Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|038290
Gene name
Locationscaffold_13:1266755..1268177
Strand-
Gene length (bp)1422
Transcript length (bp)1422
Coding sequence length (bp)1422
Protein length (aa) 474

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12937 F-box-like F-box-like 1.7E-06 61 118

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.5979 0.6953 0.0669 0.0615 0.2856 0.0053 0.0625 0.1862 0.0577 0.0182

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 7.28 3.22 11.35
Initials Initials knots 7.69 3.68 11.71
Pileal_Stipeal_center Stage I stipe center 3.16 1.27 5.06
Pileal_Stipeal_shell Stage I stipe shell 3.34 1.39 5.29
DIF_stipe_center Stage II stipe center 2.45 0.96 3.95
DIF_stipe_shell Stage II stipe shell 1.84 0.66 3.01
DIF_stipe_skin Stage II stipe skin 2.12 0.73 3.52
DIF_cap_skin Stage II cap skin 3.29 1.37 5.22
DIF_cap_tissue Stage II cap tissue 2.41 0.93 3.89
DIF_gill_tissue Stage II gill tissue 3.66 1.56 5.76
YFB_stipe_center Young fruiting body stipe center 3.41 1.28 5.54
YFB_stipe_shell Young fruiting body stipe shell 2.93 1.19 4.66
YFB_stipe_skin Young fruiting body stipe skin 1.76 0.62 2.89
YFB_cap_skin Young fruiting body cap skin 3.10 1.25 4.95
YFB_cap_tissue Young fruiting body cap tissue 2.89 1.17 4.61
YFB_gill_tissue Young fruiting body gill tissue 3.29 1.38 5.21
YFB_veil Young fruiting body veil 3.88 1.68 6.09

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.082277 no
Casing YFB_stipe_center 0.061277 no
Casing YFB_stipe_shell 0.013782 yes
Casing YFB_stipe_skin 0.000613 yes
Casing YFB_cap_skin 0.029648 yes
Casing YFB_cap_tissue 0.014374 yes
Casing YFB_gill_tissue 0.035309 yes
Casing YFB_veil 0.113966 no
Casing Initials 0.938811 no
Casing Pileal_Stipeal_center 0.032038 yes
Casing Pileal_Stipeal_shell 0.040058 yes
Casing DIF_stipe_center 0.004548 yes
Casing DIF_stipe_shell 0.000613 yes
Casing DIF_stipe_skin 0.002525 yes
Casing DIF_cap_skin 0.033906 yes
Casing DIF_cap_tissue 0.004160 yes
DIF_gill_tissue YFB_stipe_center 0.928373 no
DIF_gill_tissue YFB_stipe_shell 0.709342 no
DIF_gill_tissue YFB_stipe_skin 0.076262 no
DIF_gill_tissue YFB_cap_skin 0.803239 no
DIF_gill_tissue YFB_cap_tissue 0.689910 no
DIF_gill_tissue YFB_gill_tissue 0.883086 no
DIF_gill_tissue YFB_veil 0.938557 no
YFB_stipe_center YFB_stipe_shell 0.827608 no
YFB_stipe_center YFB_stipe_skin 0.142789 no
YFB_stipe_center YFB_cap_skin 0.904820 no
YFB_stipe_center YFB_cap_tissue 0.811913 no
YFB_stipe_center YFB_gill_tissue 0.966805 no
YFB_stipe_center YFB_veil 0.852794 no
YFB_stipe_shell YFB_stipe_skin 0.287593 no
YFB_stipe_shell YFB_cap_skin 0.944320 no
YFB_stipe_shell YFB_cap_tissue 0.986273 no
YFB_stipe_shell YFB_gill_tissue 0.872193 no
YFB_stipe_shell YFB_veil 0.614144 no
YFB_stipe_skin YFB_cap_skin 0.220445 no
YFB_stipe_skin YFB_cap_tissue 0.300294 no
YFB_stipe_skin YFB_gill_tissue 0.143758 no
YFB_stipe_skin YFB_veil 0.054575 no
YFB_cap_skin YFB_cap_tissue 0.929808 no
YFB_cap_skin YFB_gill_tissue 0.939434 no
YFB_cap_skin YFB_veil 0.710589 no
YFB_cap_tissue YFB_gill_tissue 0.853055 no
YFB_cap_tissue YFB_veil 0.593399 no
YFB_gill_tissue YFB_veil 0.794418 no
Initials DIF_gill_tissue 0.045487 yes
Initials YFB_stipe_center 0.036455 yes
Initials YFB_stipe_shell 0.006387 yes
Initials YFB_stipe_skin 0.000613 yes
Initials YFB_cap_skin 0.015242 yes
Initials YFB_cap_tissue 0.007782 yes
Initials YFB_gill_tissue 0.019442 yes
Initials YFB_veil 0.065276 no
Initials Pileal_Stipeal_center 0.015242 yes
Initials Pileal_Stipeal_shell 0.020790 yes
Initials DIF_stipe_center 0.001140 yes
Initials DIF_stipe_shell 0.000613 yes
Initials DIF_stipe_skin 0.001625 yes
Initials DIF_cap_skin 0.016669 yes
Initials DIF_cap_tissue 0.001140 yes
Pileal_Stipeal_center DIF_gill_tissue 0.832156 no
Pileal_Stipeal_center YFB_stipe_center 0.928651 no
Pileal_Stipeal_center YFB_stipe_shell 0.921121 no
Pileal_Stipeal_center YFB_stipe_skin 0.197235 no
Pileal_Stipeal_center YFB_cap_skin 0.980089 no
Pileal_Stipeal_center YFB_cap_tissue 0.907209 no
Pileal_Stipeal_center YFB_gill_tissue 0.960086 no
Pileal_Stipeal_center YFB_veil 0.743755 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.945658 no
Pileal_Stipeal_center DIF_stipe_center 0.671893 no
Pileal_Stipeal_center DIF_stipe_shell 0.252618 no
Pileal_Stipeal_center DIF_stipe_skin 0.448626 no
Pileal_Stipeal_center DIF_cap_skin 0.960981 no
Pileal_Stipeal_center DIF_cap_tissue 0.644662 no
Pileal_Stipeal_shell DIF_gill_tissue 0.898778 no
Pileal_Stipeal_shell YFB_stipe_center 0.981640 no
Pileal_Stipeal_shell YFB_stipe_shell 0.846019 no
Pileal_Stipeal_shell YFB_stipe_skin 0.133711 no
Pileal_Stipeal_shell YFB_cap_skin 0.921788 no
Pileal_Stipeal_shell YFB_cap_tissue 0.829074 no
Pileal_Stipeal_shell YFB_gill_tissue 0.985280 no
Pileal_Stipeal_shell YFB_veil 0.817106 no
Pileal_Stipeal_shell DIF_stipe_center 0.566324 no
Pileal_Stipeal_shell DIF_stipe_shell 0.172824 no
Pileal_Stipeal_shell DIF_stipe_skin 0.346251 no
Pileal_Stipeal_shell DIF_cap_skin 0.985066 no
Pileal_Stipeal_shell DIF_cap_tissue 0.539534 no
DIF_stipe_center DIF_gill_tissue 0.416662 no
DIF_stipe_center YFB_stipe_center 0.558288 no
DIF_stipe_center YFB_stipe_shell 0.790147 no
DIF_stipe_center YFB_stipe_skin 0.555495 no
DIF_stipe_center YFB_cap_skin 0.705912 no
DIF_stipe_center YFB_cap_tissue 0.811691 no
DIF_stipe_center YFB_gill_tissue 0.592918 no
DIF_stipe_center YFB_veil 0.327925 no
DIF_stipe_center DIF_stipe_shell 0.630560 no
DIF_stipe_center DIF_stipe_skin 0.845210 no
DIF_stipe_center DIF_cap_skin 0.596348 no
DIF_stipe_center DIF_cap_tissue 0.983274 no
DIF_stipe_shell DIF_gill_tissue 0.110231 no
DIF_stipe_shell YFB_stipe_center 0.182058 no
DIF_stipe_shell YFB_stipe_shell 0.344845 no
DIF_stipe_shell YFB_stipe_skin 0.956845 no
DIF_stipe_shell YFB_cap_skin 0.273845 no
DIF_stipe_shell YFB_cap_tissue 0.364831 no
DIF_stipe_shell YFB_gill_tissue 0.191927 no
DIF_stipe_shell YFB_veil 0.076803 no
DIF_stipe_shell DIF_stipe_skin 0.846592 no
DIF_stipe_shell DIF_cap_skin 0.191804 no
DIF_stipe_shell DIF_cap_tissue 0.653817 no
DIF_stipe_skin DIF_gill_tissue 0.228255 no
DIF_stipe_skin YFB_stipe_center 0.348484 no
DIF_stipe_skin YFB_stipe_shell 0.567448 no
DIF_stipe_skin YFB_stipe_skin 0.785993 no
DIF_stipe_skin YFB_cap_skin 0.472666 no
DIF_stipe_skin YFB_cap_tissue 0.588429 no
DIF_stipe_skin YFB_gill_tissue 0.360784 no
DIF_stipe_skin YFB_veil 0.163972 no
DIF_stipe_skin DIF_cap_skin 0.362560 no
DIF_stipe_skin DIF_cap_tissue 0.864586 no
DIF_cap_skin DIF_gill_tissue 0.881060 no
DIF_cap_skin YFB_stipe_center 0.967818 no
DIF_cap_skin YFB_stipe_shell 0.867691 no
DIF_cap_skin YFB_stipe_skin 0.147141 no
DIF_cap_skin YFB_cap_skin 0.939180 no
DIF_cap_skin YFB_cap_tissue 0.850122 no
DIF_cap_skin YFB_gill_tissue 0.996937 no
DIF_cap_skin YFB_veil 0.796047 no
DIF_cap_skin DIF_cap_tissue 0.560991 no
DIF_cap_tissue DIF_gill_tissue 0.388638 no
DIF_cap_tissue YFB_stipe_center 0.530260 no
DIF_cap_tissue YFB_stipe_shell 0.764111 no
DIF_cap_tissue YFB_stipe_skin 0.583360 no
DIF_cap_tissue YFB_cap_skin 0.673894 no
DIF_cap_tissue YFB_cap_tissue 0.785652 no
DIF_cap_tissue YFB_gill_tissue 0.559724 no
DIF_cap_tissue YFB_veil 0.297681 no

Orthologs

Orthofinder run ID1
Orthogroup12284
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|038290
Agaricus bisporus var bisporus H97 AgabiH97|038290 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|038290
MEFVKANPHCDYRPQDDYPHTLTNLVQINEQVNSLNDHIRDLFKIRSTLLHRSNQLRSLASTLPPKILSNIFRKL
VDPDFALGEPSAPFRLRQSFTLSSVSTHWRHVALGTPQLWEDMHCIVANNNQSVEHLISLLQHCSSCAHTLNLLL
SLPSFENAREVLHTLTQALFSSEIKEKVRSLTLCWPPAHWLSMISRLTSLRSLYILGYNASDRDNFRLYTLATVP
TSLRSLHVEDVPMFDTPILRLCQNIEFCIYRPGSPIVPVSYSEPLILGKLERLIMPAGHGLQTVTSAGNLLLPSL
KYLELEHRGFHDLDFYPDIIIHFCRQVSKTLLGLTIRCSGPQWSVDALRILFKSLPHLQEFHAEDWIAAPINVIQ
ALISDKDSNRETDCLPRLTTLSLHEEPNNGGSLPSRSYFDLVLELMKSRRTSEGPLFHVDIAGRSFVALTPEMKE
ELKSVVNNYQILVTNRKQKLPWL*
Coding >AgabiH97|038290
ATGGAGTTTGTAAAAGCTAATCCACACTGCGACTATCGTCCACAAGACGATTACCCCCATACGCTAACAAATCTC
GTGCAAATCAACGAGCAAGTCAACAGCCTCAACGACCATATTCGCGACTTGTTCAAGATACGCAGCACTTTGCTT
CATCGCTCAAATCAGCTTCGCTCCTTAGCTTCCACCCTTCCCCCTAAAATCTTGTCAAACATATTTCGCAAGTTG
GTCGATCCTGACTTTGCACTAGGTGAACCCAGCGCACCCTTCCGCCTCCGTCAATCTTTCACTCTTAGTTCGGTA
TCGACTCACTGGCGTCATGTAGCATTGGGGACACCGCAGTTGTGGGAGGATATGCATTGTATCGTTGCTAACAAC
AATCAGTCGGTTGAACACCTCATTTCTTTGCTTCAACACTGCTCTTCCTGCGCTCATACTCTGAATCTTTTACTG
TCGCTCCCGTCTTTCGAGAATGCCAGGGAGGTCCTGCACACACTTACTCAAGCACTTTTCTCAAGTGAAATCAAG
GAGAAAGTGAGGAGCCTAACGCTGTGCTGGCCGCCAGCTCATTGGCTCTCAATGATCTCTCGGTTGACCAGCCTT
CGTTCTCTGTACATCCTTGGTTATAACGCCTCAGACCGGGATAATTTCCGTCTGTACACACTCGCTACTGTTCCC
ACTTCCCTGCGGTCGCTGCACGTGGAAGATGTACCAATGTTTGACACTCCCATTCTGCGTCTGTGTCAAAACATC
GAATTTTGCATTTATCGACCTGGAAGTCCCATTGTTCCAGTTTCTTACTCTGAACCTCTTATCCTTGGAAAGCTC
GAACGCTTGATTATGCCAGCTGGGCATGGTCTTCAGACTGTAACGTCTGCGGGAAACTTGCTGTTGCCCTCACTC
AAGTATTTGGAATTAGAGCACCGGGGTTTTCATGACCTCGACTTTTACCCCGACATCATCATCCACTTCTGTCGC
CAAGTGTCTAAAACACTTCTAGGGCTTACTATTCGTTGTTCCGGACCCCAATGGTCAGTTGATGCACTACGAATA
TTATTTAAATCCCTCCCACATCTTCAAGAATTTCACGCCGAGGACTGGATAGCTGCCCCCATCAATGTCATTCAA
GCGCTCATATCTGACAAGGACAGCAACCGGGAGACTGATTGCTTGCCGCGCCTAACTACTTTGTCGCTGCATGAA
GAACCTAATAACGGTGGCAGTCTTCCGAGTCGTTCATATTTTGACCTGGTCCTGGAGTTAATGAAGAGTAGGCGG
ACTAGTGAGGGGCCTCTTTTCCATGTCGACATCGCGGGACGTTCCTTTGTGGCTCTGACCCCGGAAATGAAAGAA
GAATTGAAATCCGTCGTCAATAATTATCAGATCTTAGTCACAAATAGGAAGCAAAAATTACCGTGGTTATAA
Transcript >AgabiH97|038290
ATGGAGTTTGTAAAAGCTAATCCACACTGCGACTATCGTCCACAAGACGATTACCCCCATACGCTAACAAATCTC
GTGCAAATCAACGAGCAAGTCAACAGCCTCAACGACCATATTCGCGACTTGTTCAAGATACGCAGCACTTTGCTT
CATCGCTCAAATCAGCTTCGCTCCTTAGCTTCCACCCTTCCCCCTAAAATCTTGTCAAACATATTTCGCAAGTTG
GTCGATCCTGACTTTGCACTAGGTGAACCCAGCGCACCCTTCCGCCTCCGTCAATCTTTCACTCTTAGTTCGGTA
TCGACTCACTGGCGTCATGTAGCATTGGGGACACCGCAGTTGTGGGAGGATATGCATTGTATCGTTGCTAACAAC
AATCAGTCGGTTGAACACCTCATTTCTTTGCTTCAACACTGCTCTTCCTGCGCTCATACTCTGAATCTTTTACTG
TCGCTCCCGTCTTTCGAGAATGCCAGGGAGGTCCTGCACACACTTACTCAAGCACTTTTCTCAAGTGAAATCAAG
GAGAAAGTGAGGAGCCTAACGCTGTGCTGGCCGCCAGCTCATTGGCTCTCAATGATCTCTCGGTTGACCAGCCTT
CGTTCTCTGTACATCCTTGGTTATAACGCCTCAGACCGGGATAATTTCCGTCTGTACACACTCGCTACTGTTCCC
ACTTCCCTGCGGTCGCTGCACGTGGAAGATGTACCAATGTTTGACACTCCCATTCTGCGTCTGTGTCAAAACATC
GAATTTTGCATTTATCGACCTGGAAGTCCCATTGTTCCAGTTTCTTACTCTGAACCTCTTATCCTTGGAAAGCTC
GAACGCTTGATTATGCCAGCTGGGCATGGTCTTCAGACTGTAACGTCTGCGGGAAACTTGCTGTTGCCCTCACTC
AAGTATTTGGAATTAGAGCACCGGGGTTTTCATGACCTCGACTTTTACCCCGACATCATCATCCACTTCTGTCGC
CAAGTGTCTAAAACACTTCTAGGGCTTACTATTCGTTGTTCCGGACCCCAATGGTCAGTTGATGCACTACGAATA
TTATTTAAATCCCTCCCACATCTTCAAGAATTTCACGCCGAGGACTGGATAGCTGCCCCCATCAATGTCATTCAA
GCGCTCATATCTGACAAGGACAGCAACCGGGAGACTGATTGCTTGCCGCGCCTAACTACTTTGTCGCTGCATGAA
GAACCTAATAACGGTGGCAGTCTTCCGAGTCGTTCATATTTTGACCTGGTCCTGGAGTTAATGAAGAGTAGGCGG
ACTAGTGAGGGGCCTCTTTTCCATGTCGACATCGCGGGACGTTCCTTTGTGGCTCTGACCCCGGAAATGAAAGAA
GAATTGAAATCCGTCGTCAATAATTATCAGATCTTAGTCACAAATAGGAAGCAAAAATTACCGTGGTTATAA
Gene >AgabiH97|038290
ATGGAGTTTGTAAAAGCTAATCCACACTGCGACTATCGTCCACAAGACGATTACCCCCATACGCTAACAAATCTC
GTGCAAATCAACGAGCAAGTCAACAGCCTCAACGACCATATTCGCGACTTGTTCAAGATACGCAGCACTTTGCTT
CATCGCTCAAATCAGCTTCGCTCCTTAGCTTCCACCCTTCCCCCTAAAATCTTGTCAAACATATTTCGCAAGTTG
GTCGATCCTGACTTTGCACTAGGTGAACCCAGCGCACCCTTCCGCCTCCGTCAATCTTTCACTCTTAGTTCGGTA
TCGACTCACTGGCGTCATGTAGCATTGGGGACACCGCAGTTGTGGGAGGATATGCATTGTATCGTTGCTAACAAC
AATCAGTCGGTTGAACACCTCATTTCTTTGCTTCAACACTGCTCTTCCTGCGCTCATACTCTGAATCTTTTACTG
TCGCTCCCGTCTTTCGAGAATGCCAGGGAGGTCCTGCACACACTTACTCAAGCACTTTTCTCAAGTGAAATCAAG
GAGAAAGTGAGGAGCCTAACGCTGTGCTGGCCGCCAGCTCATTGGCTCTCAATGATCTCTCGGTTGACCAGCCTT
CGTTCTCTGTACATCCTTGGTTATAACGCCTCAGACCGGGATAATTTCCGTCTGTACACACTCGCTACTGTTCCC
ACTTCCCTGCGGTCGCTGCACGTGGAAGATGTACCAATGTTTGACACTCCCATTCTGCGTCTGTGTCAAAACATC
GAATTTTGCATTTATCGACCTGGAAGTCCCATTGTTCCAGTTTCTTACTCTGAACCTCTTATCCTTGGAAAGCTC
GAACGCTTGATTATGCCAGCTGGGCATGGTCTTCAGACTGTAACGTCTGCGGGAAACTTGCTGTTGCCCTCACTC
AAGTATTTGGAATTAGAGCACCGGGGTTTTCATGACCTCGACTTTTACCCCGACATCATCATCCACTTCTGTCGC
CAAGTGTCTAAAACACTTCTAGGGCTTACTATTCGTTGTTCCGGACCCCAATGGTCAGTTGATGCACTACGAATA
TTATTTAAATCCCTCCCACATCTTCAAGAATTTCACGCCGAGGACTGGATAGCTGCCCCCATCAATGTCATTCAA
GCGCTCATATCTGACAAGGACAGCAACCGGGAGACTGATTGCTTGCCGCGCCTAACTACTTTGTCGCTGCATGAA
GAACCTAATAACGGTGGCAGTCTTCCGAGTCGTTCATATTTTGACCTGGTCCTGGAGTTAATGAAGAGTAGGCGG
ACTAGTGAGGGGCCTCTTTTCCATGTCGACATCGCGGGACGTTCCTTTGTGGCTCTGACCCCGGAAATGAAAGAA
GAATTGAAATCCGTCGTCAATAATTATCAGATCTTAGTCACAAATAGGAAGCAAAAATTACCGTGGTTATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail