACGCTGGTGCGTAG
Gene >AgabiH97|038460
ATGAATATTCTTCTTATCTTCCCTATATTTCTCCTCTACTCCCGCGTATTCGCTATATGGCCAAGGCCACAAAAG
CTAGCCACAGGAGATACACCTCTCAGACTCGACCAGGACTTCACTATTCAAACTTCTGGAATCGACAATGTACCA
TCAGATGTTTCTGACGCTATTGAACGTACTACCGGTTTTCTCAAAACTGATAAACTTCAACTGCTCGTACCTGAT
CGTGGAGCTTCACTGTCCGACACAGTAAATTCTGCGAACACACTACGATCCCTCACACTTACTTTGACGAGCTCG
TCCACGGGGTCCGGAGGCGTGAAGAGTATTAGTGAGGAAGCGATTCAAGAACTCGGAACTCAAGATGAGAGTTAT
ACCTTGCAAGTTCCGGGTGACGATGGTGGGAATGCTGTATTGAATGCGAATACGACATTGGGGTTGTTTAGAGGG
TTGACGACGTTTGAACAGTTGTGGTTTGATCTGGAGGGGACGGTCTACACGCTTCAGGCTCCGGTCCAGATCGAA
GATGCTCCTACCTATGTGAGTAACGAATTTCCACCTTCGTATTACTCATGAGTAACCCAAAATTCAGCCATATCG
CGGGTTCATGCTGGATACTTCGCGCCATTTGTGAGTGAAAGTTCCCTGATAAGTCCGGCCTATCTATAAATGATC
GTTGTCGTGCAGTTTCCCAGCTGACGACATCAAACGCACTCTGGATGCAATGAGTTGGGTTAAAATCAACCATTT
TCATTGGCACGTCGTCGATTCCCAGTCGTTCCCCATCGTCGTTCCTGGATTTGAAGAGATATCGCAAAAGGGGGC
ATACTCGTCTTCGAAAATTTATACACCCGATGACGTCGAAGATATTGTACAGTACGCTGCTGCGGTGCGTAATTT
CAACCCAGTCAAACTCTTTTTTGAAATGTGCTGACCTTTTTTCATTTACTTGTCATGGATAGAGAGGAATCGATG
TTATGGTAGAAATCGATACTCCAGGGCATACGTCCGTCATTTCAAAATCGCATCCCGAGCACATAGCATGTCCTG
AATCTACTCCTTGGTCTCGGTTTGCCGGCGGTACGTATCTCCTTCAAATATCTTTCAACATCATAACATGCTTAC
CTATGATAACGTGCCCTATCTATCAGAGCCACCGGCTGGACAACTTCGACTTGCAACTCCTTCGACAGTAAACTT
CACCGCCAATTTGATTGGGGCTGTTTCTTCAATGTTTCCTTCCAAGTTGTTCCATACTGGTGGAGATGAGATTAA
CACAAATTGTTATGATCAAGATGAGCAGACCCAAATGGACCTTAGTTAGTGGCTTTGCGTTTTGAACATCCTGCT
CATTCTAGACGATAAATAGACTCGCAAGGGAAAACTTTTGAACAAGCATTAGATGCGTTCACGCAAGCCACGCAT
TCAGTGCTTGTAGAAGAAGGAAAGACGCCGGTGGTTTGGGAAGGTAGGTTCCTTTTTACAACCTGCTCTCGCGAA
GCGAGGACCAATGACGTTAATCGTAGAAATGGCGCTCGAACACCAGGTTCAGCTCCGAAATAACACCATCGTCTT
GTATGTGACATCGGACCATCACAGAGATGATTCTGACACCATGATGACCCACCCCAGGGTTTGGATTTCATCGCA
ACACGTCGGAGCAGTCGCTCAAAAAGGATTCAAAATTATCCACGCGGCTTCTGATTTTTTCTACCTCGATTGCGG
CGCCGGAGGATGGATTGGAGATAATGTCGATGGGGATAGCTCATGCGGTGTTTACAAGACCTGGCAGAGAGCTTA
CTCGTTCAATCCAGTAGCTGGTCTGGAAAGTGACCAAGAAGATTTGATCCTGGGAGGTTCGTGTCGTTCGTTTTT
GTCCTCCAAGAACCAGTATGATTGATCATATGTGTAGGTCAACAATTACTGTGGGCTGAACAGTCCGGCCCATCA
AATTTGGATTCTATCGCTTGGCCTCGTTCCGCTTCGTCGGCGGAACTATTTTGGTCTGGACCTGGCGGCGATGTG
AAGACCGCTTTACCGAGGTTACACGAAACAGGGTTTAGATTTGTCCAGCGAGGTGTCAACGCTATACCCTTACAG
CCTGAATGGTGCGCCTTGAGACCTAACGCTTGTGACGCTGGTGCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail