Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|038090
Gene name
Locationscaffold_13:1209036..1212666
Strand-
Gene length (bp)3630
Transcript length (bp)3351
Coding sequence length (bp)3351
Protein length (aa) 1117

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00320 GATA GATA zinc finger 1.2E-09 394 427
PF00320 GATA GATA zinc finger 6.9E-15 494 527
PF08550 DUF1752 Fungal protein of unknown function (DUF1752) 1.4E-10 31 56

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5AP95|SFU1_CANAL Suppressor of ferric uptake 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SFU1 PE=1 SV=1 393 544 4.0E-30
sp|P40349|URB1_USTMA Siderophore biosynthesis regulatory protein URBS1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=URBS1 PE=3 SV=2 393 543 4.0E-24
sp|Q61169|GATA6_MOUSE Transcription factor GATA-6 OS=Mus musculus GN=Gata6 PE=1 SV=3 393 636 2.0E-23
sp|P97489|GATA5_MOUSE Transcription factor GATA-5 OS=Mus musculus GN=Gata5 PE=1 SV=2 393 581 3.0E-23
sp|Q92908|GATA6_HUMAN Transcription factor GATA-6 OS=Homo sapiens GN=GATA6 PE=1 SV=2 393 587 4.0E-23
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5AP95|SFU1_CANAL Suppressor of ferric uptake 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SFU1 PE=1 SV=1 393 544 4.0E-30
sp|P40349|URB1_USTMA Siderophore biosynthesis regulatory protein URBS1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=URBS1 PE=3 SV=2 393 543 4.0E-24
sp|Q61169|GATA6_MOUSE Transcription factor GATA-6 OS=Mus musculus GN=Gata6 PE=1 SV=3 393 636 2.0E-23
sp|P97489|GATA5_MOUSE Transcription factor GATA-5 OS=Mus musculus GN=Gata5 PE=1 SV=2 393 581 3.0E-23
sp|Q92908|GATA6_HUMAN Transcription factor GATA-6 OS=Homo sapiens GN=GATA6 PE=1 SV=2 393 587 4.0E-23
sp|P43696|GAT5B_XENLA GATA-binding factor 5-B OS=Xenopus laevis GN=gata5-b PE=2 SV=1 389 586 8.0E-23
sp|Q91678|GAT6A_XENLA GATA-binding factor 6-A OS=Xenopus laevis GN=gata6-a PE=2 SV=1 385 543 1.0E-22
sp|Q10134|FEP1_SCHPO Iron-sensing transcription factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fep1 PE=1 SV=1 384 543 1.0E-22
sp|P70005|GAT6B_XENLA GATA-binding factor 6-B OS=Xenopus laevis GN=gata6-b PE=2 SV=1 385 543 1.0E-22
sp|P46153|GATA6_RAT Transcription factor GATA-6 OS=Rattus norvegicus GN=Gata6 PE=1 SV=2 393 636 1.0E-22
sp|Q91677|GATA4_XENLA Transcription factor GATA-4 OS=Xenopus laevis GN=gata4 PE=2 SV=1 393 543 1.0E-22
sp|P43693|GATA6_CHICK Transcription factor GATA-6 OS=Gallus gallus GN=GATA6 PE=2 SV=1 393 654 2.0E-22
sp|P43691|GATA4_CHICK Transcription factor GATA-4 (Fragment) OS=Gallus gallus GN=GATA4 PE=2 SV=1 393 565 2.0E-22
sp|P43695|GAT5A_XENLA GATA-binding factor 5-A OS=Xenopus laevis GN=gata5-a PE=2 SV=1 389 586 3.0E-22
sp|Q0Q0E4|GATA4_CANLF Transcription factor GATA-4 OS=Canis lupus familiaris GN=GATA4 PE=2 SV=1 393 565 5.0E-22
sp|P43694|GATA4_HUMAN Transcription factor GATA-4 OS=Homo sapiens GN=GATA4 PE=1 SV=2 393 565 6.0E-22
sp|Q95JA5|GATA6_PIG Transcription factor GATA-6 (Fragment) OS=Sus scrofa GN=GATA6 PE=2 SV=2 393 579 6.0E-22
sp|P46152|GATA4_RAT Transcription factor GATA-4 OS=Rattus norvegicus GN=Gata4 PE=1 SV=1 393 543 6.0E-22
sp|Q08369|GATA4_MOUSE Transcription factor GATA-4 OS=Mus musculus GN=Gata4 PE=1 SV=4 393 543 6.0E-22
sp|P23768|GAT1B_XENLA GATA-binding factor 1-B OS=Xenopus laevis GN=gata1-b PE=2 SV=1 393 543 1.0E-21
sp|P52168|PNR_DROME GATA-binding factor A OS=Drosophila melanogaster GN=pnr PE=1 SV=1 393 553 2.0E-21
sp|P28515|ELT1_CAEEL Transcription factor elt-1 OS=Caenorhabditis elegans GN=elt-1 PE=1 SV=1 393 550 2.0E-21
sp|P91623|GATAC_DROME GATA-binding factor C OS=Drosophila melanogaster GN=grn PE=2 SV=1 393 543 4.0E-21
sp|P23767|GAT1A_XENLA GATA-binding factor 1-A OS=Xenopus laevis GN=gata1-a PE=2 SV=1 393 541 5.0E-21
sp|P52167|GATAB_BOMMO Transcription factor BCFI OS=Bombyx mori GN=GATA-B PE=2 SV=1 393 582 1.0E-20
sp|P17678|GATA1_CHICK Erythroid transcription factor OS=Gallus gallus GN=GATA1 PE=1 SV=1 383 559 4.0E-20
sp|O94720|YCF8_SCHPO GATA zinc finger domain-containing protein C1393.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1393.08 PE=3 SV=1 394 538 6.0E-20
sp|P23825|GATA3_CHICK GATA-binding factor 3 OS=Gallus gallus GN=GATA3 PE=2 SV=1 393 543 3.0E-19
sp|Q91428|GATA3_DANRE Transcription factor GATA-3 OS=Danio rerio GN=gata3 PE=2 SV=1 393 543 3.0E-19
sp|P23773|GATA3_XENLA GATA-binding factor 3 OS=Xenopus laevis GN=gata3 PE=2 SV=1 393 543 3.0E-19
sp|P23772|GATA3_MOUSE Trans-acting T-cell-specific transcription factor GATA-3 OS=Mus musculus GN=Gata3 PE=1 SV=1 393 543 3.0E-19
sp|P23771|GATA3_HUMAN Trans-acting T-cell-specific transcription factor GATA-3 OS=Homo sapiens GN=GATA3 PE=1 SV=1 393 543 4.0E-19
sp|Q08DV0|GATA3_BOVIN Trans-acting T-cell-specific transcription factor GATA-3 OS=Bos taurus GN=GATA3 PE=2 SV=1 393 543 5.0E-19
sp|P23824|GATA2_CHICK GATA-binding factor 2 OS=Gallus gallus GN=GATA2 PE=2 SV=1 367 543 8.0E-19
sp|Q924Y4|GATA2_RAT Endothelial transcription factor GATA-2 OS=Rattus norvegicus GN=Gata2 PE=1 SV=1 393 543 8.0E-19
sp|P23769|GATA2_HUMAN Endothelial transcription factor GATA-2 OS=Homo sapiens GN=GATA2 PE=1 SV=3 393 543 1.0E-18
sp|O09100|GATA2_MOUSE Endothelial transcription factor GATA-2 OS=Mus musculus GN=Gata2 PE=1 SV=2 393 543 1.0E-18
sp|P23770|GATA2_XENLA GATA-binding factor 2 OS=Xenopus laevis GN=gata2 PE=2 SV=1 367 543 2.0E-18
sp|Q9BWX5|GATA5_HUMAN Transcription factor GATA-5 OS=Homo sapiens GN=GATA5 PE=1 SV=1 393 604 6.0E-18
sp|Q3SZJ5|GATA5_BOVIN Transcription factor GATA-5 OS=Bos taurus GN=GATA5 PE=2 SV=1 393 654 2.0E-17
sp|Q9HEV5|ASD4_NEUCR GATA type zinc finger protein asd-4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=asd-4 PE=1 SV=1 494 548 4.0E-17
sp|P18494|GLN3_YEAST Nitrogen regulatory protein GLN3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GLN3 PE=1 SV=2 443 541 1.0E-16
sp|P17429|AREA_EMENI Nitrogen regulatory protein areA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=areA PE=1 SV=2 494 582 3.0E-16
sp|P42944|GZF3_YEAST Protein GZF3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GZF3 PE=1 SV=1 494 543 5.0E-16
sp|P43429|GATA1_RAT Erythroid transcription factor OS=Rattus norvegicus GN=Gata1 PE=2 SV=1 393 549 6.0E-16
sp|O13415|AREA_ASPOR Nitrogen regulatory protein areA OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=areA PE=3 SV=1 445 582 1.0E-15
sp|Q5A201|GZF3_CANAL Transcriptional regulator GZF3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GZF3 PE=2 SV=1 494 543 1.0E-15
sp|P17679|GATA1_MOUSE Erythroid transcription factor OS=Mus musculus GN=Gata1 PE=1 SV=1 393 551 1.0E-15
sp|P15976|GATA1_HUMAN Erythroid transcription factor OS=Homo sapiens GN=GATA1 PE=1 SV=1 393 559 1.0E-15
sp|Q92259|SREP_PENCH GATA factor SREP OS=Penicillium chrysogenum GN=SREP PE=3 SV=1 483 543 2.0E-15
sp|P43574|GAT1_YEAST Transcriptional regulatory protein GAT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAT1 PE=1 SV=1 493 551 3.0E-15
sp|Q01168|NUT1_MAGO7 Nitrogen regulatory protein NUT1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=NUT1 PE=3 SV=1 494 575 3.0E-15
sp|Q01582|AREA_PENCH Nitrogen regulatory protein areA OS=Penicillium chrysogenum GN=AREA PE=3 SV=1 494 546 5.0E-15
sp|O13412|AREA_ASPNG Nitrogen regulatory protein areA OS=Aspergillus niger GN=areA PE=3 SV=1 494 546 5.0E-15
sp|P78688|AREA_GIBFU Nitrogen regulatory protein areA OS=Gibberella fujikuroi GN=AREA PE=3 SV=1 488 543 6.0E-15
sp|Q92269|NRFA_PENUR Nitrogen regulatory protein nrfA OS=Penicillium urticae GN=nrfA PE=3 SV=1 494 546 7.0E-15
sp|O13508|AREA_PENRO Nitrogen regulatory protein areA OS=Penicillium roqueforti GN=AREA PE=3 SV=2 494 546 7.0E-15
sp|P26343|DAL80_YEAST Nitrogen regulatory protein DAL80 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DAL80 PE=2 SV=1 485 539 1.0E-14
sp|P52172|SRP_DROME Box A-binding factor OS=Drosophila melanogaster GN=srp PE=1 SV=2 494 543 1.0E-14
sp|Q5A432|GAT1_CANAL Transcriptional regulatory protein GAT1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GAT1 PE=2 SV=1 494 543 2.0E-14
sp|P19212|NIT2_NEUCR Nitrogen catabolic enzyme regulatory protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nit-2 PE=1 SV=2 494 543 2.0E-14
sp|Q10280|GAF1_SCHPO Transcription factor gaf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gaf1 PE=1 SV=2 451 543 8.0E-14
sp|Q10655|ELT2_CAEEL Transcription factor elt-2 OS=Caenorhabditis elegans GN=elt-2 PE=2 SV=1 494 543 6.0E-11
sp|P91623|GATAC_DROME GATA-binding factor C OS=Drosophila melanogaster GN=grn PE=2 SV=1 493 570 1.0E-10
sp|P43692|GATA5_CHICK Transcription factor GATA-5 OS=Gallus gallus GN=GATA5 PE=1 SV=1 504 568 4.0E-10
sp|Q924Y4|GATA2_RAT Endothelial transcription factor GATA-2 OS=Rattus norvegicus GN=Gata2 PE=1 SV=1 489 570 5.0E-10
sp|P23769|GATA2_HUMAN Endothelial transcription factor GATA-2 OS=Homo sapiens GN=GATA2 PE=1 SV=3 489 570 6.0E-10
sp|O09100|GATA2_MOUSE Endothelial transcription factor GATA-2 OS=Mus musculus GN=Gata2 PE=1 SV=2 489 570 6.0E-10
sp|P23770|GATA2_XENLA GATA-binding factor 2 OS=Xenopus laevis GN=gata2 PE=2 SV=1 489 570 6.0E-10
sp|Q9UHF7|TRPS1_HUMAN Zinc finger transcription factor Trps1 OS=Homo sapiens GN=TRPS1 PE=1 SV=2 494 543 6.0E-10
sp|P23824|GATA2_CHICK GATA-binding factor 2 OS=Gallus gallus GN=GATA2 PE=2 SV=1 489 570 7.0E-10
sp|Q925H1|TRPS1_MOUSE Zinc finger transcription factor Trps1 OS=Mus musculus GN=Trps1 PE=1 SV=1 494 543 7.0E-10
sp|Q90ZS6|TRPS1_XENLA Zinc finger transcription factor Trps1 OS=Xenopus laevis GN=trps1 PE=1 SV=1 494 543 8.0E-10
sp|P23767|GAT1A_XENLA GATA-binding factor 1-A OS=Xenopus laevis GN=gata1-a PE=2 SV=1 457 542 1.0E-09
sp|P17679|GATA1_MOUSE Erythroid transcription factor OS=Mus musculus GN=Gata1 PE=1 SV=1 490 542 1.0E-09
sp|P23825|GATA3_CHICK GATA-binding factor 3 OS=Gallus gallus GN=GATA3 PE=2 SV=1 474 570 2.0E-09
sp|Q91428|GATA3_DANRE Transcription factor GATA-3 OS=Danio rerio GN=gata3 PE=2 SV=1 489 570 2.0E-09
sp|P23772|GATA3_MOUSE Trans-acting T-cell-specific transcription factor GATA-3 OS=Mus musculus GN=Gata3 PE=1 SV=1 474 570 2.0E-09
sp|P43429|GATA1_RAT Erythroid transcription factor OS=Rattus norvegicus GN=Gata1 PE=2 SV=1 490 542 2.0E-09
sp|P15976|GATA1_HUMAN Erythroid transcription factor OS=Homo sapiens GN=GATA1 PE=1 SV=1 490 542 2.0E-09
sp|P23771|GATA3_HUMAN Trans-acting T-cell-specific transcription factor GATA-3 OS=Homo sapiens GN=GATA3 PE=1 SV=1 493 570 3.0E-09
sp|Q08DV0|GATA3_BOVIN Trans-acting T-cell-specific transcription factor GATA-3 OS=Bos taurus GN=GATA3 PE=2 SV=1 493 570 3.0E-09
sp|P17678|GATA1_CHICK Erythroid transcription factor OS=Gallus gallus GN=GATA1 PE=1 SV=1 489 570 4.0E-09
sp|P23773|GATA3_XENLA GATA-binding factor 3 OS=Xenopus laevis GN=gata3 PE=2 SV=1 493 570 4.0E-09
sp|P97489|GATA5_MOUSE Transcription factor GATA-5 OS=Mus musculus GN=Gata5 PE=1 SV=2 468 570 6.0E-09
sp|P46152|GATA4_RAT Transcription factor GATA-4 OS=Rattus norvegicus GN=Gata4 PE=1 SV=1 469 548 6.0E-09
sp|Q08369|GATA4_MOUSE Transcription factor GATA-4 OS=Mus musculus GN=Gata4 PE=1 SV=4 469 548 9.0E-09
sp|Q9HEV5|ASD4_NEUCR GATA type zinc finger protein asd-4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=asd-4 PE=1 SV=1 394 434 9.0E-09
sp|Q0Q0E4|GATA4_CANLF Transcription factor GATA-4 OS=Canis lupus familiaris GN=GATA4 PE=2 SV=1 469 548 1.0E-08
sp|P43694|GATA4_HUMAN Transcription factor GATA-4 OS=Homo sapiens GN=GATA4 PE=1 SV=2 469 548 1.0E-08
sp|Q9BWX5|GATA5_HUMAN Transcription factor GATA-5 OS=Homo sapiens GN=GATA5 PE=1 SV=1 468 531 1.0E-08
sp|P52172|SRP_DROME Box A-binding factor OS=Drosophila melanogaster GN=srp PE=1 SV=2 394 434 1.0E-08
sp|Q91678|GAT6A_XENLA GATA-binding factor 6-A OS=Xenopus laevis GN=gata6-a PE=2 SV=1 480 531 3.0E-08
sp|P70005|GAT6B_XENLA GATA-binding factor 6-B OS=Xenopus laevis GN=gata6-b PE=2 SV=1 480 531 3.0E-08
sp|Q91677|GATA4_XENLA Transcription factor GATA-4 OS=Xenopus laevis GN=gata4 PE=2 SV=1 489 548 3.0E-08
sp|Q3SZJ5|GATA5_BOVIN Transcription factor GATA-5 OS=Bos taurus GN=GATA5 PE=2 SV=1 462 548 3.0E-08
sp|Q5A201|GZF3_CANAL Transcriptional regulator GZF3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GZF3 PE=2 SV=1 394 434 3.0E-08
sp|Q10655|ELT2_CAEEL Transcription factor elt-2 OS=Caenorhabditis elegans GN=elt-2 PE=2 SV=1 394 456 3.0E-08
sp|P52168|PNR_DROME GATA-binding factor A OS=Drosophila melanogaster GN=pnr PE=1 SV=1 481 531 4.0E-08
sp|P43692|GATA5_CHICK Transcription factor GATA-5 OS=Gallus gallus GN=GATA5 PE=1 SV=1 493 531 4.0E-08
sp|P43691|GATA4_CHICK Transcription factor GATA-4 (Fragment) OS=Gallus gallus GN=GATA4 PE=2 SV=1 489 531 5.0E-08
sp|P43695|GAT5A_XENLA GATA-binding factor 5-A OS=Xenopus laevis GN=gata5-a PE=2 SV=1 476 531 6.0E-08
sp|P43693|GATA6_CHICK Transcription factor GATA-6 OS=Gallus gallus GN=GATA6 PE=2 SV=1 489 531 7.0E-08
sp|P43691|GATA4_CHICK Transcription factor GATA-4 (Fragment) OS=Gallus gallus GN=GATA4 PE=2 SV=1 390 434 7.0E-08
sp|Q0Q0E4|GATA4_CANLF Transcription factor GATA-4 OS=Canis lupus familiaris GN=GATA4 PE=2 SV=1 390 435 7.0E-08
sp|P43694|GATA4_HUMAN Transcription factor GATA-4 OS=Homo sapiens GN=GATA4 PE=1 SV=2 390 435 7.0E-08
sp|P46152|GATA4_RAT Transcription factor GATA-4 OS=Rattus norvegicus GN=Gata4 PE=1 SV=1 390 435 7.0E-08
sp|Q08369|GATA4_MOUSE Transcription factor GATA-4 OS=Mus musculus GN=Gata4 PE=1 SV=4 390 435 7.0E-08
sp|Q61169|GATA6_MOUSE Transcription factor GATA-6 OS=Mus musculus GN=Gata6 PE=1 SV=3 489 531 1.0E-07
sp|Q92908|GATA6_HUMAN Transcription factor GATA-6 OS=Homo sapiens GN=GATA6 PE=1 SV=2 489 531 1.0E-07
sp|P46153|GATA6_RAT Transcription factor GATA-6 OS=Rattus norvegicus GN=Gata6 PE=1 SV=2 489 531 1.0E-07
sp|Q91677|GATA4_XENLA Transcription factor GATA-4 OS=Xenopus laevis GN=gata4 PE=2 SV=1 390 434 1.0E-07
sp|P28515|ELT1_CAEEL Transcription factor elt-1 OS=Caenorhabditis elegans GN=elt-1 PE=1 SV=1 475 570 1.0E-07
sp|P42944|GZF3_YEAST Protein GZF3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GZF3 PE=1 SV=1 394 434 2.0E-07
sp|P26343|DAL80_YEAST Nitrogen regulatory protein DAL80 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DAL80 PE=2 SV=1 394 434 3.0E-07
sp|Q5A432|GAT1_CANAL Transcriptional regulatory protein GAT1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GAT1 PE=2 SV=1 386 434 7.0E-07
sp|P78688|AREA_GIBFU Nitrogen regulatory protein areA OS=Gibberella fujikuroi GN=AREA PE=3 SV=1 378 434 8.0E-07
sp|Q92269|NRFA_PENUR Nitrogen regulatory protein nrfA OS=Penicillium urticae GN=nrfA PE=3 SV=1 385 434 1.0E-06
sp|P17429|AREA_EMENI Nitrogen regulatory protein areA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=areA PE=1 SV=2 385 434 2.0E-06
sp|O13508|AREA_PENRO Nitrogen regulatory protein areA OS=Penicillium roqueforti GN=AREA PE=3 SV=2 385 434 2.0E-06
sp|O13415|AREA_ASPOR Nitrogen regulatory protein areA OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=areA PE=3 SV=1 345 434 3.0E-06
sp|Q01582|AREA_PENCH Nitrogen regulatory protein areA OS=Penicillium chrysogenum GN=AREA PE=3 SV=1 388 434 3.0E-06
sp|O13412|AREA_ASPNG Nitrogen regulatory protein areA OS=Aspergillus niger GN=areA PE=3 SV=1 345 434 3.0E-06
sp|P52167|GATAB_BOMMO Transcription factor BCFI OS=Bombyx mori GN=GATA-B PE=2 SV=1 472 531 4.0E-06
sp|P19212|NIT2_NEUCR Nitrogen catabolic enzyme regulatory protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nit-2 PE=1 SV=2 394 434 4.0E-06
sp|P91623|GATAC_DROME GATA-binding factor C OS=Drosophila melanogaster GN=grn PE=2 SV=1 377 435 5.0E-06
sp|Q9UHF7|TRPS1_HUMAN Zinc finger transcription factor Trps1 OS=Homo sapiens GN=TRPS1 PE=1 SV=2 376 439 6.0E-06
sp|Q925H1|TRPS1_MOUSE Zinc finger transcription factor Trps1 OS=Mus musculus GN=Trps1 PE=1 SV=1 376 439 6.0E-06
sp|Q90ZS6|TRPS1_XENLA Zinc finger transcription factor Trps1 OS=Xenopus laevis GN=trps1 PE=1 SV=1 376 439 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0043565 sequence-specific DNA binding Yes
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0060255 regulation of macromolecule metabolic process No
GO:0080090 regulation of primary metabolic process No
GO:0065007 biological regulation No
GO:0003676 nucleic acid binding No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No
GO:0009889 regulation of biosynthetic process No
GO:0031326 regulation of cellular biosynthetic process No
GO:0008150 biological_process No
GO:0097159 organic cyclic compound binding No
GO:0019222 regulation of metabolic process No
GO:2001141 regulation of RNA biosynthetic process No
GO:0003677 DNA binding No
GO:0051252 regulation of RNA metabolic process No
GO:0050794 regulation of cellular process No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0031323 regulation of cellular metabolic process No
GO:0003674 molecular_function No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0010468 regulation of gene expression No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:0050789 regulation of biological process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.3156 0.9471 0.031 0.0143 0.1002 0.0009 0.034 0.0317 0.0142 0.0023

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
GATA type zinc finger

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Orthologs

Orthofinder run ID1
Orthogroup5303
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|552200
Agaricus bisporus var bisporus H97 AgabiH97|038090 (this protein)
Rhodonia placenta FPRL280 RhoplFPRL280|122_1

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|038090
MPAILNLKFKGNKSFVAFSNLNDSEALTKTWKVCTKVASFLEQGQRLENLSWRLWHLQNLMVDTDNAKSKREFKK
LSKCMGDKLDKEKGRSIEELEAPDYKRTPSSEMIRQRAAEKERYREQNAKPGTIKRMQFTFSVDQPSAPGANLPV
KKPDLKPSPEFTKRTRAATRAQADDSTLASSSSAISDDLPSLKFDSIFNQGFGPSALLFPAPTLTTRLSYGEGLN
PSNDDTFTVSRPTIELPLDEILNTVDSPPPMPPPPAPPAPTPPQQQQDVVMRSVPSKRRTRKSSVATRDDGDSDH
DTAADTTPFASALKSYTPLSQAVKEPETVAPSKLNPLFSTSVTRTNPNTRPTLTVKTQTSARSSGPGATATSLNP
STLRSSNSSGAPGGVKAECSNCGATHTPLWRRGLNDELNCNACGLYCKLHKRPRPKSMRNSHGGSGSGGSSNNTG
NAAVERPLTVSNASIVQSVTHGIGGGSNSRQDPVDVLGSQTAQCYNCNTTATPLWRKDDEGKTVCNACGLYYKLH
GSPRPISMKSDVIRKRSRHDARRGSNAASSAPGNINNTNTNTTSIEDTQSASPTASRRTSPIHDHDHDPPSPILA
PDSSTTMSGPNSSSAVNVNVNAATTTLGYDYTQDGLTDAFGTTQSELVGALGQDQTSLFQNTFQFQYPGPYHPDY
LLQMYTAHMHGVGGGVTTSGGAGTGNAGASPDLGNVDLSSPSSSNSVGQQQHQQHNLQQHHHTTSPDDLDLPLMS
PRLTKRRRMSIDSCIEEPPVSAVSWYSPESSSISLNGGGTGGTSSSSSGFPFGNTFATVTTTTTTGSGGQKEQGL
GLIGISQHHHSQQGQGQHHHHSLSQPEASTSSHLLLHSSSSSNSSSSSSGSSSSSSPLHHQQQQQQQQQQQQHSH
SHSLSLSHLSPHLSHLQNSHSAHTSSASASSHSTHSHHHHHHSMSLSHSLSNSHTHTHTHTGGPALRGSGNTFWH
PPMMPLSDEQFQQQQCQPQSQSQQSQQSPSQQNQQQQHRILSRSSPYLSSASSGSKSSLSPSSDMDMEMEMEIEE
DSPMDYIHGSTSGTKGLGSGTTGTTGSGSGIGTGTTTVIQDDESLFSAYLNHHPATPDEGGGEVVV*
Coding >AgabiH97|038090
ATGCCCGCCATCCTCAATCTCAAGTTCAAGGGGAACAAGTCTTTCGTCGCCTTTTCCAACCTCAACGATTCCGAG
GCCCTCACAAAGACCTGGAAGGTCTGCACAAAGGTCGCCAGCTTCCTCGAACAGGGCCAGCGCCTTGAAAACCTG
AGTTGGCGCCTATGGCACCTCCAGAACCTCATGGTCGACACTGACAACGCAAAGTCCAAACGCGAGTTCAAAAAG
CTCTCCAAATGTATGGGCGACAAGCTCGACAAGGAAAAAGGCCGGAGTATCGAAGAACTCGAGGCACCCGACTAC
AAGCGAACTCCGTCCTCTGAAATGATCCGTCAGCGCGCCGCCGAAAAGGAGCGTTACCGCGAGCAAAACGCAAAG
CCGGGTACAATCAAGCGTATGCAGTTCACGTTTAGCGTCGACCAGCCCTCTGCTCCCGGCGCTAATCTACCCGTC
AAGAAGCCTGATCTCAAACCCTCGCCCGAGTTTACCAAGCGCACTCGCGCCGCAACCCGTGCTCAGGCAGATGAC
TCGACCCTGGCTTCGTCTTCTTCTGCCATCTCTGATGACCTCCCCTCCCTCAAGTTTGATTCCATTTTCAATCAG
GGTTTCGGCCCGTCTGCTTTGCTGTTCCCCGCTCCCACTCTTACTACCCGTCTCAGCTACGGTGAAGGGCTCAAC
CCCTCCAATGACGACACGTTTACCGTTTCGCGTCCAACCATCGAGCTCCCCCTCGATGAAATCCTCAACACTGTC
GATTCTCCTCCCCCCATGCCACCACCACCAGCACCACCAGCACCAACACCACCACAACAACAACAAGACGTCGTC
ATGCGCTCCGTCCCCTCAAAGCGAAGAACACGCAAATCGTCCGTTGCTACCCGCGACGATGGCGATAGCGACCAC
GACACTGCCGCTGATACCACTCCCTTTGCTTCAGCCCTGAAATCCTACACTCCTCTATCGCAGGCGGTAAAGGAA
CCCGAAACAGTCGCTCCATCCAAACTGAACCCTCTCTTCTCTACTTCTGTCACTCGTACAAACCCAAACACCCGT
CCAACACTCACTGTCAAAACTCAAACATCAGCCCGTTCTTCCGGCCCGGGAGCCACCGCCACATCACTCAATCCC
TCTACGCTTCGTAGTAGCAATAGCAGTGGCGCTCCTGGAGGCGTCAAAGCCGAATGTTCCAATTGTGGTGCTACA
CATACGCCTTTGTGGCGAAGAGGGTTGAACGACGAGTTGAATTGTAATGCCTGTGGTTTGTATTGTAAATTGCAC
AAGAGACCGAGACCGAAGAGTATGAGGAATAGTCATGGTGGGAGTGGTAGTGGGGGGAGTAGTAATAATACTGGG
AATGCGGCTGTGGAGAGACCTTTGACGGTGTCGAATGCGAGTATTGTGCAGAGTGTGACGCATGGGATTGGGGGT
GGAAGTAATAGCAGACAGGATCCTGTGGATGTTTTGGGTTCGCAAACGGCACAGTGTTATAATTGTAATACGACT
GCTACTCCGCTTTGGAGAAAGGATGATGAAGGAAAGACGGTGTGCAATGCATGCGGTTTGTATTATAAACTTCAT
GGTTCGCCACGGCCTATTTCGATGAAATCGGATGTTATACGAAAACGGTCTCGACATGATGCTCGGCGTGGTTCC
AATGCTGCTTCCTCTGCTCCTGGAAACATAAACAACACCAACACCAACACCACATCCATCGAAGATACACAATCA
GCAAGTCCAACTGCCAGTCGTCGAACATCACCTATCCATGATCATGATCATGATCCTCCCTCTCCTATATTAGCA
CCTGATTCATCTACGACTATGTCAGGACCGAATTCGAGTTCGGCAGTGAATGTGAATGTGAATGCTGCGACGACG
ACTTTGGGGTATGATTATACGCAGGATGGGTTGACGGATGCGTTTGGAACGACTCAGTCGGAGTTGGTGGGTGCG
TTGGGACAGGATCAGACGTCATTGTTTCAGAATACTTTTCAGTTTCAGTATCCGGGGCCTTATCATCCGGATTAT
TTGTTGCAGATGTATACGGCGCATATGCATGGTGTAGGTGGTGGTGTGACCACTAGTGGGGGTGCGGGTACGGGG
AATGCGGGTGCGAGTCCGGATTTGGGGAATGTGGATTTGAGTTCGCCTTCGAGTTCGAATTCGGTTGGTCAACAA
CAACATCAACAACATAATTTGCAGCAACATCATCATACGACGAGTCCGGATGATTTGGATTTACCGTTGATGAGT
CCGAGGTTGACGAAGAGGAGGAGGATGAGTATTGATTCGTGTATTGAAGAACCACCTGTTTCGGCTGTGTCGTGG
TATTCACCGGAATCAAGTTCGATTTCGCTTAATGGTGGTGGTACTGGGGGGACGTCGTCTTCGTCGTCGGGGTTT
CCGTTTGGGAATACGTTTGCTACTGTTACGACGACGACGACGACAGGGAGTGGGGGGCAGAAGGAACAGGGGTTG
GGGTTGATTGGGATTTCGCAGCATCATCATTCGCAACAAGGGCAGGGACAGCATCATCATCATTCGTTATCGCAA
CCTGAAGCTTCGACTTCGTCGCATCTTTTACTTCATTCTTCAAGTTCATCGAATTCTTCTTCATCTAGTTCTGGT
TCGAGTTCTTCTTCGTCTCCACTTCATCATCAACAGCAACAACAACAGCAACAACAGCAACAACAACATTCACAT
TCGCATTCACTTTCACTTTCGCATCTTTCACCCCATCTTTCACATTTGCAAAATTCACATTCTGCACATACTTCT
TCTGCTTCTGCTTCTTCGCATTCGACTCATTCTCATCATCATCATCATCATTCAATGTCACTTTCACATTCACTT
TCGAATTCGCATACGCATACGCATACGCATACGGGTGGACCTGCGTTGAGAGGGTCTGGGAATACGTTTTGGCAT
CCGCCTATGATGCCTTTGAGTGATGAACAGTTTCAACAACAGCAGTGTCAACCACAATCTCAATCGCAACAATCA
CAACAATCACCATCACAGCAGAATCAACAACAACAACATAGGATTTTGAGTAGGTCTTCACCGTATTTGAGTTCG
GCTTCGTCTGGTTCGAAATCGTCGTTGTCGCCATCGTCAGATATGGATATGGAGATGGAGATGGAGATTGAGGAG
GATAGTCCTATGGATTATATTCATGGTTCTACGAGTGGGACGAAAGGGTTAGGGAGTGGGACGACTGGGACAACA
GGGAGTGGGAGTGGGATAGGGACAGGGACGACGACGGTGATACAAGATGATGAGAGTTTGTTTTCGGCTTATTTG
AATCATCATCCTGCGACGCCGGATGAGGGTGGAGGGGAAGTTGTTGTTTAA
Transcript >AgabiH97|038090
ATGCCCGCCATCCTCAATCTCAAGTTCAAGGGGAACAAGTCTTTCGTCGCCTTTTCCAACCTCAACGATTCCGAG
GCCCTCACAAAGACCTGGAAGGTCTGCACAAAGGTCGCCAGCTTCCTCGAACAGGGCCAGCGCCTTGAAAACCTG
AGTTGGCGCCTATGGCACCTCCAGAACCTCATGGTCGACACTGACAACGCAAAGTCCAAACGCGAGTTCAAAAAG
CTCTCCAAATGTATGGGCGACAAGCTCGACAAGGAAAAAGGCCGGAGTATCGAAGAACTCGAGGCACCCGACTAC
AAGCGAACTCCGTCCTCTGAAATGATCCGTCAGCGCGCCGCCGAAAAGGAGCGTTACCGCGAGCAAAACGCAAAG
CCGGGTACAATCAAGCGTATGCAGTTCACGTTTAGCGTCGACCAGCCCTCTGCTCCCGGCGCTAATCTACCCGTC
AAGAAGCCTGATCTCAAACCCTCGCCCGAGTTTACCAAGCGCACTCGCGCCGCAACCCGTGCTCAGGCAGATGAC
TCGACCCTGGCTTCGTCTTCTTCTGCCATCTCTGATGACCTCCCCTCCCTCAAGTTTGATTCCATTTTCAATCAG
GGTTTCGGCCCGTCTGCTTTGCTGTTCCCCGCTCCCACTCTTACTACCCGTCTCAGCTACGGTGAAGGGCTCAAC
CCCTCCAATGACGACACGTTTACCGTTTCGCGTCCAACCATCGAGCTCCCCCTCGATGAAATCCTCAACACTGTC
GATTCTCCTCCCCCCATGCCACCACCACCAGCACCACCAGCACCAACACCACCACAACAACAACAAGACGTCGTC
ATGCGCTCCGTCCCCTCAAAGCGAAGAACACGCAAATCGTCCGTTGCTACCCGCGACGATGGCGATAGCGACCAC
GACACTGCCGCTGATACCACTCCCTTTGCTTCAGCCCTGAAATCCTACACTCCTCTATCGCAGGCGGTAAAGGAA
CCCGAAACAGTCGCTCCATCCAAACTGAACCCTCTCTTCTCTACTTCTGTCACTCGTACAAACCCAAACACCCGT
CCAACACTCACTGTCAAAACTCAAACATCAGCCCGTTCTTCCGGCCCGGGAGCCACCGCCACATCACTCAATCCC
TCTACGCTTCGTAGTAGCAATAGCAGTGGCGCTCCTGGAGGCGTCAAAGCCGAATGTTCCAATTGTGGTGCTACA
CATACGCCTTTGTGGCGAAGAGGGTTGAACGACGAGTTGAATTGTAATGCCTGTGGTTTGTATTGTAAATTGCAC
AAGAGACCGAGACCGAAGAGTATGAGGAATAGTCATGGTGGGAGTGGTAGTGGGGGGAGTAGTAATAATACTGGG
AATGCGGCTGTGGAGAGACCTTTGACGGTGTCGAATGCGAGTATTGTGCAGAGTGTGACGCATGGGATTGGGGGT
GGAAGTAATAGCAGACAGGATCCTGTGGATGTTTTGGGTTCGCAAACGGCACAGTGTTATAATTGTAATACGACT
GCTACTCCGCTTTGGAGAAAGGATGATGAAGGAAAGACGGTGTGCAATGCATGCGGTTTGTATTATAAACTTCAT
GGTTCGCCACGGCCTATTTCGATGAAATCGGATGTTATACGAAAACGGTCTCGACATGATGCTCGGCGTGGTTCC
AATGCTGCTTCCTCTGCTCCTGGAAACATAAACAACACCAACACCAACACCACATCCATCGAAGATACACAATCA
GCAAGTCCAACTGCCAGTCGTCGAACATCACCTATCCATGATCATGATCATGATCCTCCCTCTCCTATATTAGCA
CCTGATTCATCTACGACTATGTCAGGACCGAATTCGAGTTCGGCAGTGAATGTGAATGTGAATGCTGCGACGACG
ACTTTGGGGTATGATTATACGCAGGATGGGTTGACGGATGCGTTTGGAACGACTCAGTCGGAGTTGGTGGGTGCG
TTGGGACAGGATCAGACGTCATTGTTTCAGAATACTTTTCAGTTTCAGTATCCGGGGCCTTATCATCCGGATTAT
TTGTTGCAGATGTATACGGCGCATATGCATGGTGTAGGTGGTGGTGTGACCACTAGTGGGGGTGCGGGTACGGGG
AATGCGGGTGCGAGTCCGGATTTGGGGAATGTGGATTTGAGTTCGCCTTCGAGTTCGAATTCGGTTGGTCAACAA
CAACATCAACAACATAATTTGCAGCAACATCATCATACGACGAGTCCGGATGATTTGGATTTACCGTTGATGAGT
CCGAGGTTGACGAAGAGGAGGAGGATGAGTATTGATTCGTGTATTGAAGAACCACCTGTTTCGGCTGTGTCGTGG
TATTCACCGGAATCAAGTTCGATTTCGCTTAATGGTGGTGGTACTGGGGGGACGTCGTCTTCGTCGTCGGGGTTT
CCGTTTGGGAATACGTTTGCTACTGTTACGACGACGACGACGACAGGGAGTGGGGGGCAGAAGGAACAGGGGTTG
GGGTTGATTGGGATTTCGCAGCATCATCATTCGCAACAAGGGCAGGGACAGCATCATCATCATTCGTTATCGCAA
CCTGAAGCTTCGACTTCGTCGCATCTTTTACTTCATTCTTCAAGTTCATCGAATTCTTCTTCATCTAGTTCTGGT
TCGAGTTCTTCTTCGTCTCCACTTCATCATCAACAGCAACAACAACAGCAACAACAGCAACAACAACATTCACAT
TCGCATTCACTTTCACTTTCGCATCTTTCACCCCATCTTTCACATTTGCAAAATTCACATTCTGCACATACTTCT
TCTGCTTCTGCTTCTTCGCATTCGACTCATTCTCATCATCATCATCATCATTCAATGTCACTTTCACATTCACTT
TCGAATTCGCATACGCATACGCATACGCATACGGGTGGACCTGCGTTGAGAGGGTCTGGGAATACGTTTTGGCAT
CCGCCTATGATGCCTTTGAGTGATGAACAGTTTCAACAACAGCAGTGTCAACCACAATCTCAATCGCAACAATCA
CAACAATCACCATCACAGCAGAATCAACAACAACAACATAGGATTTTGAGTAGGTCTTCACCGTATTTGAGTTCG
GCTTCGTCTGGTTCGAAATCGTCGTTGTCGCCATCGTCAGATATGGATATGGAGATGGAGATGGAGATTGAGGAG
GATAGTCCTATGGATTATATTCATGGTTCTACGAGTGGGACGAAAGGGTTAGGGAGTGGGACGACTGGGACAACA
GGGAGTGGGAGTGGGATAGGGACAGGGACGACGACGGTGATACAAGATGATGAGAGTTTGTTTTCGGCTTATTTG
AATCATCATCCTGCGACGCCGGATGAGGGTGGAGGGGAAGTTGTTGTTTAA
Gene >AgabiH97|038090
ATGCCCGCCATCCTCAATCTCAAGTTCAAGGTGTGTTCTTAGCCGTCAACTTTCACTTTCACACTCACTTTCGTA
GGGGAACAAGTCTTTCGTCGCCTTTTCCAACCTCAACGATTCCGAGGCCCTCACAAAGACCTGGAAGGTCCGTCC
GCTCCTCTCTTTTCTCGTCCTTTTCGTCCTCAACTCTCCCCTCCAGGTCTGCACAAAGGTCGCCAGCTTCCTCGA
ACAGGGCCAGCGCCTTGAAAACCTGAGTTGGCGCCTATGGCACCTCCAGAACCTCATGGTCGACACTGACAACGC
AAAGTCCAAACGCGAGTTCAAAAAGCTCTCCAAATGTATGGGCGACAAGCTCGACAAGGAAAAAGGCCGGTACGT
TCTTCCTTTTTTTTTCCAACTTTACTCCCTCCCTTATCTTATCTCTCTCTCTCGCTCAGGAGTATCGAAGAACTC
GAGGCACCCGACTACAAGCGAACTCCGTCCTCTGAAATGATCCGTCAGCGCGCCGCCGAAAAGGAGCGTTACCGC
GAGCAAAACGCAAAGCCGGGTACAATCAAGCGTATGCAGTTCACGTTTAGCGTCGACCAGCCCTCTGCTCCCGGC
GCTAATCTACCCGTCAAGAAGCCTGATCTCAAACCCTCGCCCGAGTTTACCAAGCGCACTCGCGCCGCAACCCGT
GCTCAGGCAGATGACTCGACCCTGGCTTCGTCTTCTTCTGCCATCTCTGATGACCTCCCCTCCCTCAAGTTTGAT
TCCATTTTCAATCAGGGTTTCGGCCCGTCTGCTTTGCTGTTCCCCGCTCCCACTCTTACTACCCGTCTCAGCTAC
GGTGAAGGGCTCAACCCCTCCAATGACGACACGTTTACCGTTTCGCGTCCAACCATCGAGCTCCCCCTCGATGAA
ATCCTCAACACTGTCGATTCTCCTCCCCCCATGCCACCACCACCAGCACCACCAGCACCAACACCACCACAACAA
CAACAAGACGTCGTCATGCGCTCCGTCCCCTCAAAGCGAAGAACACGCAAATCGTCCGTTGCTACCCGCGACGAT
GGCGATAGCGACCACGACACTGCCGCTGATACCACTCCCTTTGCTTCAGCCCTGAAATCCTACACTCCTCTATCG
CAGGCGGTAAAGGAACCCGAAACAGTCGCTCCATCCAAACTGAACCCTCTCTTCTCTACTTCTGTCACTCGTACA
AACCCAAACACCCGTCCAACACTCACTGTCAAAACTCAAACATCAGCCCGTTCTTCCGGCCCGGGAGCCACCGCC
ACATCACTCAATCCCTCTACGCTTCGTAGTAGCAATAGCAGTGGCGCTCCTGGAGGCGTCAAAGCCGAATGTTCC
AATTGTGGTGCTACACATACGCCTTTGTGGCGAAGAGGGTTGAACGACGAGTTGAATTGTAATGCCTGTGGTTTG
TATTGTAAATTGCACAAGAGACCGAGACCGAAGAGTATGAGGAATAGTCATGGTGGGAGTGGTAGTGGGGGGAGT
AGTAATAATACTGGGAATGCGGCTGTGGAGAGACCTTTGACGGTGTCGAATGCGAGTATTGTGCAGAGTGTGACG
CATGGGATTGGGGGTGGAAGTAATAGCAGACAGGATCCTGTGGATGTTTTGGGTGAGTTTATATGCGCTAAAACC
TCTTTTTTTTTTTACTGAGAAAGGGGCTTTAGGTTCGCAAACGGCACAGTGTTATAATTGTAATACGACTGCTAC
TCCGCTTTGGAGAAAGGATGATGAAGGAAAGACGGTGTGCAATGCGTGAGTTTTTTTGTCTTCCCAAAAACGATT
TTTTCCCATTTTGACACTATTTTTATTAGATGCGGTTTGTATTATAAACTTCATGGTTCGCCACGGCCTATTTCG
ATGAAATCGGATGTTATACGAAAACGGTCTCGACATGATGCTCGGCGTGGTTCCAATGCTGCTTCCTCTGCTCCT
GGAAACATAAACAACACCAACACCAACACCACATCCATCGAAGATACACAATCAGCAAGTCCAACTGCCAGTCGT
CGAACATCACCTATCCATGATCATGATCATGATCCTCCCTCTCCTATATTAGCACCTGATTCATCTACGACTATG
TCAGGACCGAATTCGAGTTCGGCAGTGAATGTGAATGTGAATGCTGCGACGACGACTTTGGGGTATGATTATACG
CAGGATGGGTTGACGGATGCGTTTGGAACGACTCAGTCGGAGTTGGTGGGTGCGTTGGGACAGGATCAGACGTCA
TTGTTTCAGAATACTTTTCAGTTTCAGTATCCGGGGCCTTATCATCCGGATTATTTGTTGCAGATGTATACGGCG
CATATGCATGGTGTAGGTGGTGGTGTGACCACTAGTGGGGGTGCGGGTACGGGGAATGCGGGTGCGAGTCCGGAT
TTGGGGAATGTGGATTTGAGTTCGCCTTCGAGTTCGAATTCGGTTGGTCAACAACAACATCAACAACATAATTTG
CAGCAACATCATCATACGACGAGTCCGGATGATTTGGATTTACCGTTGATGAGTCCGAGGTTGACGAAGAGGAGG
AGGATGAGTATTGATTCGTGTATTGAAGAACCACCTGTTTCGGCTGTGTCGTGGTATTCACCGGAATCAAGTTCG
ATTTCGCTTAATGGTGGTGGTACTGGGGGGACGTCGTCTTCGTCGTCGGGGTTTCCGTTTGGGAATACGTTTGCT
ACTGTTACGACGACGACGACGACAGGGAGTGGGGGGCAGAAGGAACAGGGGTTGGGGTTGATTGGGATTTCGCAG
CATCATCATTCGCAACAAGGGCAGGGACAGCATCATCATCATTCGTTATCGCAACCTGAAGCTTCGACTTCGTCG
CATCTTTTACTTCATTCTTCAAGTTCATCGAATTCTTCTTCATCTAGTTCTGGTTCGAGTTCTTCTTCGTCTCCA
CTTCATCATCAACAGCAACAACAACAGCAACAACAGCAACAACAACATTCACATTCGCATTCACTTTCACTTTCG
CATCTTTCACCCCATCTTTCACATTTGCAAAATTCACATTCTGCACATACTTCTTCTGCTTCTGCTTCTTCGCAT
TCGACTCATTCTCATCATCATCATCATCATTCAATGTCACTTTCACATTCACTTTCGAATTCGCATACGCATACG
CATACGCATACGGGTGGACCTGCGTTGAGAGGGTCTGGGAATACGTTTTGGCATCCGCCTATGATGCCTTTGAGT
GATGAACAGTTTCAACAACAGCAGTGTCAACCACAATCTCAATCGCAACAATCACAACAATCACCATCACAGCAG
AATCAACAACAACAACATAGGATTTTGAGTAGGTCTTCACCGTATTTGAGTTCGGCTTCGTCTGGTTCGAAATCG
TCGTTGTCGCCATCGTCAGATATGGATATGGAGATGGAGATGGAGATTGAGGAGGATAGTCCTATGGATTATATT
CATGGTTCTACGAGTGGGACGAAAGGGTTAGGGAGTGGGACGACTGGGACAACAGGGAGTGGGAGTGGGATAGGG
ACAGGGACGACGACGGTGATACAAGATGATGAGAGTTTGTTTTCGGCTTATTTGAATCATCATCCTGCGACGCCG
GATGAGGGTGGAGGGGAAGTTGTTGTTTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail