Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|037670
Gene name
Locationscaffold_13:1070611..1073514
Strand-
Gene length (bp)2903
Transcript length (bp)1581
Coding sequence length (bp)1581
Protein length (aa) 527

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02055 Glyco_hydro_30 Glycosyl hydrolase family 30 TIM-barrel domain 5.6E-25 68 329
PF02057 Glyco_hydro_59 Glycosyl hydrolase family 59 1.4E-13 77 326

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7M4T0|NEG1_NEUCR Endo-1,6-beta-D-glucanase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=neg-1 PE=1 SV=2 47 428 4.0E-40
sp|Q4WBR2|NEG1_ASPFU Endo-1,6-beta-D-glucanase neg1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=neg1 PE=1 SV=1 47 410 4.0E-36
sp|Q8J0I9|GUN16_TRIHA Endo-1,6-beta-D-glucanase BGN16.3 OS=Trichoderma harzianum PE=1 SV=1 47 403 3.0E-34
sp|O16581|GLCM2_CAEEL Putative glucosylceramidase 2 OS=Caenorhabditis elegans GN=gba-2 PE=3 SV=2 58 407 5.0E-22
sp|G5ECR8|GLCM3_CAEEL Putative glucosylceramidase 3 OS=Caenorhabditis elegans GN=gba-3 PE=3 SV=1 56 416 7.0E-21
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7M4T0|NEG1_NEUCR Endo-1,6-beta-D-glucanase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=neg-1 PE=1 SV=2 47 428 4.0E-40
sp|Q4WBR2|NEG1_ASPFU Endo-1,6-beta-D-glucanase neg1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=neg1 PE=1 SV=1 47 410 4.0E-36
sp|Q8J0I9|GUN16_TRIHA Endo-1,6-beta-D-glucanase BGN16.3 OS=Trichoderma harzianum PE=1 SV=1 47 403 3.0E-34
sp|O16581|GLCM2_CAEEL Putative glucosylceramidase 2 OS=Caenorhabditis elegans GN=gba-2 PE=3 SV=2 58 407 5.0E-22
sp|G5ECR8|GLCM3_CAEEL Putative glucosylceramidase 3 OS=Caenorhabditis elegans GN=gba-3 PE=3 SV=1 56 416 7.0E-21
sp|Q9UB00|GLCM4_CAEEL Putative glucosylceramidase 4 OS=Caenorhabditis elegans GN=gba-4 PE=3 SV=2 49 422 1.0E-20
sp|P17439|GLCM_MOUSE Glucosylceramidase OS=Mus musculus GN=Gba PE=1 SV=1 49 364 8.0E-19
sp|Q2KHZ8|GLCM_BOVIN Glucosylceramidase OS=Bos taurus GN=GBA PE=2 SV=1 49 364 2.0E-18
sp|O16580|GLCM1_CAEEL Putative glucosylceramidase 1 OS=Caenorhabditis elegans GN=gba-1 PE=1 SV=2 52 407 6.0E-18
sp|P04062|GLCM_HUMAN Glucosylceramidase OS=Homo sapiens GN=GBA PE=1 SV=3 43 364 4.0E-17
sp|Q9BDT0|GLCM_PANTR Glucosylceramidase OS=Pan troglodytes GN=GBA PE=3 SV=1 49 364 2.0E-16
sp|Q5R8E3|GLCM_PONAB Glucosylceramidase OS=Pongo abelii GN=GBA PE=2 SV=1 49 364 3.0E-16
sp|Q70KH2|GLCM_PIG Glucosylceramidase OS=Sus scrofa GN=GBA PE=3 SV=1 64 364 3.0E-14
[Show less]

GO

GO Term Description Terminal node
GO:0006683 galactosylceramide catabolic process Yes
GO:0004336 galactosylceramidase activity Yes
GO:1901565 organonitrogen compound catabolic process No
GO:0006672 ceramide metabolic process No
GO:0008152 metabolic process No
GO:0046479 glycosphingolipid catabolic process No
GO:0043603 cellular amide metabolic process No
GO:0006681 galactosylceramide metabolic process No
GO:0009056 catabolic process No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:0006677 glycosylceramide metabolic process No
GO:0019374 galactolipid metabolic process No
GO:0044248 cellular catabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0044255 cellular lipid metabolic process No
GO:0044242 cellular lipid catabolic process No
GO:0046514 ceramide catabolic process No
GO:0016787 hydrolase activity No
GO:0006664 glycolipid metabolic process No
GO:1903509 liposaccharide metabolic process No
GO:0019377 glycolipid catabolic process No
GO:0006665 sphingolipid metabolic process No
GO:0046477 glycosylceramide catabolic process No
GO:0019376 galactolipid catabolic process No
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0016042 lipid catabolic process No
GO:0006629 lipid metabolic process No
GO:0044237 cellular metabolic process No
GO:0003824 catalytic activity No
GO:0009987 cellular process No
GO:1901136 carbohydrate derivative catabolic process No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0044238 primary metabolic process No
GO:0003674 molecular_function No
GO:0046466 membrane lipid catabolic process No
GO:1901135 carbohydrate derivative metabolic process No
GO:0030149 sphingolipid catabolic process No
GO:0006643 membrane lipid metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0006687 glycosphingolipid metabolic process No
GO:1901575 organic substance catabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|037670
MQQFAIILILASCVSAQYAIWDTWSTTWERSNLFTSFKPNPPISFGPVSGTGQADIRIDDTSTFQSVWGFGGSLT
DSSALTLNNLKSRNSASYRSLLNYLFNPTDDMNAAGFSYMRIPLGASDFSASAYSYDDTPGDTSFNNFDINRTPS
YVFSVLNDIKAVNNIMRFHFIPWSPPGWMKDSGTMKGGALKPELVDEYATYLLKCVQGWNSKGFRAYAVSAQNEP
LNSNPTYPTSKLTAAQEAQIGLRLRSLLNSNGFSDTKIVGYDHNWSNAGGYPVQLMQDAGSAFDGVSFHCYAGNV
SQQDTFHSQFSDKQIYFTECSGTFGSDWWSDIKWYMDNIAIGSIERSSHTGLMWNIALDGSGNPKLPGTSSCGGP
GCRPLVTVNSDGTWSVNQEFYALAQASKAILPRDVGGPFGKRIGVSVGGELNWALRVSAFVTGRVDSSEWQRYSI
VVLNWDDSVGGWNPQPVRATIEFRGTQASYTFPVGVTTLWWYAPSTSFDVCGSSNTEEQGPMVFLNDQQGQVPLN
F*
Coding >AgabiH97|037670
ATGCAACAGTTTGCCATAATTCTGATTTTAGCAAGCTGTGTTTCCGCACAATACGCTATATGGGATACCTGGTCT
ACGACCTGGGAGCGTTCCAATCTCTTTACATCTTTCAAACCGAATCCTCCAATCTCATTCGGGCCTGTCTCTGGT
ACTGGTCAAGCTGATATCAGGATTGATGATACGTCGACGTTTCAATCCGTCTGGGGATTTGGCGGTTCTCTCACT
GATTCGTCTGCGCTGACGCTCAATAACCTAAAGTCCAGGAATTCGGCTAGCTACCGGAGCCTTCTCAACTACCTG
TTTAACCCTACAGATGATATGAACGCAGCAGGATTTAGCTATATGCGTATACCTTTGGGTGCTTCTGATTTTTCC
GCGTCTGCTTATAGTTATGATGACACTCCCGGCGACACATCCTTCAACAACTTTGATATCAATCGCACGCCTTCC
TACGTGTTTTCAGTTTTGAATGACATTAAAGCTGTTAACAACATCATGCGCTTCCATTTTATTCCTTGGTCACCC
CCTGGATGGATGAAGGACAGCGGCACAATGAAAGGAGGAGCGCTGAAACCGGAACTTGTCGATGAATACGCCACA
TACCTCCTGAAGTGTGTACAAGGCTGGAACTCTAAAGGCTTCAGAGCATATGCTGTATCCGCCCAGAATGAACCT
CTCAACTCGAATCCTACATATCCGACGTCCAAATTAACGGCTGCACAAGAAGCACAGATCGGTCTGAGACTTAGG
AGTCTATTGAATTCGAACGGATTTTCGGATACTAAAATCGTTGGATACGATCATAATTGGAGTAATGCTGGAGGC
TATCCTGTTCAATTAATGCAAGATGCTGGAAGCGCTTTTGACGGCGTGTCATTCCATTGTTATGCTGGAAACGTT
TCGCAGCAAGATACTTTCCATTCGCAGTTCAGTGACAAGCAAATATACTTTACAGAGTGCTCGGGAACGTTTGGC
AGCGATTGGTGGAGCGACATCAAGTGGTATATGGATAATATTGCTATAGGGTCGATCGAACGTAGTTCACATACG
GGCTTGATGTGGAATATCGCTTTGGATGGGTCTGGAAATCCCAAACTTCCAGGAACGAGTAGTTGCGGAGGTCCC
GGATGTCGTCCCCTTGTGACAGTCAATTCTGATGGTACTTGGAGTGTCAATCAAGAATTTTATGCTCTGGCACAA
GCGTCGAAAGCTATTTTACCTCGAGATGTTGGTGGTCCTTTTGGAAAACGGATTGGAGTTAGTGTTGGTGGTGAA
CTTAATTGGGCGTTGAGAGTCTCGGCTTTTGTTACGGGAAGAGTTGATTCTTCTGAGTGGCAAAGGTATTCTATT
GTGGTTCTAAACTGGGATGACAGTGTAGGGGGATGGAACCCTCAACCTGTACGCGCAACAATCGAATTTAGAGGT
ACTCAGGCGTCCTATACTTTCCCTGTTGGAGTAACTACCCTATGGTGGTATGCGCCTTCAACTTCGTTCGACGTA
TGCGGTTCTTCGAATACCGAGGAACAAGGACCGATGGTATTTTTGAATGATCAACAGGGTCAGGTTCCTCTCAAT
TTTTGA
Transcript >AgabiH97|037670
ATGCAACAGTTTGCCATAATTCTGATTTTAGCAAGCTGTGTTTCCGCACAATACGCTATATGGGATACCTGGTCT
ACGACCTGGGAGCGTTCCAATCTCTTTACATCTTTCAAACCGAATCCTCCAATCTCATTCGGGCCTGTCTCTGGT
ACTGGTCAAGCTGATATCAGGATTGATGATACGTCGACGTTTCAATCCGTCTGGGGATTTGGCGGTTCTCTCACT
GATTCGTCTGCGCTGACGCTCAATAACCTAAAGTCCAGGAATTCGGCTAGCTACCGGAGCCTTCTCAACTACCTG
TTTAACCCTACAGATGATATGAACGCAGCAGGATTTAGCTATATGCGTATACCTTTGGGTGCTTCTGATTTTTCC
GCGTCTGCTTATAGTTATGATGACACTCCCGGCGACACATCCTTCAACAACTTTGATATCAATCGCACGCCTTCC
TACGTGTTTTCAGTTTTGAATGACATTAAAGCTGTTAACAACATCATGCGCTTCCATTTTATTCCTTGGTCACCC
CCTGGATGGATGAAGGACAGCGGCACAATGAAAGGAGGAGCGCTGAAACCGGAACTTGTCGATGAATACGCCACA
TACCTCCTGAAGTGTGTACAAGGCTGGAACTCTAAAGGCTTCAGAGCATATGCTGTATCCGCCCAGAATGAACCT
CTCAACTCGAATCCTACATATCCGACGTCCAAATTAACGGCTGCACAAGAAGCACAGATCGGTCTGAGACTTAGG
AGTCTATTGAATTCGAACGGATTTTCGGATACTAAAATCGTTGGATACGATCATAATTGGAGTAATGCTGGAGGC
TATCCTGTTCAATTAATGCAAGATGCTGGAAGCGCTTTTGACGGCGTGTCATTCCATTGTTATGCTGGAAACGTT
TCGCAGCAAGATACTTTCCATTCGCAGTTCAGTGACAAGCAAATATACTTTACAGAGTGCTCGGGAACGTTTGGC
AGCGATTGGTGGAGCGACATCAAGTGGTATATGGATAATATTGCTATAGGGTCGATCGAACGTAGTTCACATACG
GGCTTGATGTGGAATATCGCTTTGGATGGGTCTGGAAATCCCAAACTTCCAGGAACGAGTAGTTGCGGAGGTCCC
GGATGTCGTCCCCTTGTGACAGTCAATTCTGATGGTACTTGGAGTGTCAATCAAGAATTTTATGCTCTGGCACAA
GCGTCGAAAGCTATTTTACCTCGAGATGTTGGTGGTCCTTTTGGAAAACGGATTGGAGTTAGTGTTGGTGGTGAA
CTTAATTGGGCGTTGAGAGTCTCGGCTTTTGTTACGGGAAGAGTTGATTCTTCTGAGTGGCAAAGGTATTCTATT
GTGGTTCTAAACTGGGATGACAGTGTAGGGGGATGGAACCCTCAACCTGTACGCGCAACAATCGAATTTAGAGGT
ACTCAGGCGTCCTATACTTTCCCTGTTGGAGTAACTACCCTATGGTGGTATGCGCCTTCAACTTCGTTCGACGTA
TGCGGTTCTTCGAATACCGAGGAACAAGGACCGATGGTATTTTTGAATGATCAACAGGGTCAGGTTCCTCTCAAT
TTTTGA
Gene >AgabiH97|037670
ATGCAACAGTTTGCCATAATTCTGATTTTAGCAAGCTGTGTTTCCGCACAATACGCTATATGGGATACCGTAAGT
ACCATTTGTTCTAATGACTATTGTCGTGAGGCAACACTATCCATTTCTAGTGGTCTACGACCTGGGAGCGTTCCA
ATCTCTTTACATCTTTCAAACCGAATCCTCCAATCTCATTCGGGCCTGTCTCTGGTACTGGTCAAGCTGATATCA
GGATTGATGATACGTCGACGTTTCAATCCGTCTGGGGATTTGGCGGTTCTCTCAGTTCGTTTTTCTGATGATCAG
CCATGAAGCCTCCTGCCTAAATCGCGTCTAGCTGATTCGTCTGCGCTGACGCTCAATAACCTAAAGGTAAGTGTA
AATCAGCCTCCAACTCTAAAGTCCGCCGAGCACTATATCTGATTCTGATTCTGACTGTTCCTTTTACTTCCCCAC
TGTTCATAGTCCAGGAATTCGGCTAGCTACCGGAGCCTTCTCAACTACCTGTTTAACCCTACAGATGATATGAAC
GCAGCAGGATTTAGCTATATGCGTATACCTTTGGGTGCTTCTGATTTTTCCGCGTCTGGTGAGAGTTGGCTGCAC
TTAGTTTCTTTTGGATTTATTCCTGACTTATTTTGATAGCTTATAGTTATGATGACACTCCCGGCGACACATCCT
TCAACAACTTTGATATCAATCGCACGCCTTCCTACGTGTTTTCAGTTTTGAATGACATTAAAGCTGTTAACAACA
GTCAGTTTGTTTCGCTATCGCTGCTTATATGTATTCCTAATCTGGGGAATTCTTTGGTAGTCATGCGCTTCCATT
TTATTCCTTGGTCACCCGTAAGCCACTCTGCTTTTCATCAAAGAACCTATGGATCGTTTATCATATATTAGCCTG
GATGGATGAAGGACAGCGGCACAATGAAAGGAGGAGCGCTGAAACCGGAACTTGTCGATGAATGTACGTATAAGT
ATTTTTGTTAACTCGGAAAGGGACACTGTAAACTGAAGGCCATACGGGATACAAAGACGCCACATACCTCCTGAA
GTGTGTACAAGGCTGGAACTCTAAAGGCTTCAGAGCATATGCTGTATCCGCCCAGAATGAACCTCTCAACTCGAA
TCCTACATATCCGACGTCCAAATTAACGGCTGCACAAGAAGCACAGATCGGTCTGAGACTTAGGAGTCTATTGAA
TTCGAACGGATTTTCGGATACTAAAATCGTTGGTGAGTCGGAGCTTTTTGGTGATACAGTGCTTTTGCAGAGAAG
GGACTCCAGTAGAGAGGGTATCGCATGGTTGGTGGGTCACTGGTGGTGGAGAAATAATTCCTCCGATCCATCCCC
ATTCTTTAGAGTGGCGGTAACCTCTTCTTTCTTCACCTTCCATGTGCTTCGCCTTTTATTTTTTCCTCCATACGT
AAAGGAAGGCTTTCTTCAATATAGTTTGCTGATCCGTTTTCTCGTGATATGCATATAGGATACGATCATAATTGG
AGTAATGCTGGAGGCTATCCTGTTCAATTAATGCAAGATGCTGGAAGCGCTTTTGACGGCGTGTCATTCCATTGT
TATGCTGTGAGTTTTTTTTCCCTCTCTCCCTTGCCAAATGGTCGACGTGTTGCTTAAATTATGACATCAGGGAAA
CGTTTCGCAGCAAGATACTTTCCATTCGCAGTTCAGTGACAAGGTTCGTTCTGAGCGTCAAAATTGTTATTCCGG
GTTAATTAATGCTCTATATTTGCTGTTAGCAAATATACTTTACAGGTAAAAGTTTAAAGCCTTTCGAAGGGTTTG
ATAATTGATTTCTGATGATGTTCTTCATTCCAGAGTGCTCGGGAACGTTTGGCAGCGATTGGTGGAGCGACATCA
AGGTAAAAAAAATCTCTTTGTGAAATCTTTCCTTTGTTGATGTAATTGATTAGTGGTATATGGATAATATGTGAG
TTGTATACCTTTTGATGCCTTCCAAGAAAGCTTCTCATGTTTTGAGATGGTAGTGCTATAGGTAGGCGACGAAGT
ATCTCTTATTGATTAAAATTGAATTCGTATATCAGGGTCGATCGAACGTAGTTCACATACGGGCTTGATGTGGAA
TATCGCTTTGGATGGGTCTGGAAATCCCAAACTTCCAGGAACGAGTAGTTGCGGAGGTCCCGGATGTCGTCCCCT
TGTGACAGTCAATTCTGATGGTACTTGGAGTGTCAATCAAGAATGTGAGTTTCGAGTTTTTCTTTCTTCCTATCT
CATCGCAAGGCACGATACACTATGACTAATGGATTTGTTTCCTCGAATGTTCTATGTGATCAGTTTATGCTCTGG
CACAAGCGTCGAAAGCTATTTTACCTCGAGATGTTGGTGGTCCTTTTGGAAAACGGATTGGAGTTAGTGTTGGTG
GTGAACTTAATTGGGCGTTGAGAGTCTCGGCTTTTGTTACGGGAAGAGTTGATTCTTCTGAGTGGCAAAGGTATT
CTATTGTGGTTCTAAACTGTGAGTGTTCCATCGATATTTTATTCTGTTAATTGTTGTTTGATACACGCTTTCATT
CATAGGGGATGACAGTGTAGGGGGATGGAACCCTCAACCTGTACGCGCAACAATCGAATTTAGAGGTACTCAGGT
AAGTTTTCGGGAATTTAGGAAAAATGGAATGGAAGGTTGATGGTTTTTGTCAAATAGGCGTCCTATACTTTCCCT
GTTGGAGTAACTACCCTATGGTGGTATGGTACGTACAATGAATACTAAGCCGATACAATGTTGGTAATGCTCACT
TTTTTTTTCCTGCTTCTTCATCAGCGCCTTCAACTTCGTTCGACGTATGCGGTTCTTCGAATACCGAGGAACAAG
GACCGATGGTATTTTTGAATGATCAACAGGGTCAGGTTCCTCTCAATTTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail