Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|037940
Gene name
Locationscaffold_13:1164878..1167146
Strand+
Gene length (bp)2268
Transcript length (bp)1848
Coding sequence length (bp)1848
Protein length (aa) 616

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14075 UBN_AB Ubinuclein conserved middle domain 2.1E-52 355 597
PF08729 HUN HPC2 and ubinuclein domain 1.4E-12 214 261

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 57 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|037940
MNPEHISDQDDLQLEETAAEAEHQAVAEEDEDDREEEYDESADEDENEEDSESEVEEGDDSTKDSIPIAESHGPS
AAVPDDGGAASSASRSIAIPVLIHPSSPPPISASPAGDPGLASSVSAPPGPSSKPAASSAKPRSKKPRSPSPSPP
PAPPAPPLTTIRLEIKLGGPNKYEIDVSKLAKDSGQRPPTPPPRITVTKQPVSESEPDTDGGKKKKRRKNPTSEY
YDVNDPFIDDSELALDERTYFAQTKQQGFYVSSGEVALLKDKTPKKPKSKKMISLSAAINASNGSAVKASAVKAS
AVKSEGTKEEETANADDSGAKYGDEEGDERVGQKRKRYITIVENGKKRKVVDQSSFHPELQASIERLKEYIKAEN
WSQKGKFPATLKPQLANLALQAIRLDEYDEHFFNLMPVLFPYNKFTMTKLIKRTVFADHMKLLHDRQEELLKELK
ALTTEGFQKAEEEWTRSVLAWDRRQEKAKSDQPDSAAPTRHPTEEMEVDSISTGVGQQGDGENKDGAGKESKEAQ
PPQKRYRLTEPMKNVVWQLVLLSNECCRLENEKNNLEGSVIQVSEQGSRKNLYQKIVAQFPDGWMNSGNVSREVS
VMKKKFEKETMEGED*
Coding >AgabiH97|037940
ATGAATCCTGAGCACATCTCCGACCAGGACGACCTCCAACTTGAAGAGACTGCGGCTGAGGCCGAACATCAAGCC
GTCGCTGAGGAAGACGAGGACGATAGAGAAGAAGAGTACGATGAATCAGCCGATGAGGACGAGAATGAGGAAGAC
AGTGAAAGTGAAGTGGAAGAAGGCGACGACAGTACGAAAGATAGCATACCCATTGCAGAGTCGCATGGGCCATCT
GCAGCAGTGCCTGACGACGGCGGTGCAGCGTCGTCGGCGTCGCGTTCCATCGCCATACCCGTTCTCATTCACCCC
TCCAGTCCTCCGCCCATTTCGGCTTCTCCCGCCGGAGATCCCGGCCTGGCTTCCTCCGTTTCTGCTCCACCCGGA
CCTTCCTCCAAGCCCGCCGCTTCTTCGGCTAAACCCCGCTCAAAGAAGCCCAGATCCCCATCGCCATCACCGCCA
CCCGCCCCTCCCGCCCCGCCGCTTACGACCATCCGACTCGAAATCAAGCTTGGAGGCCCGAATAAATACGAAATC
GATGTATCAAAACTGGCTAAAGACTCGGGGCAGCGGCCACCCACGCCTCCCCCGAGAATTACTGTCACTAAGCAG
CCTGTGAGTGAGAGCGAACCTGATACTGATGGTGGAAAGAAGAAGAAACGTCGGAAAAATCCTACATCGGAATAT
TACGATGTCAACGATCCTTTCATTGACGATTCTGAACTTGCACTTGACGAGCGGACGTATTTTGCTCAAACAAAA
CAGCAAGGTTTCTATGTTTCCAGTGGGGAAGTTGCACTTCTCAAAGACAAGACACCCAAAAAACCCAAGTCAAAG
AAGATGATTTCCCTCTCTGCAGCTATCAATGCCAGCAATGGATCCGCTGTCAAAGCATCCGCCGTCAAAGCATCT
GCTGTCAAATCGGAGGGGACAAAGGAAGAGGAGACTGCTAATGCCGACGACTCCGGCGCGAAATACGGAGATGAA
GAAGGTGATGAGCGTGTTGGGCAGAAACGGAAACGGTATATTACAATTGTCGAGAATGGAAAGAAACGGAAGGTT
GTCGATCAGTCCTCTTTCCATCCCGAGCTTCAAGCGTCCATTGAGAGATTGAAAGAATATATCAAAGCTGAAAAC
TGGTCTCAAAAAGGCAAATTTCCTGCGACTCTCAAACCTCAACTCGCGAATCTCGCCTTACAGGCAATCAGACTC
GACGAATACGATGAACATTTCTTCAACCTCATGCCCGTTTTATTCCCTTACAACAAATTCACGATGACAAAATTA
ATTAAACGGACAGTATTTGCGGATCATATGAAACTGCTTCATGATAGACAAGAAGAACTTCTCAAAGAACTTAAA
GCTCTTACGACTGAAGGTTTTCAAAAGGCCGAAGAAGAGTGGACGAGAAGCGTTTTAGCTTGGGATCGTCGTCAG
GAGAAAGCTAAAAGCGATCAACCTGATTCAGCAGCTCCTACACGTCATCCAACAGAAGAAATGGAAGTGGATAGT
ATTAGTACCGGAGTTGGTCAACAGGGAGATGGTGAAAACAAGGATGGAGCTGGGAAAGAATCGAAAGAGGCTCAA
CCACCGCAGAAGAGGTATCGATTGACGGAGCCGATGAAGAATGTTGTGTGGCAGTTGGTATTACTCAGTAATGAG
TGTTGTCGATTGGAAAATGAGAAAAATAATTTAGAAGGTTCGGTTATTCAAGTTAGTGAACAAGGGTCGAGAAAG
AATTTGTATCAGAAAATCGTGGCGCAATTCCCGGATGGATGGATGAATTCGGGGAATGTTTCAAGAGAAGTGAGC
GTTATGAAGAAGAAATTTGAAAAAGAGACTATGGAAGGCGAAGATTAG
Transcript >AgabiH97|037940
ATGAATCCTGAGCACATCTCCGACCAGGACGACCTCCAACTTGAAGAGACTGCGGCTGAGGCCGAACATCAAGCC
GTCGCTGAGGAAGACGAGGACGATAGAGAAGAAGAGTACGATGAATCAGCCGATGAGGACGAGAATGAGGAAGAC
AGTGAAAGTGAAGTGGAAGAAGGCGACGACAGTACGAAAGATAGCATACCCATTGCAGAGTCGCATGGGCCATCT
GCAGCAGTGCCTGACGACGGCGGTGCAGCGTCGTCGGCGTCGCGTTCCATCGCCATACCCGTTCTCATTCACCCC
TCCAGTCCTCCGCCCATTTCGGCTTCTCCCGCCGGAGATCCCGGCCTGGCTTCCTCCGTTTCTGCTCCACCCGGA
CCTTCCTCCAAGCCCGCCGCTTCTTCGGCTAAACCCCGCTCAAAGAAGCCCAGATCCCCATCGCCATCACCGCCA
CCCGCCCCTCCCGCCCCGCCGCTTACGACCATCCGACTCGAAATCAAGCTTGGAGGCCCGAATAAATACGAAATC
GATGTATCAAAACTGGCTAAAGACTCGGGGCAGCGGCCACCCACGCCTCCCCCGAGAATTACTGTCACTAAGCAG
CCTGTGAGTGAGAGCGAACCTGATACTGATGGTGGAAAGAAGAAGAAACGTCGGAAAAATCCTACATCGGAATAT
TACGATGTCAACGATCCTTTCATTGACGATTCTGAACTTGCACTTGACGAGCGGACGTATTTTGCTCAAACAAAA
CAGCAAGGTTTCTATGTTTCCAGTGGGGAAGTTGCACTTCTCAAAGACAAGACACCCAAAAAACCCAAGTCAAAG
AAGATGATTTCCCTCTCTGCAGCTATCAATGCCAGCAATGGATCCGCTGTCAAAGCATCCGCCGTCAAAGCATCT
GCTGTCAAATCGGAGGGGACAAAGGAAGAGGAGACTGCTAATGCCGACGACTCCGGCGCGAAATACGGAGATGAA
GAAGGTGATGAGCGTGTTGGGCAGAAACGGAAACGGTATATTACAATTGTCGAGAATGGAAAGAAACGGAAGGTT
GTCGATCAGTCCTCTTTCCATCCCGAGCTTCAAGCGTCCATTGAGAGATTGAAAGAATATATCAAAGCTGAAAAC
TGGTCTCAAAAAGGCAAATTTCCTGCGACTCTCAAACCTCAACTCGCGAATCTCGCCTTACAGGCAATCAGACTC
GACGAATACGATGAACATTTCTTCAACCTCATGCCCGTTTTATTCCCTTACAACAAATTCACGATGACAAAATTA
ATTAAACGGACAGTATTTGCGGATCATATGAAACTGCTTCATGATAGACAAGAAGAACTTCTCAAAGAACTTAAA
GCTCTTACGACTGAAGGTTTTCAAAAGGCCGAAGAAGAGTGGACGAGAAGCGTTTTAGCTTGGGATCGTCGTCAG
GAGAAAGCTAAAAGCGATCAACCTGATTCAGCAGCTCCTACACGTCATCCAACAGAAGAAATGGAAGTGGATAGT
ATTAGTACCGGAGTTGGTCAACAGGGAGATGGTGAAAACAAGGATGGAGCTGGGAAAGAATCGAAAGAGGCTCAA
CCACCGCAGAAGAGGTATCGATTGACGGAGCCGATGAAGAATGTTGTGTGGCAGTTGGTATTACTCAGTAATGAG
TGTTGTCGATTGGAAAATGAGAAAAATAATTTAGAAGGTTCGGTTATTCAAGTTAGTGAACAAGGGTCGAGAAAG
AATTTGTATCAGAAAATCGTGGCGCAATTCCCGGATGGATGGATGAATTCGGGGAATGTTTCAAGAGAAGTGAGC
GTTATGAAGAAGAAATTTGAAAAAGAGACTATGGAAGGCGAAGATTAG
Gene >AgabiH97|037940
ATGAATCCTGAGCACATCTCCGACCAGGACGACCTCCAACTTGAAGAGACTGCGGCTGAGGCCGAACATCAAGCC
GTCGCTGAGGAAGACGAGGACGATAGAGAAGAAGAGTACGATGAATCAGCCGATGAGGACGAGAATGAGGAAGAC
AGTGAAAGTGAAGTGGAAGAAGGCGACGACAGTACGAAAGATAGCATACCCATTGCAGAGTCGCATGGGCCATCT
GCAGCAGTGCCTGACGACGGCGGTGCAGCGTCGTCGGCGTCGCGTTCCATCGCCATACCCGTTCTCATTCACCCC
TCCAGTCCTCCGCCCATTTCGGCTTCTCCCGCCGGAGATCCCGGCCTGGCTTCCTCCGTTTCTGCTCCACCCGGA
CCTTCCTCCAAGCCCGCCGCTTCTTCGGCTAAACCCCGCTCAAAGAAGCCCAGATCCCCATCGCCATCACCGCCA
CCCGCCCCTCCCGCCCCGCCGCTTACGACCATCCGACTCGAAATCAAGCTTGGAGGCCCGAATAAATACGAAATC
GATGTATCAAAACTGGCTAAAGACTCGGGGCAGCGGCCACCCACGCCTCCCCCGAGAATTACTGTCACTAAGCAG
CCTGTGAGTGAGAGCGAACCTGATACTGATGGTGGAAAGAAGAAGAAACGTCGGGTAAGATGTCACTCAACTTTT
TGTTGAACTTGTTGTGATGCTCACAATCATGGCTGCGTAGAAAAATCCTACATCGGAATATTACGATGTCAACGA
TCCTTTCATTGACGATTCTGAACTTGCACTTGACGAGCGGACGTATTTTGCTCAAACAAAACAGCAAGGTTTCTA
TGTTTCCAGTGGGGAAGTTGCACTTCTCAAAGACAAGTGAGCCCTTGATGATGTCCACTGAGATAGACAGGGATA
TTGATAGTTTCTTCTCAGGACACCCAAAAAACCCAAGTCAAAGAAGATGATTTCCCTCTCTGCAGCTATCAATGC
CAGCAATGGATCCGCTGTCAAAGCATCCGCCGTCAAAGCATCTGCTGTCAAATCGGAGGGGACAAAGGAAGAGGA
GACTGCTAATGCCGACGACTCCGGCGCGAAATACGGAGATGAAGAAGGTGATGAGCGTGTTGGGCAGAAACGGAA
ACGGTATATTACAATTGTCGAGAATGGAAAGAAACGGAAGGTTGTCGATCAGGTGGGTTATTCACACCATATGTA
TTACCCCCTCTCATGTATGTTTCTAGTCCTCTTTCCATCCCGAGCTTCAAGCGTCCATTGAGAGATTGAAAGAAT
ATATCAAAGCTGGTAAGTGTGTGTATTTAATTATCATGTTTTTTAACTAGTAACCTATACTCGCGCAATCACAGA
AAACTGGTCTCAAAAAGGCAAATTTCCTGCGACTCTCAAACCTCAACTCGCGAATCTCGCCTTACAGGCAATCAG
ACTCGACGAATACGATGAACATTTCTTCAACCTCATGCCCGTTTTATTCCCTTACAACAAATTCACGATGACAAA
ATTAATTAAACGGACAGTATTTGCGGATCATATGAAACTGCTTCATGATAGACAAGAAGAACTTCTCAAAGAACT
TAAAGCTCTTACGACTGAAGGTTTTCAAAAGGCCGAAGAAGAGTGGACGAGAAGCGTTTTAGCTTGGGGTTAGTC
TTTTTTATTATTTCTATTCTTCTCGGAAGCTGACAATTGAGTTGGTATTTATATTATTAGATCGTCGTCAGGAGA
AAGCTAAAAGCGATCAACCTGATTCAGCAGCTCCTACACGTCATCCAACAGAAGAAATGGAAGTGGATAGTATTA
GTACCGGAGTTGGTCAACAGGGAGATGGTGAAAACAAGGATGGAGCTGGGAAAGAATCGAAAGAGGCTCAACCAC
CGCAGAAGAGGTATCGATTGACGGAGCCGATGAAGAATGTTGTGTGGCAGTTGGTATTACTCAGTAATGAGTGTT
GTCGATTGGAAAATGAGAAAAAGTGAGTTTTTTGGTTTTTGGTTTTCCATTGGTTTGTGTAGATGTTGAATGAAT
GAACGAACACATACACAGTAATTTAGAAGGTTCGGTTATTCAAGTTAGTGAACAAGGGTCGAGAAAGAATTTGTA
TCAGAAAATCGTGGCGCAATTCCCGGATGGATGGATGAATTCGGGGAATGTTTCAAGAGAAGGTGAGTAAAAAAA
TCCTGATGATCCGGGAAAATGTTAAGACAATGATATCCAGTGAGCGTTATGAAGAAGAAATTTGAAAAAGAGACT
ATGGAAGGCGAAGATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail