Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|038260
Gene name
Locationscaffold_13:1260580..1261650
Strand-
Gene length (bp)1070
Transcript length (bp)966
Coding sequence length (bp)966
Protein length (aa) 322

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00561 Abhydrolase_1 alpha/beta hydrolase fold 1.5E-24 47 302
PF12697 Abhydrolase_6 Alpha/beta hydrolase family 9.9E-12 48 306
PF12146 Hydrolase_4 Serine aminopeptidase, S33 3.8E-08 49 206

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|C3K630|LAAA_PSEFS L-amino acid amidase OS=Pseudomonas fluorescens (strain SBW25) GN=laaA PE=3 SV=1 32 316 7.0E-70
sp|Q76KX0|LAAA_PSEAZ L-amino acid amidase OS=Pseudomonas azotoformans GN=laaA PE=1 SV=1 32 316 4.0E-68
sp|Q97UA2|PIP_SULSO Proline iminopeptidase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=pip PE=3 SV=1 31 316 2.0E-40
sp|A5I3F5|PIP_CLOBH Proline iminopeptidase OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=pip PE=3 SV=1 30 316 9.0E-38
sp|C0ZKI1|PIP_BREBN Proline iminopeptidase OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=pip PE=3 SV=1 32 314 3.0E-36
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|C3K630|LAAA_PSEFS L-amino acid amidase OS=Pseudomonas fluorescens (strain SBW25) GN=laaA PE=3 SV=1 32 316 7.0E-70
sp|Q76KX0|LAAA_PSEAZ L-amino acid amidase OS=Pseudomonas azotoformans GN=laaA PE=1 SV=1 32 316 4.0E-68
sp|Q97UA2|PIP_SULSO Proline iminopeptidase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=pip PE=3 SV=1 31 316 2.0E-40
sp|A5I3F5|PIP_CLOBH Proline iminopeptidase OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=pip PE=3 SV=1 30 316 9.0E-38
sp|C0ZKI1|PIP_BREBN Proline iminopeptidase OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=pip PE=3 SV=1 32 314 3.0E-36
sp|P46541|PIP_BACCO Proline iminopeptidase OS=Bacillus coagulans GN=pip PE=1 SV=2 40 315 2.0E-35
sp|Q890D8|PIP_LACPL Proline iminopeptidase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=pip PE=3 SV=2 32 307 4.0E-34
sp|Q03NE0|PIP_LACBA Proline iminopeptidase OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=pip PE=3 SV=1 29 302 3.0E-33
sp|Q184M8|PIP_PEPD6 Proline iminopeptidase OS=Peptoclostridium difficile (strain 630) GN=pip PE=3 SV=1 13 315 2.0E-31
sp|C7TMK0|PIP_LACRL Proline iminopeptidase OS=Lactobacillus rhamnosus (strain Lc 705) GN=pip PE=3 SV=1 30 315 1.0E-30
sp|Q97A76|PIP_THEVO Proline iminopeptidase OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=pip PE=3 SV=1 48 314 2.0E-30
sp|P46542|PIP_LACDL Proline iminopeptidase OS=Lactobacillus delbrueckii subsp. lactis GN=pip PE=1 SV=1 32 317 5.0E-30
sp|P46544|PIP_LACDE Proline iminopeptidase OS=Lactobacillus delbrueckii subsp. bulgaricus GN=pepIP PE=1 SV=2 32 317 4.0E-29
sp|Q1G8L9|PIP_LACDA Proline iminopeptidase OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=pepIP PE=3 SV=1 32 317 4.0E-29
sp|P96084|PIP_THEAC Proline iminopeptidase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=pip PE=1 SV=1 48 314 5.0E-27
sp|C7PDD8|PIP_CHIPD Proline iminopeptidase OS=Chitinophaga pinensis (strain ATCC 43595 / DSM 2588 / NCIB 11800 / UQM 2034) GN=Cpin_0261 PE=3 SV=2 48 316 1.0E-25
sp|A5FIF5|PIP_FLAJ1 Proline iminopeptidase OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=fpaP PE=3 SV=2 24 316 6.0E-23
sp|P52278|PIP_LACHE Proline iminopeptidase OS=Lactobacillus helveticus GN=pip PE=1 SV=1 32 316 3.0E-22
sp|A8YWL3|PIP_LACH4 Proline iminopeptidase OS=Lactobacillus helveticus (strain DPC 4571) GN=pip PE=3 SV=1 32 316 3.0E-22
sp|O05420|PIP_ELIME Proline iminopeptidase OS=Elizabethkingia meningoseptica GN=fpaP PE=1 SV=1 48 316 8.0E-22
sp|Q5FMT1|PIP_LACAC Proline iminopeptidase OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=pip PE=3 SV=1 32 314 3.0E-20
sp|D5H0J3|PIP_LACCS Proline iminopeptidase OS=Lactobacillus crispatus (strain ST1) GN=pip PE=3 SV=1 32 316 3.0E-17
sp|P42786|PIP_NEIGO Proline iminopeptidase OS=Neisseria gonorrhoeae GN=pip PE=1 SV=1 47 272 4.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|038260
MTSAISPPKPAAVRTTEGEMLWEIKNNGKECKTWYRIYGDLKSGIRPLLVVHGGPGVTSDYLVSLSDLTVEKAIP
VIIYDQVGNGLSTHFPEMMGDVSFWTEELFLDELNRLLDHIGIVGDYDLFGHSWGGMLGARHASRRPRRLKRLIL
MSTPASGALWIEAQTKLRKTLPEAVQETFERCEREGKTSSKEYQEVSMLYYSQYLCTINPMPESLQKSFEWMGKD
PTVYLTLNGSPSGTYVPGPLKDYTLLDDLNKITVPTLLMNGWKDQVTDKCVYPLFQQIPRVRWIQFPESSHMAQL
EEHERFLQVVGLFLTEEGMGR*
Coding >AgabiH97|038260
ATGACCTCTGCAATTTCGCCACCAAAGCCCGCAGCGGTGAGGACCACCGAAGGGGAAATGTTATGGGAAATAAAA
AACAACGGGAAGGAATGCAAGACTTGGTATAGGATATATGGTGATTTGAAGTCAGGAATTCGTCCATTGTTGGTC
GTTCATGGAGGGCCTGGAGTGACCTCAGATTATTTGGTCTCGTTATCCGATCTCACTGTGGAGAAAGCTATCCCA
GTGATCATCTACGACCAGGTCGGAAATGGGCTCTCAACACATTTCCCAGAGATGATGGGTGACGTTTCGTTCTGG
ACAGAGGAGCTGTTCTTGGACGAGTTGAACCGTTTATTGGATCATATTGGAATCGTTGGCGATTATGATCTCTTT
GGACATTCTTGGGGTGGAATGTTGGGCGCTCGTCATGCATCGAGGCGACCCCGCAGGCTGAAGCGTCTTATTTTG
ATGTCTACGCCTGCTTCGGGCGCCCTCTGGATTGAGGCACAAACAAAACTTCGAAAGACGCTTCCCGAGGCGGTT
CAGGAAACTTTTGAGAGGTGTGAAAGGGAGGGAAAGACAAGCAGCAAAGAATATCAAGAAGTTTCCATGCTCTAT
TACTCTCAATACCTTTGCACGATCAATCCTATGCCAGAGTCTCTTCAAAAGAGTTTTGAATGGATGGGGAAAGAT
CCAACAGTTTATCTCACTTTGAATGGCAGCCCTTCTGGGACATATGTCCCTGGTCCACTCAAAGATTACACGCTG
TTGGATGACTTGAACAAGATAACAGTTCCGACTCTTTTGATGAACGGGTGGAAAGACCAGGTCACCGACAAATGT
GTTTATCCGTTGTTCCAGCAGATTCCTAGGGTTCGCTGGATTCAGTTCCCGGAATCGAGCCATATGGCACAGTTG
GAAGAGCACGAAAGGTTCTTACAGGTTGTCGGTCTCTTCCTCACTGAAGAGGGCATGGGCCGTTGA
Transcript >AgabiH97|038260
ATGACCTCTGCAATTTCGCCACCAAAGCCCGCAGCGGTGAGGACCACCGAAGGGGAAATGTTATGGGAAATAAAA
AACAACGGGAAGGAATGCAAGACTTGGTATAGGATATATGGTGATTTGAAGTCAGGAATTCGTCCATTGTTGGTC
GTTCATGGAGGGCCTGGAGTGACCTCAGATTATTTGGTCTCGTTATCCGATCTCACTGTGGAGAAAGCTATCCCA
GTGATCATCTACGACCAGGTCGGAAATGGGCTCTCAACACATTTCCCAGAGATGATGGGTGACGTTTCGTTCTGG
ACAGAGGAGCTGTTCTTGGACGAGTTGAACCGTTTATTGGATCATATTGGAATCGTTGGCGATTATGATCTCTTT
GGACATTCTTGGGGTGGAATGTTGGGCGCTCGTCATGCATCGAGGCGACCCCGCAGGCTGAAGCGTCTTATTTTG
ATGTCTACGCCTGCTTCGGGCGCCCTCTGGATTGAGGCACAAACAAAACTTCGAAAGACGCTTCCCGAGGCGGTT
CAGGAAACTTTTGAGAGGTGTGAAAGGGAGGGAAAGACAAGCAGCAAAGAATATCAAGAAGTTTCCATGCTCTAT
TACTCTCAATACCTTTGCACGATCAATCCTATGCCAGAGTCTCTTCAAAAGAGTTTTGAATGGATGGGGAAAGAT
CCAACAGTTTATCTCACTTTGAATGGCAGCCCTTCTGGGACATATGTCCCTGGTCCACTCAAAGATTACACGCTG
TTGGATGACTTGAACAAGATAACAGTTCCGACTCTTTTGATGAACGGGTGGAAAGACCAGGTCACCGACAAATGT
GTTTATCCGTTGTTCCAGCAGATTCCTAGGGTTCGCTGGATTCAGTTCCCGGAATCGAGCCATATGGCACAGTTG
GAAGAGCACGAAAGGTTCTTACAGGTTGTCGGTCTCTTCCTCACTGAAGAGGGCATGGGCCGTTGA
Gene >AgabiH97|038260
ATGACCTCTGCAATTTCGCCACCAAAGCCCGCAGCGGTGAGGACCACCGAAGGGGAAATGTTATGGGAAATAAAA
AACAACGGGAAGGAATGCAAGACTTGGTATAGGATATATGGTGATTTGAAGTCAGGAATTCGTCCATTGTTGGTC
GTTCATGGAGGGCCTGGAGTGACCTCAGATTATTTGGTCTCGTTATCCGATCTCACTGTGGAGAAAGCTATCCCA
GTGATCATCTACGACCAGGTCGGAAATGGGCTCTCAACACATTTCCCAGAGATGATGGGTGACGTTTCGTTCTGG
ACAGAGGAGCTGTTCTTGGACGAGTTGAACCGTTTATTGGATCATATTGGAATCGTTGGCGATTATGATCTCTTT
GGACATTCTTGGGGTGGAATGTTGGGCGCTCGTCATGCATCGAGGCGACCCCGCAGGCTGAAGCGTCTTATTTTG
ATGTCTACGCCTGCTTCGGGCGCCCTCTGGATTGAGGCACAAACAAAACTTCGAAAGACGCTTCCCGAGGCGGTT
CAGGAAACTTTTGAGAGGTGTGAAAGGGAGGGAAAGACAAGCAGCAAAGAATATCAAGAAGTTTCCATGCTCTAT
TACTCTCAATACCTTTGCACGATCAATCCTATGCCAGAGTCTCTTCAAAAGAGTTTTGAATGGATGGGGAAAGAT
CCAACAGTTTATCTCACTTTGTCGGTTTGAATTATCTCTTTTACACTCATACCTGTTGACTCGTTTGATAGGAAT
GGCAGCCCTTCTGGGACATATGTCCCTGGTCCACTCAAAGATTACACGCTGTTGGATGACTTGAACAAGATAACA
GTTCCGACTCTTTTGATGAACGGGTGGAAAGACCAGGTCACCGACAAATGTGTTTATCCGTTGTTCCAGCAGATT
CCTAGGGTTCGCTGGATTCAGTTCCCGGTGCGTGAATGAACGATCTGCTTCTAAATTCGACTCAACGCGATGATA
TCCAGGAATCGAGCCATATGGCACAGTTGGAAGAGCACGAAAGGTTCTTACAGGTTGTCGGTCTCTTCCTCACTG
AAGAGGGCATGGGCCGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail