Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|037880
Gene name
Locationscaffold_13:1151098..1152772
Strand+
Gene length (bp)1674
Transcript length (bp)1623
Coding sequence length (bp)1623
Protein length (aa) 541

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12937 F-box-like F-box-like 1.5E-05 41 94

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus 0.646 0.5613 0.1258 0.0838 0.2714 0.0071 0.1224 0.1668 0.1179 0.0067

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 67 89 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 4.71 2.10 7.33
Initials Initials knots 6.73 3.24 10.22
Pileal_Stipeal_center Stage I stipe center 6.29 3.00 9.59
Pileal_Stipeal_shell Stage I stipe shell 4.71 2.11 7.31
DIF_stipe_center Stage II stipe center 4.90 2.23 7.57
DIF_stipe_shell Stage II stipe shell 8.55 4.24 12.87
DIF_stipe_skin Stage II stipe skin 8.85 4.41 13.28
DIF_cap_skin Stage II cap skin 4.39 1.98 6.80
DIF_cap_tissue Stage II cap tissue 4.13 1.84 6.41
DIF_gill_tissue Stage II gill tissue 4.46 2.00 6.92
YFB_stipe_center Young fruiting body stipe center 7.42 3.58 11.27
YFB_stipe_shell Young fruiting body stipe shell 7.89 3.88 11.90
YFB_stipe_skin Young fruiting body stipe skin 13.44 7.07 19.81
YFB_cap_skin Young fruiting body cap skin 6.23 2.95 9.51
YFB_cap_tissue Young fruiting body cap tissue 4.15 1.83 6.47
YFB_gill_tissue Young fruiting body gill tissue 5.86 2.69 9.02
YFB_veil Young fruiting body veil 5.42 2.51 8.33

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.940572 no
Casing YFB_stipe_center 0.262378 no
Casing YFB_stipe_shell 0.168934 no
Casing YFB_stipe_skin 0.002951 yes
Casing YFB_cap_skin 0.550196 no
Casing YFB_cap_tissue 0.846570 no
Casing YFB_gill_tissue 0.688180 no
Casing YFB_veil 0.824461 no
Casing Initials 0.416744 no
Casing Pileal_Stipeal_center 0.534722 no
Casing Pileal_Stipeal_shell 0.998209 no
Casing DIF_stipe_center 0.958275 no
Casing DIF_stipe_shell 0.096942 no
Casing DIF_stipe_skin 0.077161 no
Casing DIF_cap_skin 0.919861 no
Casing DIF_cap_tissue 0.835071 no
DIF_gill_tissue YFB_stipe_center 0.201872 no
DIF_gill_tissue YFB_stipe_shell 0.124703 no
DIF_gill_tissue YFB_stipe_skin 0.000613 yes
DIF_gill_tissue YFB_cap_skin 0.456793 no
DIF_gill_tissue YFB_cap_tissue 0.919260 no
DIF_gill_tissue YFB_gill_tissue 0.585392 no
DIF_gill_tissue YFB_veil 0.728502 no
YFB_stipe_center YFB_stipe_shell 0.929931 no
YFB_stipe_center YFB_stipe_skin 0.083328 no
YFB_stipe_center YFB_cap_skin 0.748637 no
YFB_stipe_center YFB_cap_tissue 0.136602 no
YFB_stipe_center YFB_gill_tissue 0.649129 no
YFB_stipe_center YFB_veil 0.498845 no
YFB_stipe_shell YFB_stipe_skin 0.110863 no
YFB_stipe_shell YFB_cap_skin 0.618125 no
YFB_stipe_shell YFB_cap_tissue 0.080708 no
YFB_stipe_shell YFB_gill_tissue 0.509225 no
YFB_stipe_shell YFB_veil 0.365801 no
YFB_stipe_skin YFB_cap_skin 0.014668 yes
YFB_stipe_skin YFB_cap_tissue 0.000613 yes
YFB_stipe_skin YFB_gill_tissue 0.011041 yes
YFB_stipe_skin YFB_veil 0.007782 yes
YFB_cap_skin YFB_cap_tissue 0.349565 no
YFB_cap_skin YFB_gill_tissue 0.930536 no
YFB_cap_skin YFB_veil 0.817269 no
YFB_cap_tissue YFB_gill_tissue 0.465509 no
YFB_cap_tissue YFB_veil 0.606650 no
YFB_gill_tissue YFB_veil 0.910530 no
Initials DIF_gill_tissue 0.331689 no
Initials YFB_stipe_center 0.878716 no
Initials YFB_stipe_shell 0.776711 no
Initials YFB_stipe_skin 0.036228 yes
Initials YFB_cap_skin 0.907706 no
Initials YFB_cap_tissue 0.234184 no
Initials YFB_gill_tissue 0.821737 no
Initials YFB_veil 0.685728 no
Initials Pileal_Stipeal_center 0.920988 no
Initials Pileal_Stipeal_shell 0.418823 no
Initials DIF_stipe_center 0.497395 no
Initials DIF_stipe_shell 0.622121 no
Initials DIF_stipe_skin 0.553732 no
Initials DIF_cap_skin 0.302693 no
Initials DIF_cap_tissue 0.218082 no
Pileal_Stipeal_center DIF_gill_tissue 0.445917 no
Pileal_Stipeal_center YFB_stipe_center 0.771210 no
Pileal_Stipeal_center YFB_stipe_shell 0.644451 no
Pileal_Stipeal_center YFB_stipe_skin 0.019715 yes
Pileal_Stipeal_center YFB_cap_skin 0.988311 no
Pileal_Stipeal_center YFB_cap_tissue 0.330649 no
Pileal_Stipeal_center YFB_gill_tissue 0.920177 no
Pileal_Stipeal_center YFB_veil 0.803720 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.544449 no
Pileal_Stipeal_center DIF_stipe_center 0.626650 no
Pileal_Stipeal_center DIF_stipe_shell 0.483821 no
Pileal_Stipeal_center DIF_stipe_skin 0.422068 no
Pileal_Stipeal_center DIF_cap_skin 0.414173 no
Pileal_Stipeal_center DIF_cap_tissue 0.308159 no
Pileal_Stipeal_shell DIF_gill_tissue 0.939938 no
Pileal_Stipeal_shell YFB_stipe_center 0.263595 no
Pileal_Stipeal_shell YFB_stipe_shell 0.171933 no
Pileal_Stipeal_shell YFB_stipe_skin 0.002525 yes
Pileal_Stipeal_shell YFB_cap_skin 0.559317 no
Pileal_Stipeal_shell YFB_cap_tissue 0.846217 no
Pileal_Stipeal_shell YFB_gill_tissue 0.691243 no
Pileal_Stipeal_shell YFB_veil 0.822768 no
Pileal_Stipeal_shell DIF_stipe_center 0.956874 no
Pileal_Stipeal_shell DIF_stipe_shell 0.099929 no
Pileal_Stipeal_shell DIF_stipe_skin 0.079123 no
Pileal_Stipeal_shell DIF_cap_skin 0.919083 no
Pileal_Stipeal_shell DIF_cap_tissue 0.835137 no
DIF_stipe_center DIF_gill_tissue 0.888375 no
DIF_stipe_center YFB_stipe_center 0.329497 no
DIF_stipe_center YFB_stipe_shell 0.218974 no
DIF_stipe_center YFB_stipe_skin 0.003765 yes
DIF_stipe_center YFB_cap_skin 0.633733 no
DIF_stipe_center YFB_cap_tissue 0.782370 no
DIF_stipe_center YFB_gill_tissue 0.760506 no
DIF_stipe_center YFB_veil 0.879907 no
DIF_stipe_center DIF_stipe_shell 0.130962 no
DIF_stipe_center DIF_stipe_skin 0.105537 no
DIF_stipe_center DIF_cap_skin 0.863894 no
DIF_stipe_center DIF_cap_tissue 0.768859 no
DIF_stipe_shell DIF_gill_tissue 0.069013 no
DIF_stipe_shell YFB_stipe_center 0.804711 no
DIF_stipe_shell YFB_stipe_shell 0.899247 no
DIF_stipe_shell YFB_stipe_skin 0.210069 no
DIF_stipe_shell YFB_cap_skin 0.465448 no
DIF_stipe_shell YFB_cap_tissue 0.046117 yes
DIF_stipe_shell YFB_gill_tissue 0.367256 no
DIF_stipe_shell YFB_veil 0.248019 no
DIF_stipe_shell DIF_stipe_skin 0.960790 no
DIF_stipe_shell DIF_cap_skin 0.062610 no
DIF_stipe_shell DIF_cap_tissue 0.038278 yes
DIF_stipe_skin DIF_gill_tissue 0.054776 no
DIF_stipe_skin YFB_stipe_center 0.747530 no
DIF_stipe_skin YFB_stipe_shell 0.848584 no
DIF_stipe_skin YFB_stipe_skin 0.253252 no
DIF_stipe_skin YFB_cap_skin 0.407665 no
DIF_stipe_skin YFB_cap_tissue 0.035993 yes
DIF_stipe_skin YFB_gill_tissue 0.316872 no
DIF_stipe_skin YFB_veil 0.199497 no
DIF_stipe_skin DIF_cap_skin 0.049882 yes
DIF_stipe_skin DIF_cap_tissue 0.029408 yes
DIF_cap_skin DIF_gill_tissue 0.981545 no
DIF_cap_skin YFB_stipe_center 0.179329 no
DIF_cap_skin YFB_stipe_shell 0.105537 no
DIF_cap_skin YFB_stipe_skin 0.001140 yes
DIF_cap_skin YFB_cap_skin 0.436280 no
DIF_cap_skin YFB_cap_tissue 0.939205 no
DIF_cap_skin YFB_gill_tissue 0.561837 no
DIF_cap_skin YFB_veil 0.703619 no
DIF_cap_skin DIF_cap_tissue 0.931244 no
DIF_cap_tissue DIF_gill_tissue 0.912650 no
DIF_cap_tissue YFB_stipe_center 0.124412 no
DIF_cap_tissue YFB_stipe_shell 0.073760 no
DIF_cap_tissue YFB_stipe_skin 0.001140 yes
DIF_cap_tissue YFB_cap_skin 0.331689 no
DIF_cap_tissue YFB_cap_tissue 0.994313 no
DIF_cap_tissue YFB_gill_tissue 0.452131 no
DIF_cap_tissue YFB_veil 0.595644 no

Orthologs

Orthofinder run ID1
Orthogroup10492
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|037880
Agaricus bisporus var bisporus H97 AgabiH97|037880 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|037880
MRDMNNLDDNDKNLRAVVMKCWKEEKENEENDNDSKVSTQVLPPELLSVVFLYVCAEESFARNNRHSIFLLASVC
SYWRALVLGMTFLWSRLTLTVNPVSQGDPSVLQYFLDNVKQTPFALCLLFSQKQEYFSVPLGRMSAIEALLLKDK
NRGKLETLRIEGFSLALCGYLPRFQSICRLEIGGIPYLNYWQPDSLQPLDLSNLAGLNQVEFYSSGCSLGVVMPW
TQITSLTLKSEDIYVCVFFFTQCPNLQEFHCFSPLKSNTRVSYPEIVDNFTSEKVENLSWTSNPEQKCVMLFSRL
RLPSLRSLQWYSRSYRRSDIRPDEASALHNLFSGSAFTLSCFRLHNAGSWTIDFIKTILSRAKNLRVLHLTKCKY
KFVIDTLSVLRHEPDGDTFLPLLETLIIQEPEGSIRPSERERQEIQLASHIIPIFQNRDLEKKKSFSLQLSQTAG
LHSKDMRTVYNALRSEGYAFNIWVDSAMTCSVKEVLERERWKKGMRNVPRVSGTQWYTSRNDEDEDQDWDDEPST
RLIREAAGCSLSPTT*
Coding >AgabiH97|037880
ATGCGCGACATGAACAATCTTGACGATAACGACAAAAATTTGAGGGCTGTTGTAATGAAGTGCTGGAAAGAAGAG
AAGGAGAATGAGGAGAATGACAACGATTCCAAAGTTTCAACTCAAGTCCTGCCCCCCGAACTGCTTTCTGTAGTA
TTCCTATACGTATGCGCGGAAGAAAGCTTCGCCAGAAACAACCGACACAGCATCTTTCTACTCGCGTCAGTATGC
TCCTATTGGCGAGCCCTGGTTCTGGGCATGACTTTCCTGTGGTCGCGTCTGACCTTGACAGTCAATCCCGTCTCT
CAAGGAGATCCCTCAGTACTTCAGTACTTCCTCGACAATGTCAAACAGACTCCTTTCGCACTTTGCTTGCTATTT
TCGCAAAAACAAGAATACTTCTCTGTACCTCTCGGGCGTATGTCTGCGATTGAGGCTCTGCTGTTGAAAGATAAA
AATAGGGGCAAGCTAGAGACCCTCCGAATAGAGGGCTTCTCCCTCGCCTTGTGTGGTTATCTCCCCCGATTCCAA
TCCATCTGTCGTCTTGAGATTGGTGGCATCCCATATTTAAATTACTGGCAACCCGATTCTCTTCAACCACTCGAT
CTGTCCAACCTCGCTGGCTTGAATCAAGTTGAATTTTACTCGTCAGGGTGCTCTCTCGGCGTTGTTATGCCCTGG
ACTCAAATCACGTCCTTGACACTCAAGTCCGAAGACATCTATGTATGCGTGTTCTTCTTCACTCAATGCCCCAAC
CTTCAAGAATTCCACTGTTTTTCTCCTCTGAAATCCAATACGCGGGTCTCTTATCCTGAAATTGTTGATAACTTC
ACTTCTGAAAAAGTGGAGAACCTTTCATGGACCTCCAACCCAGAACAGAAATGTGTGATGCTCTTCTCAAGGCTC
CGACTCCCATCGCTACGATCTCTTCAATGGTACAGTCGATCTTATCGAAGGTCTGATATTCGACCCGACGAAGCA
TCCGCTCTACACAACCTTTTCTCTGGTTCTGCGTTCACATTATCTTGTTTCCGACTCCACAACGCAGGATCATGG
ACAATCGATTTCATCAAAACCATTCTCTCTCGCGCCAAGAACTTACGAGTTTTACACCTCACCAAATGCAAATAC
AAATTCGTCATCGACACCCTTTCTGTTCTCAGACACGAACCCGATGGTGACACCTTTCTTCCTCTTCTAGAAACC
CTCATCATACAAGAACCCGAAGGATCCATCCGCCCATCAGAAAGGGAAAGACAAGAAATTCAACTGGCATCGCAT
ATCATTCCTATATTCCAAAATCGGGACCTCGAGAAGAAGAAATCGTTTTCGCTGCAGCTTTCACAGACTGCTGGA
TTACATTCGAAAGATATGCGAACGGTGTATAATGCGCTGCGTTCGGAAGGATATGCGTTTAATATTTGGGTTGAT
TCTGCGATGACATGTTCTGTGAAGGAGGTTTTGGAGCGTGAGCGGTGGAAGAAGGGAATGAGGAATGTTCCTAGG
GTGTCGGGGACTCAATGGTATACGTCACGTAACGACGAGGATGAGGACCAGGATTGGGATGATGAACCTAGTACT
CGGTTGATTAGAGAAGCTGCTGGTTGTTCCTTGTCTCCTACAACTTGA
Transcript >AgabiH97|037880
ATGCGCGACATGAACAATCTTGACGATAACGACAAAAATTTGAGGGCTGTTGTAATGAAGTGCTGGAAAGAAGAG
AAGGAGAATGAGGAGAATGACAACGATTCCAAAGTTTCAACTCAAGTCCTGCCCCCCGAACTGCTTTCTGTAGTA
TTCCTATACGTATGCGCGGAAGAAAGCTTCGCCAGAAACAACCGACACAGCATCTTTCTACTCGCGTCAGTATGC
TCCTATTGGCGAGCCCTGGTTCTGGGCATGACTTTCCTGTGGTCGCGTCTGACCTTGACAGTCAATCCCGTCTCT
CAAGGAGATCCCTCAGTACTTCAGTACTTCCTCGACAATGTCAAACAGACTCCTTTCGCACTTTGCTTGCTATTT
TCGCAAAAACAAGAATACTTCTCTGTACCTCTCGGGCGTATGTCTGCGATTGAGGCTCTGCTGTTGAAAGATAAA
AATAGGGGCAAGCTAGAGACCCTCCGAATAGAGGGCTTCTCCCTCGCCTTGTGTGGTTATCTCCCCCGATTCCAA
TCCATCTGTCGTCTTGAGATTGGTGGCATCCCATATTTAAATTACTGGCAACCCGATTCTCTTCAACCACTCGAT
CTGTCCAACCTCGCTGGCTTGAATCAAGTTGAATTTTACTCGTCAGGGTGCTCTCTCGGCGTTGTTATGCCCTGG
ACTCAAATCACGTCCTTGACACTCAAGTCCGAAGACATCTATGTATGCGTGTTCTTCTTCACTCAATGCCCCAAC
CTTCAAGAATTCCACTGTTTTTCTCCTCTGAAATCCAATACGCGGGTCTCTTATCCTGAAATTGTTGATAACTTC
ACTTCTGAAAAAGTGGAGAACCTTTCATGGACCTCCAACCCAGAACAGAAATGTGTGATGCTCTTCTCAAGGCTC
CGACTCCCATCGCTACGATCTCTTCAATGGTACAGTCGATCTTATCGAAGGTCTGATATTCGACCCGACGAAGCA
TCCGCTCTACACAACCTTTTCTCTGGTTCTGCGTTCACATTATCTTGTTTCCGACTCCACAACGCAGGATCATGG
ACAATCGATTTCATCAAAACCATTCTCTCTCGCGCCAAGAACTTACGAGTTTTACACCTCACCAAATGCAAATAC
AAATTCGTCATCGACACCCTTTCTGTTCTCAGACACGAACCCGATGGTGACACCTTTCTTCCTCTTCTAGAAACC
CTCATCATACAAGAACCCGAAGGATCCATCCGCCCATCAGAAAGGGAAAGACAAGAAATTCAACTGGCATCGCAT
ATCATTCCTATATTCCAAAATCGGGACCTCGAGAAGAAGAAATCGTTTTCGCTGCAGCTTTCACAGACTGCTGGA
TTACATTCGAAAGATATGCGAACGGTGTATAATGCGCTGCGTTCGGAAGGATATGCGTTTAATATTTGGGTTGAT
TCTGCGATGACATGTTCTGTGAAGGAGGTTTTGGAGCGTGAGCGGTGGAAGAAGGGAATGAGGAATGTTCCTAGG
GTGTCGGGGACTCAATGGTATACGTCACGTAACGACGAGGATGAGGACCAGGATTGGGATGATGAACCTAGTACT
CGGTTGATTAGAGAAGCTGCTGGTTGTTCCTTGTCTCCTACAACTTGA
Gene >AgabiH97|037880
ATGCGCGACATGAACAATCTTGACGATAACGACAAAAATTTGAGGGCTGTTGTAATGAAGTGCTGGAAAGAAGAG
AAGGAGAATGAGGAGAATGACGTAACCTTTCAACGCATTCGAACCAGACATCTTGCTCACTTGTGAAAGCAGAAC
GATTCCAAAGTTTCAACTCAAGTCCTGCCCCCCGAACTGCTTTCTGTAGTATTCCTATACGTATGCGCGGAAGAA
AGCTTCGCCAGAAACAACCGACACAGCATCTTTCTACTCGCGTCAGTATGCTCCTATTGGCGAGCCCTGGTTCTG
GGCATGACTTTCCTGTGGTCGCGTCTGACCTTGACAGTCAATCCCGTCTCTCAAGGAGATCCCTCAGTACTTCAG
TACTTCCTCGACAATGTCAAACAGACTCCTTTCGCACTTTGCTTGCTATTTTCGCAAAAACAAGAATACTTCTCT
GTACCTCTCGGGCGTATGTCTGCGATTGAGGCTCTGCTGTTGAAAGATAAAAATAGGGGCAAGCTAGAGACCCTC
CGAATAGAGGGCTTCTCCCTCGCCTTGTGTGGTTATCTCCCCCGATTCCAATCCATCTGTCGTCTTGAGATTGGT
GGCATCCCATATTTAAATTACTGGCAACCCGATTCTCTTCAACCACTCGATCTGTCCAACCTCGCTGGCTTGAAT
CAAGTTGAATTTTACTCGTCAGGGTGCTCTCTCGGCGTTGTTATGCCCTGGACTCAAATCACGTCCTTGACACTC
AAGTCCGAAGACATCTATGTATGCGTGTTCTTCTTCACTCAATGCCCCAACCTTCAAGAATTCCACTGTTTTTCT
CCTCTGAAATCCAATACGCGGGTCTCTTATCCTGAAATTGTTGATAACTTCACTTCTGAAAAAGTGGAGAACCTT
TCATGGACCTCCAACCCAGAACAGAAATGTGTGATGCTCTTCTCAAGGCTCCGACTCCCATCGCTACGATCTCTT
CAATGGTACAGTCGATCTTATCGAAGGTCTGATATTCGACCCGACGAAGCATCCGCTCTACACAACCTTTTCTCT
GGTTCTGCGTTCACATTATCTTGTTTCCGACTCCACAACGCAGGATCATGGACAATCGATTTCATCAAAACCATT
CTCTCTCGCGCCAAGAACTTACGAGTTTTACACCTCACCAAATGCAAATACAAATTCGTCATCGACACCCTTTCT
GTTCTCAGACACGAACCCGATGGTGACACCTTTCTTCCTCTTCTAGAAACCCTCATCATACAAGAACCCGAAGGA
TCCATCCGCCCATCAGAAAGGGAAAGACAAGAAATTCAACTGGCATCGCATATCATTCCTATATTCCAAAATCGG
GACCTCGAGAAGAAGAAATCGTTTTCGCTGCAGCTTTCACAGACTGCTGGATTACATTCGAAAGATATGCGAACG
GTGTATAATGCGCTGCGTTCGGAAGGATATGCGTTTAATATTTGGGTTGATTCTGCGATGACATGTTCTGTGAAG
GAGGTTTTGGAGCGTGAGCGGTGGAAGAAGGGAATGAGGAATGTTCCTAGGGTGTCGGGGACTCAATGGTATACG
TCACGTAACGACGAGGATGAGGACCAGGATTGGGATGATGAACCTAGTACTCGGTTGATTAGAGAAGCTGCTGGT
TGTTCCTTGTCTCCTACAACTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail