Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|037620
Gene name
Locationscaffold_13:1056956..1058240
Strand-
Gene length (bp)1284
Transcript length (bp)1005
Coding sequence length (bp)1005
Protein length (aa) 335

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01975 SurE Survival protein SurE 3.3E-32 23 209

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P30887|PHO2_YARLI Acid phosphatase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PHO2 PE=3 SV=2 23 199 1.0E-23
sp|Q1MQB1|SURE_LAWIP 5'-nucleotidase SurE OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=surE PE=3 SV=1 23 164 1.0E-15
sp|Q30YV9|SURE_DESAG 5'-nucleotidase SurE OS=Desulfovibrio alaskensis (strain G20) GN=surE PE=3 SV=1 23 164 2.0E-15
sp|B8DN39|SURE_DESVM 5'-nucleotidase SurE OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=surE PE=3 SV=1 23 167 5.0E-15
sp|Q24WI0|SURE_DESHY 5'-nucleotidase SurE OS=Desulfitobacterium hafniense (strain Y51) GN=surE PE=3 SV=1 23 183 6.0E-15
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P30887|PHO2_YARLI Acid phosphatase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PHO2 PE=3 SV=2 23 199 1.0E-23
sp|Q1MQB1|SURE_LAWIP 5'-nucleotidase SurE OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=surE PE=3 SV=1 23 164 1.0E-15
sp|Q30YV9|SURE_DESAG 5'-nucleotidase SurE OS=Desulfovibrio alaskensis (strain G20) GN=surE PE=3 SV=1 23 164 2.0E-15
sp|B8DN39|SURE_DESVM 5'-nucleotidase SurE OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=surE PE=3 SV=1 23 167 5.0E-15
sp|Q24WI0|SURE_DESHY 5'-nucleotidase SurE OS=Desulfitobacterium hafniense (strain Y51) GN=surE PE=3 SV=1 23 183 6.0E-15
sp|B8FYS8|SURE_DESHD 5'-nucleotidase SurE OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=surE PE=3 SV=1 23 183 6.0E-15
sp|A0KGH8|SURE_AERHH 5'-nucleotidase SurE OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=surE PE=3 SV=1 21 164 3.0E-14
sp|Q7MHQ7|SURE_VIBVY 5'-nucleotidase SurE OS=Vibrio vulnificus (strain YJ016) GN=surE PE=3 SV=1 22 164 4.0E-14
sp|Q8DC57|SURE_VIBVU 5'-nucleotidase SurE OS=Vibrio vulnificus (strain CMCP6) GN=surE PE=3 SV=1 22 164 4.0E-14
sp|A1VCE4|SURE_DESVV 5'-nucleotidase SurE OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=surE PE=3 SV=1 21 167 4.0E-14
sp|Q72A55|SURE_DESVH 5'-nucleotidase SurE OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=surE PE=3 SV=1 21 167 5.0E-14
sp|C4XNX3|SURE_DESMR 5'-nucleotidase SurE OS=Desulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1) GN=surE PE=3 SV=1 21 164 6.0E-14
sp|B8CWH0|SURE_HALOH 5'-nucleotidase SurE OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=surE PE=3 SV=1 21 175 1.0E-13
sp|Q2LUH7|SURE_SYNAS 5'-nucleotidase SurE OS=Syntrophus aciditrophicus (strain SB) GN=surE PE=3 SV=1 21 164 2.0E-13
sp|Q46D82|SURE_METBF 5'-nucleotidase SurE OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=surE PE=3 SV=1 20 166 2.0E-13
sp|Q3JCZ4|SURE_NITOC 5'-nucleotidase SurE OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=surE PE=3 SV=1 21 175 2.0E-13
sp|Q8RA90|SURE_CALS4 5'-nucleotidase SurE OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=surE PE=3 SV=1 23 170 4.0E-13
sp|Q12U23|SURE_METBU 5'-nucleotidase SurE OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=surE PE=3 SV=1 20 166 5.0E-13
sp|Q8TUG3|SURE_METAC 5'-nucleotidase SurE OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=surE PE=3 SV=1 20 166 7.0E-13
sp|Q0ANE1|SURE_MARMM 5'-nucleotidase SurE OS=Maricaulis maris (strain MCS10) GN=surE PE=3 SV=1 22 168 2.0E-12
sp|A0LHG0|SURE_SYNFM 5'-nucleotidase SurE OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=surE PE=3 SV=1 21 176 2.0E-12
sp|C6BUG4|SURE_DESAD 5'-nucleotidase SurE OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=surE PE=3 SV=1 23 167 2.0E-12
sp|A6UP61|SURE_METVS 5'-nucleotidase SurE OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=surE PE=3 SV=1 22 201 3.0E-12
sp|Q8PX31|SURE_METMA 5'-nucleotidase SurE OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=surE PE=3 SV=1 22 166 3.0E-12
sp|A6TRH0|SURE_ALKMQ 5'-nucleotidase SurE OS=Alkaliphilus metalliredigens (strain QYMF) GN=surE PE=3 SV=1 21 164 4.0E-12
sp|Q6LYE0|SURE_METMP 5'-nucleotidase SurE OS=Methanococcus maripaludis (strain S2 / LL) GN=surE PE=3 SV=2 21 199 5.0E-12
sp|Q10YV3|SURE_TRIEI 5'-nucleotidase SurE OS=Trichodesmium erythraeum (strain IMS101) GN=surE PE=3 SV=1 21 172 5.0E-12
sp|Q8Y040|SURE_RALSO 5'-nucleotidase SurE OS=Ralstonia solanacearum (strain GMI1000) GN=surE PE=3 SV=1 23 205 7.0E-12
sp|B8HSQ9|SURE_CYAP4 5'-nucleotidase SurE OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=surE PE=3 SV=1 21 180 7.0E-12
sp|B2U9T8|SURE_RALPJ 5'-nucleotidase SurE OS=Ralstonia pickettii (strain 12J) GN=surE PE=3 SV=1 23 205 7.0E-12
sp|B8J2G2|SURE_DESDA 5'-nucleotidase SurE OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=surE PE=3 SV=1 21 187 1.0E-11
sp|B1WXT3|SURE_CYAA5 5'-nucleotidase SurE OS=Cyanothece sp. (strain ATCC 51142) GN=surE PE=3 SV=1 23 173 1.0E-11
sp|Q73G84|SURE_WOLPM 5'-nucleotidase SurE OS=Wolbachia pipientis wMel GN=surE PE=3 SV=1 23 164 1.0E-11
sp|Q72H70|SURE1_THET2 5'-nucleotidase SurE 1 OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=surE1 PE=3 SV=1 21 173 1.0E-11
sp|O29320|SURE_ARCFU 5'-nucleotidase SurE OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=surE PE=3 SV=1 21 166 1.0E-11
sp|B9KI89|SURE_ANAMF 5'-nucleotidase SurE OS=Anaplasma marginale (strain Florida) GN=surE PE=3 SV=1 21 199 1.0E-11
sp|P74709|SURE_SYNY3 5'-nucleotidase SurE OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=surE PE=3 SV=1 23 180 1.0E-11
sp|Q5PB34|SURE_ANAMM 5'-nucleotidase SurE OS=Anaplasma marginale (strain St. Maries) GN=surE PE=3 SV=1 21 199 1.0E-11
sp|A6VFZ9|SURE_METM7 5'-nucleotidase SurE OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=surE PE=3 SV=1 21 199 1.0E-11
sp|Q8DI06|SURE_THEEB 5'-nucleotidase SurE OS=Thermosynechococcus elongatus (strain BP-1) GN=surE PE=3 SV=1 21 185 1.0E-11
sp|A9AAP6|SURE_METM6 5'-nucleotidase SurE OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=surE PE=3 SV=1 21 199 2.0E-11
sp|C0R4G7|SURE_WOLWR 5'-nucleotidase SurE OS=Wolbachia sp. subsp. Drosophila simulans (strain wRi) GN=surE PE=3 SV=1 23 164 2.0E-11
sp|A3CVB4|SURE_METMJ 5'-nucleotidase SurE OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=surE PE=3 SV=1 22 166 2.0E-11
sp|B3CLR5|SURE_WOLPP 5'-nucleotidase SurE OS=Wolbachia pipientis subsp. Culex pipiens (strain wPip) GN=surE PE=3 SV=1 23 164 2.0E-11
sp|B0JX00|SURE_MICAN 5'-nucleotidase SurE OS=Microcystis aeruginosa (strain NIES-843) GN=surE PE=3 SV=1 22 164 3.0E-11
sp|A4FXC7|SURE_METM5 5'-nucleotidase SurE OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=surE PE=3 SV=1 21 199 3.0E-11
sp|B2VA83|SURE_SULSY 5'-nucleotidase SurE OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=surE PE=3 SV=1 21 199 3.0E-11
sp|Q5GS87|SURE_WOLTR 5'-nucleotidase SurE OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=surE PE=3 SV=1 23 164 4.0E-11
sp|Q3YSH3|SURE_EHRCJ 5'-nucleotidase SurE OS=Ehrlichia canis (strain Jake) GN=surE PE=3 SV=1 21 166 5.0E-11
sp|Q5N0F0|SURE_SYNP6 5'-nucleotidase SurE OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=surE PE=3 SV=1 21 187 5.0E-11
sp|Q31LH6|SURE_SYNE7 5'-nucleotidase SurE OS=Synechococcus elongatus (strain PCC 7942) GN=surE PE=3 SV=1 21 187 5.0E-11
sp|Q3ADI0|SURE_CARHZ 5'-nucleotidase SurE OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=surE PE=3 SV=1 21 170 6.0E-11
sp|Q2SWF5|SURE_BURTA 5'-nucleotidase SurE OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=surE PE=3 SV=1 21 164 6.0E-11
sp|Q8TY72|SURE_METKA 5'-nucleotidase SurE OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=surE PE=3 SV=1 21 166 6.0E-11
sp|A8ZXL1|SURE_DESOH 5'-nucleotidase SurE OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=surE PE=3 SV=1 21 164 6.0E-11
sp|A4SRB6|SURE_AERS4 5'-nucleotidase SurE OS=Aeromonas salmonicida (strain A449) GN=surE PE=3 SV=1 21 164 7.0E-11
sp|Q1QU76|SURE_CHRSD 5'-nucleotidase SurE OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=surE PE=3 SV=1 21 164 7.0E-11
sp|Q2JVR3|SURE_SYNJA 5'-nucleotidase SurE OS=Synechococcus sp. (strain JA-3-3Ab) GN=surE PE=3 SV=1 23 186 7.0E-11
sp|B0K177|SURE_THEPX 5'-nucleotidase SurE OS=Thermoanaerobacter sp. (strain X514) GN=surE PE=3 SV=1 21 164 7.0E-11
sp|B0K9J0|SURE_THEP3 5'-nucleotidase SurE OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=surE PE=3 SV=1 21 164 7.0E-11
sp|A8F523|SURE_PSELT 5'-nucleotidase SurE OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=surE PE=3 SV=1 21 164 8.0E-11
sp|Q899M5|SURE_CLOTE 5'-nucleotidase SurE OS=Clostridium tetani (strain Massachusetts / E88) GN=surE PE=3 SV=1 21 166 8.0E-11
sp|Q7NNG7|SURE_GLOVI 5'-nucleotidase SurE OS=Gloeobacter violaceus (strain PCC 7421) GN=surE PE=3 SV=1 21 164 8.0E-11
sp|A5EY39|SURE_DICNV 5'-nucleotidase SurE OS=Dichelobacter nodosus (strain VCS1703A) GN=surE PE=3 SV=1 23 164 1.0E-10
sp|O67004|SURE_AQUAE 5'-nucleotidase SurE OS=Aquifex aeolicus (strain VF5) GN=surE PE=1 SV=1 24 200 1.0E-10
sp|Q39VS1|SURE_GEOMG 5'-nucleotidase SurE OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=surE PE=3 SV=1 21 164 1.0E-10
sp|Q8YMT3|SURE_NOSS1 5'-nucleotidase SurE OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=surE PE=3 SV=1 21 164 1.0E-10
sp|Q57979|SURE_METJA 5'-nucleotidase SurE OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=surE PE=3 SV=2 21 199 1.0E-10
sp|A5HYC6|SURE_CLOBH 5'-nucleotidase SurE OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=surE PE=3 SV=1 23 166 1.0E-10
sp|A7FQP3|SURE_CLOB1 5'-nucleotidase SurE OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=surE PE=3 SV=1 23 166 1.0E-10
sp|A7I2X3|SURE_CAMHC 5'-nucleotidase SurE OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=surE PE=3 SV=1 21 167 2.0E-10
sp|Q63UU4|SURE_BURPS 5'-nucleotidase SurE OS=Burkholderia pseudomallei (strain K96243) GN=surE PE=3 SV=1 21 164 2.0E-10
sp|Q3JRP0|SURE_BURP1 5'-nucleotidase SurE OS=Burkholderia pseudomallei (strain 1710b) GN=surE PE=3 SV=1 21 164 2.0E-10
sp|A3NVY2|SURE_BURP0 5'-nucleotidase SurE OS=Burkholderia pseudomallei (strain 1106a) GN=surE PE=3 SV=1 21 164 2.0E-10
sp|Q0W2Q3|SURE_METAR 5'-nucleotidase SurE OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=surE PE=3 SV=1 22 164 2.0E-10
sp|B2FK94|SURE_STRMK 5'-nucleotidase SurE OS=Stenotrophomonas maltophilia (strain K279a) GN=surE PE=3 SV=1 21 181 2.0E-10
sp|A3NA65|SURE_BURP6 5'-nucleotidase SurE OS=Burkholderia pseudomallei (strain 668) GN=surE PE=3 SV=1 21 164 2.0E-10
sp|A1V4L3|SURE_BURMS 5'-nucleotidase SurE OS=Burkholderia mallei (strain SAVP1) GN=surE PE=3 SV=1 21 164 2.0E-10
sp|Q62JV2|SURE_BURMA 5'-nucleotidase SurE OS=Burkholderia mallei (strain ATCC 23344) GN=surE PE=3 SV=1 21 164 2.0E-10
sp|A2S290|SURE_BURM9 5'-nucleotidase SurE OS=Burkholderia mallei (strain NCTC 10229) GN=surE PE=3 SV=1 21 164 2.0E-10
sp|A3MK87|SURE_BURM7 5'-nucleotidase SurE OS=Burkholderia mallei (strain NCTC 10247) GN=surE PE=3 SV=1 21 164 2.0E-10
sp|Q0K950|SURE_CUPNH 5'-nucleotidase SurE OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=surE PE=3 SV=1 23 164 2.0E-10
sp|Q7V0I6|SURE_PROMP 5'-nucleotidase SurE OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=surE PE=3 SV=1 23 173 2.0E-10
sp|B2A4J5|SURE_NATTJ 5'-nucleotidase SurE OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=surE PE=3 SV=1 21 175 2.0E-10
sp|B3R1L4|SURE_CUPTR 5'-nucleotidase SurE OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=surE PE=3 SV=1 23 164 2.0E-10
sp|Q7VAV8|SURE_PROMA 5'-nucleotidase SurE OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=surE PE=3 SV=1 22 173 3.0E-10
sp|A5D2G6|SURE_PELTS 5'-nucleotidase SurE OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=surE PE=3 SV=1 21 174 3.0E-10
sp|Q46ZH1|SURE_CUPPJ 5'-nucleotidase SurE OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=surE PE=3 SV=1 23 164 3.0E-10
sp|Q128R7|SURE_POLSJ 5'-nucleotidase SurE OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=surE PE=3 SV=1 22 164 3.0E-10
sp|Q1H096|SURE_METFK 5'-nucleotidase SurE OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=surE PE=3 SV=1 22 198 3.0E-10
sp|A2BXX8|SURE_PROM5 5'-nucleotidase SurE OS=Prochlorococcus marinus (strain MIT 9515) GN=surE PE=3 SV=1 23 173 4.0E-10
sp|B1I3V7|SURE_DESAP 5'-nucleotidase SurE OS=Desulforudis audaxviator (strain MP104C) GN=surE PE=3 SV=1 21 164 4.0E-10
sp|A5G4S8|SURE_GEOUR 5'-nucleotidase SurE OS=Geobacter uraniireducens (strain Rf4) GN=surE PE=3 SV=1 21 164 5.0E-10
sp|B4SR92|SURE_STRM5 5'-nucleotidase SurE OS=Stenotrophomonas maltophilia (strain R551-3) GN=surE PE=3 SV=1 21 181 6.0E-10
sp|Q7VXN2|SURE_BORPE 5'-nucleotidase SurE OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=surE PE=3 SV=1 21 164 6.0E-10
sp|Q31G71|SURE_THICR 5'-nucleotidase SurE OS=Thiomicrospira crunogena (strain XCL-2) GN=surE PE=3 SV=1 21 164 6.0E-10
sp|A0B8M6|SURE_METTP 5'-nucleotidase SurE OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=surE PE=3 SV=1 21 166 6.0E-10
sp|A8G678|SURE_PROM2 5'-nucleotidase SurE OS=Prochlorococcus marinus (strain MIT 9215) GN=surE PE=3 SV=1 23 173 7.0E-10
sp|O83434|SURE_TREPA 5'-nucleotidase SurE OS=Treponema pallidum (strain Nichols) GN=surE PE=3 SV=1 21 164 8.0E-10
sp|A5N6V8|SURE_CLOK5 5'-nucleotidase SurE OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=surE PE=3 SV=1 21 164 8.0E-10
sp|B9E0C7|SURE_CLOK1 5'-nucleotidase SurE OS=Clostridium kluyveri (strain NBRC 12016) GN=surE PE=3 SV=1 21 164 8.0E-10
sp|Q3MB98|SURE_ANAVT 5'-nucleotidase SurE OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=surE PE=3 SV=1 21 164 8.0E-10
sp|C5A6M8|SURE_THEGJ 5'-nucleotidase SurE OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=surE PE=3 SV=1 21 164 9.0E-10
sp|Q5E331|SURE_VIBF1 5'-nucleotidase SurE OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=surE PE=3 SV=1 22 164 9.0E-10
sp|C1FQW9|SURE_CLOBJ 5'-nucleotidase SurE OS=Clostridium botulinum (strain Kyoto / Type A2) GN=surE PE=3 SV=1 23 166 9.0E-10
sp|Q3IDD3|SURE_PSEHT 5'-nucleotidase SurE OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=surE PE=3 SV=1 21 164 1.0E-09
sp|A2BSJ2|SURE_PROMS 5'-nucleotidase SurE OS=Prochlorococcus marinus (strain AS9601) GN=surE PE=3 SV=1 23 173 1.0E-09
sp|Q0AXU4|SURE_SYNWW 5'-nucleotidase SurE OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=surE PE=3 SV=1 21 164 1.0E-09
sp|Q2FLE8|SURE_METHJ 5'-nucleotidase SurE OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=surE PE=3 SV=1 23 166 1.0E-09
sp|Q15P28|SURE_PSEA6 5'-nucleotidase SurE OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=surE PE=3 SV=1 22 164 1.0E-09
sp|Q47D24|SURE_DECAR 5'-nucleotidase SurE OS=Dechloromonas aromatica (strain RCB) GN=surE PE=3 SV=1 21 167 1.0E-09
sp|Q7W670|SURE_BORPA 5'-nucleotidase SurE OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=surE PE=3 SV=1 21 164 1.0E-09
sp|Q7WI36|SURE_BORBR 5'-nucleotidase SurE OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=surE PE=3 SV=1 21 164 1.0E-09
sp|A3PEA4|SURE_PROM0 5'-nucleotidase SurE OS=Prochlorococcus marinus (strain MIT 9301) GN=surE PE=3 SV=1 23 173 1.0E-09
sp|B9M4Z4|SURE_GEODF 5'-nucleotidase SurE OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=surE PE=3 SV=1 21 164 2.0E-09
sp|Q7U5U4|SURE_SYNPX 5'-nucleotidase SurE OS=Synechococcus sp. (strain WH8102) GN=surE PE=3 SV=1 22 173 2.0E-09
sp|Q8PLR4|SURE_XANAC 5'-nucleotidase SurE OS=Xanthomonas axonopodis pv. citri (strain 306) GN=surE PE=3 SV=1 21 164 2.0E-09
sp|Q13Z72|SURE_BURXL 5'-nucleotidase SurE OS=Burkholderia xenovorans (strain LB400) GN=surE PE=3 SV=1 21 209 2.0E-09
sp|Q2NVM2|SURE_SODGM 5'/3'-nucleotidase SurE OS=Sodalis glossinidius (strain morsitans) GN=surE PE=3 SV=1 23 164 2.0E-09
sp|A7G9Y6|SURE_CLOBL 5'-nucleotidase SurE OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=surE PE=3 SV=1 23 166 2.0E-09
sp|B1IDC2|SURE_CLOBK 5'-nucleotidase SurE OS=Clostridium botulinum (strain Okra / Type B1) GN=surE PE=3 SV=1 23 166 2.0E-09
sp|B1KTK1|SURE_CLOBM 5'-nucleotidase SurE OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=surE PE=3 SV=1 23 166 2.0E-09
sp|Q3BUS4|SURE_XANC5 5'-nucleotidase SurE OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=surE PE=3 SV=1 21 164 2.0E-09
sp|B8FC91|SURE_DESAA 5'-nucleotidase SurE OS=Desulfatibacillum alkenivorans (strain AK-01) GN=surE PE=3 SV=1 23 164 2.0E-09
sp|Q3A4N5|SURE_PELCD 5'-nucleotidase SurE OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=surE PE=3 SV=1 23 172 2.0E-09
sp|Q87LQ5|SURE_VIBPA 5'-nucleotidase SurE OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=surE PE=3 SV=1 16 164 2.0E-09
sp|Q9A6T5|SURE_CAUCR 5'-nucleotidase SurE OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=surE PE=3 SV=1 21 170 2.0E-09
sp|B8GX52|SURE_CAUCN 5'-nucleotidase SurE OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=surE PE=3 SV=1 21 170 2.0E-09
sp|B0RTZ9|SURE_XANCB 5'-nucleotidase SurE OS=Xanthomonas campestris pv. campestris (strain B100) GN=surE PE=3 SV=1 21 164 2.0E-09
sp|B9K7G8|SURE_THENN 5'-nucleotidase SurE OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=surE PE=3 SV=1 21 167 2.0E-09
sp|Q82VV9|SURE_NITEU 5'-nucleotidase SurE OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=surE PE=3 SV=1 21 198 2.0E-09
sp|Q823A6|SURE1_CHLCV 5'-nucleotidase SurE 1 OS=Chlamydophila caviae (strain GPIC) GN=surE1 PE=3 SV=1 22 181 3.0E-09
sp|Q8P9Y7|SURE_XANCP 5'-nucleotidase SurE OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=surE PE=3 SV=1 21 164 3.0E-09
sp|Q4UTP8|SURE_XANC8 5'-nucleotidase SurE OS=Xanthomonas campestris pv. campestris (strain 8004) GN=surE PE=3 SV=1 21 164 3.0E-09
sp|A1ASL7|SURE_PELPD 5'-nucleotidase SurE OS=Pelobacter propionicus (strain DSM 2379) GN=surE PE=3 SV=1 23 164 3.0E-09
sp|A1VQF4|SURE_POLNA 5'-nucleotidase SurE OS=Polaromonas naphthalenivorans (strain CJ2) GN=surE PE=3 SV=1 22 164 3.0E-09
sp|Q46JK0|SURE_PROMT 5'-nucleotidase SurE OS=Prochlorococcus marinus (strain NATL2A) GN=surE PE=3 SV=1 22 174 3.0E-09
sp|B1XPE2|SURE_SYNP2 5'-nucleotidase SurE OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=surE PE=3 SV=1 23 164 3.0E-09
sp|A4JEQ1|SURE_BURVG 5'-nucleotidase SurE OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=surE PE=3 SV=1 21 164 3.0E-09
sp|C0ZGV3|SURE_BREBN 5'-nucleotidase SurE OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=surE PE=3 SV=1 21 164 3.0E-09
sp|Q1ATN8|SURE_RUBXD 5'-nucleotidase SurE OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=surE PE=3 SV=2 21 168 3.0E-09
sp|A2C436|SURE_PROM1 5'-nucleotidase SurE OS=Prochlorococcus marinus (strain NATL1A) GN=surE PE=3 SV=1 22 174 4.0E-09
sp|Q0A7L4|SURE_ALKEH 5'-nucleotidase SurE OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=surE PE=3 SV=1 23 164 4.0E-09
sp|Q2NI97|SURE_METST 5'-nucleotidase SurE OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=surE PE=3 SV=1 21 166 4.0E-09
sp|Q21UQ9|SURE_RHOFT 5'-nucleotidase SurE OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=surE PE=3 SV=1 21 164 4.0E-09
sp|Q7NRV1|SURE_CHRVO 5'-nucleotidase SurE OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=surE PE=3 SV=1 22 169 4.0E-09
sp|Q39FP8|SURE2_BURL3 5'-nucleotidase SurE 2 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=surE2 PE=3 SV=1 21 164 4.0E-09
sp|Q0ADP1|SURE_NITEC 5'-nucleotidase SurE OS=Nitrosomonas eutropha (strain C91) GN=surE PE=3 SV=1 21 199 5.0E-09
sp|C3KZ52|SURE_CLOB6 5'-nucleotidase SurE OS=Clostridium botulinum (strain 657 / Type Ba4) GN=surE PE=3 SV=1 23 166 5.0E-09
sp|Q5L5X3|SURE_CHLAB 5'-nucleotidase SurE OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=surE PE=3 SV=1 22 166 5.0E-09
sp|Q2W4A1|SURE_MAGSA 5'-nucleotidase SurE OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=surE PE=3 SV=1 22 164 5.0E-09
sp|Q319M0|SURE_PROM9 5'-nucleotidase SurE OS=Prochlorococcus marinus (strain MIT 9312) GN=surE PE=3 SV=1 23 173 5.0E-09
sp|Q87AK6|SURE_XYLFT 5'-nucleotidase SurE OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=surE PE=3 SV=1 21 164 5.0E-09
sp|B0U4U5|SURE_XYLFM 5'-nucleotidase SurE OS=Xylella fastidiosa (strain M12) GN=surE PE=3 SV=1 21 164 5.0E-09
sp|B2I8X7|SURE_XYLF2 5'-nucleotidase SurE OS=Xylella fastidiosa (strain M23) GN=surE PE=3 SV=1 21 164 5.0E-09
sp|C5BGI8|SURE_EDWI9 5'/3'-nucleotidase SurE OS=Edwardsiella ictaluri (strain 93-146) GN=surE PE=3 SV=1 21 164 6.0E-09
sp|A8FK82|SURE_CAMJ8 5'-nucleotidase SurE OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=surE PE=3 SV=1 21 190 6.0E-09
sp|Q9PF20|SURE_XYLFA 5'-nucleotidase SurE OS=Xylella fastidiosa (strain 9a5c) GN=surE PE=1 SV=1 21 164 7.0E-09
sp|A7HXK5|SURE_PARL1 5'-nucleotidase SurE OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=surE PE=3 SV=1 17 177 7.0E-09
sp|C3LS21|SURE_VIBCM 5'-nucleotidase SurE OS=Vibrio cholerae serotype O1 (strain M66-2) GN=surE PE=3 SV=1 22 164 7.0E-09
sp|A5F9D9|SURE_VIBC3 5'-nucleotidase SurE OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=surE PE=3 SV=1 22 164 7.0E-09
sp|Q9KUI9|SURE_VIBCH 5'-nucleotidase SurE OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=surE PE=3 SV=2 22 164 7.0E-09
sp|Q5GYL1|SURE_XANOR 5'-nucleotidase SurE OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=surE PE=3 SV=2 21 164 7.0E-09
sp|B2SUB2|SURE_XANOP 5'-nucleotidase SurE OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=surE PE=3 SV=1 21 164 7.0E-09
sp|Q2P1L4|SURE_XANOM 5'-nucleotidase SurE OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=surE PE=3 SV=1 21 164 7.0E-09
sp|Q9HQB2|SURE_HALSA 5'-nucleotidase SurE OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=surE PE=3 SV=1 22 164 7.0E-09
sp|B0R567|SURE_HALS3 5'-nucleotidase SurE OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=surE PE=3 SV=1 22 164 7.0E-09
sp|B4F224|SURE_PROMH 5'/3'-nucleotidase SurE OS=Proteus mirabilis (strain HI4320) GN=surE PE=3 SV=1 22 164 7.0E-09
sp|Q2L006|SURE_BORA1 5'-nucleotidase SurE OS=Bordetella avium (strain 197N) GN=surE PE=3 SV=1 21 164 8.0E-09
sp|Q5HWH7|SURE_CAMJR 5'-nucleotidase SurE OS=Campylobacter jejuni (strain RM1221) GN=surE PE=3 SV=1 21 190 9.0E-09
sp|A1VY14|SURE_CAMJJ 5'-nucleotidase SurE OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=surE PE=3 SV=1 21 190 9.0E-09
sp|Q9PIK6|SURE_CAMJE 5'-nucleotidase SurE OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=surE PE=3 SV=1 21 190 9.0E-09
sp|A7HLM0|SURE_FERNB 5'-nucleotidase SurE OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=surE PE=3 SV=1 23 164 9.0E-09
sp|B0SJM4|SURE_LEPBP 5'-nucleotidase SurE OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=surE PE=3 SV=1 23 206 1.0E-08
sp|B0SBG1|SURE_LEPBA 5'-nucleotidase SurE OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=surE PE=3 SV=1 23 206 1.0E-08
sp|A9BBN4|SURE_PROM4 5'-nucleotidase SurE OS=Prochlorococcus marinus (strain MIT 9211) GN=surE PE=3 SV=1 22 174 1.0E-08
sp|Q5JE78|SURE_THEKO 5'-nucleotidase SurE OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=surE PE=3 SV=1 21 164 1.0E-08
sp|Q67NP4|SURE_SYMTH 5'-nucleotidase SurE OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=surE PE=3 SV=1 23 164 1.0E-08
sp|O27484|SURE_METTH 5'-nucleotidase SurE OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=surE PE=3 SV=1 21 166 1.0E-08
sp|Q4ZWQ0|SURE_PSEU2 5'-nucleotidase SurE OS=Pseudomonas syringae pv. syringae (strain B728a) GN=surE PE=3 SV=1 21 164 1.0E-08
sp|A4G4J2|SURE_HERAR 5'-nucleotidase SurE OS=Herminiimonas arsenicoxydans GN=surE PE=3 SV=1 22 164 1.0E-08
sp|B2VG26|SURE_ERWT9 5'/3'-nucleotidase SurE OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=surE PE=3 SV=1 21 164 1.0E-08
sp|A9BER9|SURE_PETMO 5'-nucleotidase SurE OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=surE PE=3 SV=1 23 164 1.0E-08
sp|A6LL96|SURE_THEM4 5'-nucleotidase SurE OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=surE PE=3 SV=1 23 164 1.0E-08
sp|B1LB13|SURE_THESQ 5'-nucleotidase SurE OS=Thermotoga sp. (strain RQ2) GN=surE PE=3 SV=1 21 164 2.0E-08
sp|C4LBQ6|SURE_TOLAT 5'-nucleotidase SurE OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=surE PE=3 SV=1 21 164 2.0E-08
sp|Q2YBR8|SURE_NITMU 5'-nucleotidase SurE OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=surE PE=3 SV=1 21 205 2.0E-08
sp|C5CG17|SURE_KOSOT 5'-nucleotidase SurE OS=Kosmotoga olearia (strain TBF 19.5.1) GN=surE PE=3 SV=1 23 164 2.0E-08
sp|A4TQ00|SURE_YERPP 5'/3'-nucleotidase SurE OS=Yersinia pestis (strain Pestoides F) GN=surE PE=3 SV=1 22 164 2.0E-08
sp|Q1CLR3|SURE_YERPN 5'/3'-nucleotidase SurE OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=surE PE=3 SV=1 22 164 2.0E-08
sp|A9R116|SURE_YERPG 5'/3'-nucleotidase SurE OS=Yersinia pestis bv. Antiqua (strain Angola) GN=surE PE=3 SV=1 22 164 2.0E-08
sp|Q8ZBP9|SURE_YERPE 5'/3'-nucleotidase SurE OS=Yersinia pestis GN=surE PE=3 SV=1 22 164 2.0E-08
sp|Q1C475|SURE_YERPA 5'/3'-nucleotidase SurE OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=surE PE=3 SV=1 22 164 2.0E-08
sp|A4J5D2|SURE_DESRM 5'-nucleotidase SurE OS=Desulfotomaculum reducens (strain MI-1) GN=surE PE=3 SV=1 21 164 2.0E-08
sp|Q6LMT6|SURE_PHOPR 5'-nucleotidase SurE OS=Photobacterium profundum GN=surE PE=3 SV=2 21 164 2.0E-08
sp|Q5NNV1|SURE_ZYMMO 5'-nucleotidase SurE OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=surE PE=3 SV=1 21 164 2.0E-08
sp|Q3AVE5|SURE_SYNS9 5'-nucleotidase SurE OS=Synechococcus sp. (strain CC9902) GN=surE PE=3 SV=1 19 173 3.0E-08
sp|B7IH68|SURE_THEAB 5'-nucleotidase SurE OS=Thermosipho africanus (strain TCF52B) GN=surE PE=3 SV=1 23 167 3.0E-08
sp|A7MTT7|SURE_VIBCB 5'-nucleotidase SurE OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=surE PE=3 SV=1 22 164 3.0E-08
sp|Q1J2E1|SURE_DEIGD 5'-nucleotidase SurE OS=Deinococcus geothermalis (strain DSM 11300) GN=surE PE=3 SV=1 22 174 3.0E-08
sp|A2SF75|SURE_METPP 5'-nucleotidase SurE OS=Methylibium petroleiphilum (strain PM1) GN=surE PE=3 SV=2 21 164 3.0E-08
sp|B5BEY1|SURE_SALPK 5'/3'-nucleotidase SurE OS=Salmonella paratyphi A (strain AKU_12601) GN=surE PE=3 SV=1 21 164 4.0E-08
sp|Q5PEG4|SURE_SALPA 5'/3'-nucleotidase SurE OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=surE PE=3 SV=1 21 164 4.0E-08
sp|Q48F87|SURE_PSE14 5'-nucleotidase SurE OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=surE PE=3 SV=1 21 164 4.0E-08
sp|B7KB74|SURE_CYAP7 5'-nucleotidase SurE OS=Cyanothece sp. (strain PCC 7424) GN=surE PE=3 SV=1 23 187 4.0E-08
sp|A9MF31|SURE_SALAR 5'/3'-nucleotidase SurE OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=surE PE=3 SV=1 21 164 4.0E-08
sp|A1JJT7|SURE_YERE8 5'/3'-nucleotidase SurE OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=surE PE=3 SV=1 22 164 4.0E-08
sp|A4XWR2|SURE_PSEMY 5'-nucleotidase SurE OS=Pseudomonas mendocina (strain ymp) GN=surE PE=3 SV=1 21 164 4.0E-08
sp|B5XV37|SURE_KLEP3 5'/3'-nucleotidase SurE OS=Klebsiella pneumoniae (strain 342) GN=surE PE=3 SV=1 21 164 4.0E-08
sp|A9N2D0|SURE_SALPB 5'/3'-nucleotidase SurE OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=surE PE=3 SV=1 21 164 5.0E-08
sp|A5ILS0|SURE_THEP1 5'-nucleotidase SurE OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=surE PE=3 SV=1 21 164 5.0E-08
sp|B8ERC6|SURE_METSB 5'-nucleotidase SurE OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=surE PE=3 SV=1 21 173 5.0E-08
sp|P66881|SURE_SALTY 5'/3'-nucleotidase SurE OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=surE PE=1 SV=1 21 164 5.0E-08
sp|P66882|SURE_SALTI 5'/3'-nucleotidase SurE OS=Salmonella typhi GN=surE PE=3 SV=1 21 164 5.0E-08
sp|B4TTV8|SURE_SALSV 5'/3'-nucleotidase SurE OS=Salmonella schwarzengrund (strain CVM19633) GN=surE PE=3 SV=1 21 164 5.0E-08
sp|B4T454|SURE_SALNS 5'/3'-nucleotidase SurE OS=Salmonella newport (strain SL254) GN=surE PE=3 SV=1 21 164 5.0E-08
sp|B5RDQ0|SURE_SALG2 5'/3'-nucleotidase SurE OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=surE PE=3 SV=1 21 164 5.0E-08
sp|B5QW15|SURE_SALEP 5'/3'-nucleotidase SurE OS=Salmonella enteritidis PT4 (strain P125109) GN=surE PE=3 SV=1 21 164 5.0E-08
sp|Q57KJ7|SURE_SALCH 5'/3'-nucleotidase SurE OS=Salmonella choleraesuis (strain SC-B67) GN=surE PE=3 SV=1 21 164 5.0E-08
sp|A8ANV8|SURE_CITK8 5'/3'-nucleotidase SurE OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=surE PE=3 SV=1 21 164 5.0E-08
sp|Q30QB8|SURE_SULDN 5'-nucleotidase SurE OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=surE PE=3 SV=1 22 198 5.0E-08
sp|P96112|SURE_THEMA 5'-nucleotidase SurE OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=surE PE=1 SV=2 21 164 5.0E-08
sp|Q254M8|SURE_CHLFF 5'-nucleotidase SurE OS=Chlamydophila felis (strain Fe/C-56) GN=surE PE=3 SV=1 22 166 6.0E-08
sp|Q9KI21|SURE_COXBU 5'-nucleotidase SurE OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=surE PE=1 SV=1 18 186 6.0E-08
sp|A9N9U7|SURE_COXBR 5'-nucleotidase SurE OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=surE PE=3 SV=1 18 186 6.0E-08
sp|B6J3X6|SURE_COXB2 5'-nucleotidase SurE OS=Coxiella burnetii (strain CbuG_Q212) GN=surE PE=3 SV=1 18 186 6.0E-08
sp|B6J4X6|SURE_COXB1 5'-nucleotidase SurE OS=Coxiella burnetii (strain CbuK_Q154) GN=surE PE=3 SV=1 18 186 6.0E-08
sp|B0TAY4|SURE_HELMI 5'-nucleotidase SurE OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=surE PE=3 SV=1 21 164 6.0E-08
sp|A9IP06|SURE_BORPD 5'-nucleotidase SurE OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=surE PE=3 SV=1 21 164 8.0E-08
sp|Q74CZ6|SURE_GEOSL 5'-nucleotidase SurE OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=surE PE=3 SV=1 21 164 8.0E-08
sp|B0C6V3|SURE_ACAM1 5'-nucleotidase SurE OS=Acaryochloris marina (strain MBIC 11017) GN=surE PE=3 SV=1 22 199 8.0E-08
sp|B9MFW6|SURE_ACIET 5'-nucleotidase SurE OS=Acidovorax ebreus (strain TPSY) GN=surE PE=3 SV=1 22 164 8.0E-08
sp|A5EJV7|SURE_BRASB 5'-nucleotidase SurE OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=surE PE=3 SV=1 21 201 9.0E-08
sp|A1WWY6|SURE_HALHL 5'-nucleotidase SurE OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=surE PE=3 SV=1 23 164 9.0E-08
sp|B1JJF5|SURE_YERPY 5'/3'-nucleotidase SurE OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=surE PE=3 SV=1 22 164 9.0E-08
sp|Q66EC0|SURE_YERPS 5'/3'-nucleotidase SurE OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=surE PE=3 SV=1 22 164 9.0E-08
sp|B2K580|SURE_YERPB 5'/3'-nucleotidase SurE OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=surE PE=3 SV=1 22 164 9.0E-08
sp|A7FLX5|SURE_YERP3 5'/3'-nucleotidase SurE OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=surE PE=3 SV=1 22 164 9.0E-08
sp|A4YV68|SURE_BRASO 5'-nucleotidase SurE OS=Bradyrhizobium sp. (strain ORS278) GN=surE PE=3 SV=1 21 215 1.0E-07
sp|A5CVV1|SURE_VESOH 5'-nucleotidase SurE OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=surE PE=3 SV=1 22 164 1.0E-07
sp|A7MJ60|SURE_CROS8 5'/3'-nucleotidase SurE OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=surE PE=3 SV=1 21 164 1.0E-07
sp|A8G9Z5|SURE_SERP5 5'/3'-nucleotidase SurE OS=Serratia proteamaculans (strain 568) GN=surE PE=3 SV=1 22 164 1.0E-07
sp|Q0C0W3|SURE_HYPNA 5'-nucleotidase SurE OS=Hyphomonas neptunium (strain ATCC 15444) GN=surE PE=3 SV=1 22 170 1.0E-07
sp|A5V3Z0|SURE_SPHWW 5'-nucleotidase SurE OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=surE PE=3 SV=1 21 164 1.0E-07
sp|Q3AL65|SURE_SYNSC 5'-nucleotidase SurE OS=Synechococcus sp. (strain CC9605) GN=surE PE=3 SV=1 19 173 1.0E-07
sp|Q9S4T3|SURE_LEGPH 5'-nucleotidase SurE OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=surE PE=3 SV=1 21 164 1.0E-07
sp|B1Y0T1|SURE_LEPCP 5'-nucleotidase SurE OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=surE PE=3 SV=1 21 164 1.0E-07
sp|Q11WK5|SURE_CYTH3 5'-nucleotidase SurE OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=surE PE=3 SV=1 23 164 1.0E-07
sp|Q2GG44|SURE_EHRCR 5'-nucleotidase SurE OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=surE PE=3 SV=1 21 170 1.0E-07
sp|Q2S1H7|SURE_SALRD 5'-nucleotidase SurE OS=Salinibacter ruber (strain DSM 13855 / M31) GN=surE PE=3 SV=1 22 164 1.0E-07
sp|A6Q9V0|SURE_SULNB 5'-nucleotidase SurE OS=Sulfurovum sp. (strain NBC37-1) GN=surE PE=3 SV=1 21 164 1.0E-07
sp|Q0T1H5|SURE_SHIF8 5'/3'-nucleotidase SurE OS=Shigella flexneri serotype 5b (strain 8401) GN=surE PE=3 SV=2 21 164 1.0E-07
sp|B3Q6H7|SURE_RHOPT 5'-nucleotidase SurE OS=Rhodopseudomonas palustris (strain TIE-1) GN=surE PE=3 SV=1 21 166 2.0E-07
sp|Q6N5X7|SURE_RHOPA 5'-nucleotidase SurE OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=surE PE=3 SV=1 21 166 2.0E-07
sp|B1JB30|SURE_PSEPW 5'-nucleotidase SurE OS=Pseudomonas putida (strain W619) GN=surE PE=3 SV=1 21 164 2.0E-07
sp|B7LXF6|SURE_ECO8A 5'/3'-nucleotidase SurE OS=Escherichia coli O8 (strain IAI1) GN=surE PE=3 SV=1 21 164 2.0E-07
sp|B7NT88|SURE_ECO7I 5'/3'-nucleotidase SurE OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=surE PE=3 SV=1 21 164 2.0E-07
sp|B7LWJ1|SURE_ESCF3 5'/3'-nucleotidase SurE OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=surE PE=3 SV=1 21 164 2.0E-07
sp|Q5WX53|SURE_LEGPL 5'-nucleotidase SurE OS=Legionella pneumophila (strain Lens) GN=surE PE=3 SV=1 21 164 2.0E-07
sp|C1DBF4|SURE_LARHH 5'-nucleotidase SurE OS=Laribacter hongkongensis (strain HLHK9) GN=surE PE=3 SV=1 21 164 2.0E-07
sp|Q8YSE9|Y3139_NOSS1 Putative 5'-nucleotidase alr3139 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3139 PE=3 SV=1 23 164 2.0E-07
sp|Q3YYB8|SURE_SHISS 5'/3'-nucleotidase SurE OS=Shigella sonnei (strain Ss046) GN=surE PE=3 SV=1 21 164 2.0E-07
sp|Q31XA6|SURE_SHIBS 5'/3'-nucleotidase SurE OS=Shigella boydii serotype 4 (strain Sb227) GN=surE PE=3 SV=1 21 164 2.0E-07
sp|B2TZI7|SURE_SHIB3 5'/3'-nucleotidase SurE OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=surE PE=3 SV=1 21 164 2.0E-07
sp|Q1R7U7|SURE_ECOUT 5'/3'-nucleotidase SurE OS=Escherichia coli (strain UTI89 / UPEC) GN=surE PE=3 SV=2 21 164 2.0E-07
sp|B6I6D4|SURE_ECOSE 5'/3'-nucleotidase SurE OS=Escherichia coli (strain SE11) GN=surE PE=3 SV=1 21 164 2.0E-07
sp|P0A840|SURE_ECOLI 5'/3'-nucleotidase SurE OS=Escherichia coli (strain K12) GN=surE PE=1 SV=1 21 164 2.0E-07
sp|B1IUT5|SURE_ECOLC 5'/3'-nucleotidase SurE OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=surE PE=3 SV=1 21 164 2.0E-07
sp|P0A841|SURE_ECOL6 5'/3'-nucleotidase SurE OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=surE PE=3 SV=1 21 164 2.0E-07
sp|Q0TEB4|SURE_ECOL5 5'/3'-nucleotidase SurE OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=surE PE=3 SV=1 21 164 2.0E-07
sp|A1AET8|SURE_ECOK1 5'/3'-nucleotidase SurE OS=Escherichia coli O1:K1 / APEC GN=surE PE=3 SV=1 21 164 2.0E-07
sp|A8A3M3|SURE_ECOHS 5'/3'-nucleotidase SurE OS=Escherichia coli O9:H4 (strain HS) GN=surE PE=3 SV=1 21 164 2.0E-07
sp|B1XCS0|SURE_ECODH 5'/3'-nucleotidase SurE OS=Escherichia coli (strain K12 / DH10B) GN=surE PE=3 SV=1 21 164 2.0E-07
sp|C4ZZP8|SURE_ECOBW 5'/3'-nucleotidase SurE OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=surE PE=3 SV=1 21 164 2.0E-07
sp|B7MZ45|SURE_ECO81 5'/3'-nucleotidase SurE OS=Escherichia coli O81 (strain ED1a) GN=surE PE=3 SV=1 21 164 2.0E-07
sp|B5Z3A6|SURE_ECO5E 5'/3'-nucleotidase SurE OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=surE PE=3 SV=1 21 164 2.0E-07
sp|P0A842|SURE_ECO57 5'/3'-nucleotidase SurE OS=Escherichia coli O157:H7 GN=surE PE=3 SV=1 21 164 2.0E-07
sp|B7LEG2|SURE_ECO55 5'/3'-nucleotidase SurE OS=Escherichia coli (strain 55989 / EAEC) GN=surE PE=3 SV=1 21 164 2.0E-07
sp|B7MKL8|SURE_ECO45 5'/3'-nucleotidase SurE OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=surE PE=3 SV=1 21 164 2.0E-07
sp|B7UHG3|SURE_ECO27 5'/3'-nucleotidase SurE OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=surE PE=3 SV=1 21 164 2.0E-07
sp|A7ZQI8|SURE_ECO24 5'/3'-nucleotidase SurE OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=surE PE=3 SV=1 21 164 2.0E-07
sp|Q7VN28|SURE_HAEDU 5'-nucleotidase SurE OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=surE PE=3 SV=1 21 164 2.0E-07
sp|B7N6X4|SURE_ECOLU 5'/3'-nucleotidase SurE OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=surE PE=3 SV=1 21 164 2.0E-07
sp|Q7UKT6|SURE_RHOBA 5'-nucleotidase SurE OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=surE PE=3 SV=2 21 164 2.0E-07
sp|Q12PY9|SURE_SHEDO 5'-nucleotidase SurE OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=surE PE=3 SV=1 23 175 2.0E-07
sp|Q07N44|SURE_RHOP5 5'-nucleotidase SurE OS=Rhodopseudomonas palustris (strain BisA53) GN=surE PE=3 SV=1 21 166 2.0E-07
sp|B4RDI0|SURE_PHEZH 5'-nucleotidase SurE OS=Phenylobacterium zucineum (strain HLK1) GN=surE PE=3 SV=1 21 170 2.0E-07
sp|Q9JP92|SURE_RUBGI 5'-nucleotidase SurE OS=Rubrivivax gelatinosus (strain NBRC 100245 / IL144) GN=surE PE=3 SV=1 21 164 2.0E-07
sp|Q4KHE8|SURE_PSEF5 5'-nucleotidase SurE OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=surE PE=3 SV=1 21 164 2.0E-07
sp|Q8ZU79|SURE1_PYRAE 5'-nucleotidase SurE1 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=surE1 PE=1 SV=1 21 164 2.0E-07
sp|Q5X5S5|SURE_LEGPA 5'-nucleotidase SurE OS=Legionella pneumophila (strain Paris) GN=surE PE=3 SV=1 21 164 3.0E-07
sp|Q0IC13|SURE_SYNS3 5'-nucleotidase SurE OS=Synechococcus sp. (strain CC9311) GN=surE PE=3 SV=1 22 173 3.0E-07
sp|A9KDH9|SURE_COXBN 5'-nucleotidase SurE OS=Coxiella burnetii (strain Dugway 5J108-111) GN=surE PE=3 SV=1 18 175 3.0E-07
sp|Q9Z8S6|SURE_CHLPN 5'-nucleotidase SurE OS=Chlamydia pneumoniae GN=surE PE=3 SV=1 22 245 3.0E-07
sp|A5GMH4|SURE_SYNPW 5'-nucleotidase SurE OS=Synechococcus sp. (strain WH7803) GN=surE PE=3 SV=1 19 196 3.0E-07
sp|Q1QME1|SURE_NITHX 5'-nucleotidase SurE OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=surE PE=3 SV=1 21 166 3.0E-07
sp|A5IBD5|SURE_LEGPC 5'-nucleotidase SurE OS=Legionella pneumophila (strain Corby) GN=surE PE=3 SV=1 21 164 3.0E-07
sp|Q3ZXG5|SURE_DEHMC 5'-nucleotidase SurE OS=Dehalococcoides mccartyi (strain CBDB1) GN=surE PE=3 SV=1 22 164 3.0E-07
sp|Q7V8I0|SURE_PROMM 5'-nucleotidase SurE OS=Prochlorococcus marinus (strain MIT 9313) GN=surE PE=3 SV=1 22 164 3.0E-07
sp|A9GFF6|SURE_SORC5 5'-nucleotidase SurE OS=Sorangium cellulosum (strain So ce56) GN=surE PE=3 SV=1 23 164 3.0E-07
sp|B0T1Q2|SURE_CAUSK 5'-nucleotidase SurE OS=Caulobacter sp. (strain K31) GN=surE PE=3 SV=1 22 164 4.0E-07
sp|C5CUL9|SURE_VARPS 5'-nucleotidase SurE OS=Variovorax paradoxus (strain S110) GN=surE PE=3 SV=1 22 164 4.0E-07
sp|A2CB17|SURE_PROM3 5'-nucleotidase SurE OS=Prochlorococcus marinus (strain MIT 9303) GN=surE PE=3 SV=1 22 164 4.0E-07
sp|Q2RTH6|SURE_RHORT 5'-nucleotidase SurE OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=surE PE=3 SV=1 22 164 4.0E-07
sp|Q3Z8C0|SURE_DEHM1 5'-nucleotidase SurE OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=surE PE=3 SV=1 22 164 4.0E-07
sp|Q8EBR5|SURE_SHEON 5'-nucleotidase SurE OS=Shewanella oneidensis (strain MR-1) GN=surE PE=3 SV=2 21 175 4.0E-07
sp|Q9RRT8|SURE_DEIRA 5'-nucleotidase SurE OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=surE PE=3 SV=1 98 164 4.0E-07
sp|C3K705|SURE_PSEFS 5'-nucleotidase SurE OS=Pseudomonas fluorescens (strain SBW25) GN=surE PE=3 SV=1 21 164 4.0E-07
sp|A5FR64|SURE_DEHMB 5'-nucleotidase SurE OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=surE PE=3 SV=1 22 164 4.0E-07
sp|A7ZCD9|SURE_CAMC1 5'-nucleotidase SurE OS=Campylobacter concisus (strain 13826) GN=surE PE=3 SV=1 21 164 4.0E-07
sp|A9M0S4|SURE_NEIM0 5'-nucleotidase SurE OS=Neisseria meningitidis serogroup C (strain 053442) GN=surE PE=3 SV=1 22 177 4.0E-07
sp|Q5F7V9|SURE_NEIG1 5'-nucleotidase SurE OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=surE PE=3 SV=1 21 177 4.0E-07
sp|A1WE26|SURE_VEREI 5'-nucleotidase SurE OS=Verminephrobacter eiseniae (strain EF01-2) GN=surE PE=3 SV=1 21 164 5.0E-07
sp|A1KUT0|SURE_NEIMF 5'-nucleotidase SurE OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=surE PE=3 SV=1 21 177 5.0E-07
sp|B2IJG0|SURE_BEII9 5'-nucleotidase SurE OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=surE PE=3 SV=1 21 164 5.0E-07
sp|Q9JYP8|SURE_NEIMB 5'-nucleotidase SurE OS=Neisseria meningitidis serogroup B (strain MC58) GN=surE PE=3 SV=1 22 177 5.0E-07
sp|B0UD11|SURE_METS4 5'-nucleotidase SurE OS=Methylobacterium sp. (strain 4-46) GN=surE PE=3 SV=1 21 169 5.0E-07
sp|A4VJV2|SURE_PSEU5 5'-nucleotidase SurE OS=Pseudomonas stutzeri (strain A1501) GN=surE PE=3 SV=1 21 164 5.0E-07
sp|Q89L02|SURE_BRADU 5'-nucleotidase SurE OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=surE PE=3 SV=2 21 166 5.0E-07
sp|Q7N8K4|SURE_PHOLL 5'/3'-nucleotidase SurE OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=surE PE=3 SV=1 22 164 5.0E-07
sp|A8FST3|SURE_SHESH 5'-nucleotidase SurE OS=Shewanella sediminis (strain HAW-EB3) GN=surE PE=3 SV=1 22 175 5.0E-07
sp|Q65Q81|SURE_MANSM 5'-nucleotidase SurE OS=Mannheimia succiniciproducens (strain MBEL55E) GN=surE PE=3 SV=2 21 164 6.0E-07
sp|A6SZY0|SURE_JANMA 5'-nucleotidase SurE OS=Janthinobacterium sp. (strain Marseille) GN=surE PE=3 SV=1 22 164 6.0E-07
sp|Q7VJA8|SURE_HELHP 5'-nucleotidase SurE OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=surE PE=3 SV=1 21 164 6.0E-07
sp|Q136H7|SURE_RHOPS 5'-nucleotidase SurE OS=Rhodopseudomonas palustris (strain BisB5) GN=surE PE=3 SV=1 21 166 6.0E-07
sp|Q487E6|SURE_COLP3 5'-nucleotidase SurE OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=surE PE=3 SV=2 21 164 6.0E-07
sp|A1RHF8|SURE_SHESW 5'-nucleotidase SurE OS=Shewanella sp. (strain W3-18-1) GN=surE PE=3 SV=1 22 175 7.0E-07
sp|A4Y938|SURE_SHEPC 5'-nucleotidase SurE OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=surE PE=3 SV=1 22 175 7.0E-07
sp|Q1I654|SURE_PSEE4 5'-nucleotidase SurE OS=Pseudomonas entomophila (strain L48) GN=surE PE=3 SV=1 21 164 7.0E-07
sp|A0KU87|SURE_SHESA 5'-nucleotidase SurE OS=Shewanella sp. (strain ANA-3) GN=surE PE=3 SV=1 22 175 7.0E-07
sp|Q32CI6|SURE_SHIDS 5'/3'-nucleotidase SurE OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=surE PE=3 SV=1 21 164 7.0E-07
sp|Q8A0L8|SURE_BACTN 5'-nucleotidase SurE OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=surE PE=3 SV=1 23 164 8.0E-07
sp|A0M5L6|SURE_GRAFK 5'-nucleotidase SurE OS=Gramella forsetii (strain KT0803) GN=surE PE=3 SV=1 23 164 9.0E-07
sp|Q5P832|SURE_AROAE 5'-nucleotidase SurE OS=Aromatoleum aromaticum (strain EbN1) GN=surE PE=3 SV=1 21 174 1.0E-06
sp|Q9JTP0|SURE_NEIMA 5'-nucleotidase SurE OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=surE PE=3 SV=1 22 177 1.0E-06
sp|A8EX03|SURE_ARCB4 5'-nucleotidase SurE OS=Arcobacter butzleri (strain RM4018) GN=surE PE=3 SV=1 21 164 1.0E-06
sp|Q823A7|SURE2_CHLCV 5'-nucleotidase SurE 2 OS=Chlamydophila caviae (strain GPIC) GN=surE2 PE=3 SV=2 22 173 1.0E-06
sp|Q2IWG9|SURE_RHOP2 5'-nucleotidase SurE OS=Rhodopseudomonas palustris (strain HaA2) GN=surE PE=3 SV=1 21 166 1.0E-06
sp|B8G513|SURE_CHLAD 5'-nucleotidase SurE OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=surE PE=3 SV=1 23 164 1.0E-06
sp|Q3KH84|SURE_PSEPF 5'-nucleotidase SurE OS=Pseudomonas fluorescens (strain Pf0-1) GN=surE PE=3 SV=1 21 164 1.0E-06
sp|A5W821|SURE_PSEP1 5'-nucleotidase SurE OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=surE PE=3 SV=1 21 164 1.0E-06
sp|Q390V3|SURE1_BURL3 5'-nucleotidase SurE 1 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=surE1 PE=3 SV=1 22 164 1.0E-06
sp|Q64YA5|SURE_BACFR 5'-nucleotidase SurE OS=Bacteroides fragilis (strain YCH46) GN=surE PE=3 SV=1 23 164 1.0E-06
sp|Q5LHD7|SURE_BACFN 5'-nucleotidase SurE OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=surE PE=3 SV=1 23 164 1.0E-06
sp|B8GRG3|SURE_THISH 5'-nucleotidase SurE OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=surE PE=3 SV=1 21 164 1.0E-06
sp|Q2RJD1|SURE_MOOTA 5'-nucleotidase SurE OS=Moorella thermoacetica (strain ATCC 39073) GN=surE PE=3 SV=1 23 173 2.0E-06
sp|Q886L5|SURE_PSESM 5'-nucleotidase SurE OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=surE PE=3 SV=1 21 164 2.0E-06
sp|B2TPM3|SURE_CLOBB 5'-nucleotidase SurE OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=surE PE=3 SV=1 23 164 2.0E-06
sp|Q3SRQ5|SURE_NITWN 5'-nucleotidase SurE OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=surE PE=3 SV=1 21 166 2.0E-06
sp|A2SQ45|SURE_METLZ 5'-nucleotidase SurE OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=surE PE=3 SV=1 22 166 2.0E-06
sp|A6LF90|SURE_PARD8 5'-nucleotidase SurE OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=surE PE=3 SV=1 23 164 2.0E-06
sp|B0BTK8|SURE_ACTPJ 5'-nucleotidase SurE OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=surE PE=3 SV=1 21 164 2.0E-06
sp|B3H2Z8|SURE_ACTP7 5'-nucleotidase SurE OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=surE PE=3 SV=1 21 164 2.0E-06
sp|A3N3M1|SURE_ACTP2 5'-nucleotidase SurE OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=surE PE=3 SV=1 21 164 2.0E-06
sp|Q83JY2|SURE_SHIFL 5'/3'-nucleotidase SurE OS=Shigella flexneri GN=surE PE=3 SV=2 21 164 2.0E-06
sp|Q214W6|SURE_RHOPB 5'-nucleotidase SurE OS=Rhodopseudomonas palustris (strain BisB18) GN=surE PE=3 SV=1 21 166 2.0E-06
sp|A7H0A1|SURE_CAMC5 5'-nucleotidase SurE OS=Campylobacter curvus (strain 525.92) GN=surE PE=3 SV=1 21 164 2.0E-06
sp|B6JFP2|SURE_OLICO 5'-nucleotidase SurE OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=surE PE=3 SV=1 21 168 2.0E-06
sp|A4WDU9|SURE_ENT38 5'/3'-nucleotidase SurE OS=Enterobacter sp. (strain 638) GN=surE PE=3 SV=1 21 164 2.0E-06
sp|Q0HXG5|SURE_SHESR 5'-nucleotidase SurE OS=Shewanella sp. (strain MR-7) GN=surE PE=3 SV=1 22 164 2.0E-06
sp|Q0HL67|SURE_SHESM 5'-nucleotidase SurE OS=Shewanella sp. (strain MR-4) GN=surE PE=3 SV=1 22 164 2.0E-06
sp|Q5V4L7|SURE_HALMA 5'-nucleotidase SurE OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=surE PE=3 SV=1 23 164 2.0E-06
sp|C6E582|SURE_GEOSM 5'-nucleotidase SurE OS=Geobacter sp. (strain M21) GN=surE PE=3 SV=1 96 164 3.0E-06
sp|B1KPT1|SURE_SHEWM 5'-nucleotidase SurE OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=surE PE=3 SV=1 22 164 3.0E-06
sp|A3QC82|SURE_SHELP 5'-nucleotidase SurE OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=surE PE=3 SV=1 22 164 3.0E-06
sp|B4RKR4|SURE_NEIG2 5'-nucleotidase SurE OS=Neisseria gonorrhoeae (strain NCCP11945) GN=surE PE=3 SV=1 21 177 3.0E-06
sp|B5EHF5|SURE_GEOBB 5'-nucleotidase SurE OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=surE PE=3 SV=1 96 164 3.0E-06
sp|Q3SKJ3|SURE_THIDA 5'-nucleotidase SurE OS=Thiobacillus denitrificans (strain ATCC 25259) GN=surE PE=3 SV=1 21 198 3.0E-06
sp|A6LS61|SURE_CLOB8 5'-nucleotidase SurE OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=surE PE=3 SV=1 23 164 3.0E-06
sp|Q6MCW1|SURE_PARUW 5'-nucleotidase SurE OS=Protochlamydia amoebophila (strain UWE25) GN=surE PE=3 SV=1 23 164 3.0E-06
sp|Q7MT32|SURE_PORGI 5'-nucleotidase SurE OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=surE PE=3 SV=1 22 164 3.0E-06
sp|B2RH81|SURE_PORG3 5'-nucleotidase SurE OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=surE PE=3 SV=1 22 164 3.0E-06
sp|A9KYG5|SURE_SHEB9 5'-nucleotidase SurE OS=Shewanella baltica (strain OS195) GN=surE PE=3 SV=1 22 175 3.0E-06
sp|Q17WX7|SURE_HELAH 5'-nucleotidase SurE OS=Helicobacter acinonychis (strain Sheeba) GN=surE PE=3 SV=1 21 164 4.0E-06
sp|Q11HC9|SURE_CHESB 5'-nucleotidase SurE OS=Chelativorans sp. (strain BNC1) GN=surE PE=3 SV=1 21 164 4.0E-06
sp|A1K4E9|SURE_AZOSB 5'-nucleotidase SurE OS=Azoarcus sp. (strain BH72) GN=surE PE=3 SV=1 21 174 4.0E-06
sp|A6VUV4|SURE_MARMS 5'-nucleotidase SurE OS=Marinomonas sp. (strain MWYL1) GN=surE PE=3 SV=1 21 164 5.0E-06
sp|A6Q4L7|SURE_NITSB 5'-nucleotidase SurE OS=Nitratiruptor sp. (strain SB155-2) GN=surE PE=3 SV=1 21 206 5.0E-06
sp|C1A8T7|SURE_GEMAT 5'-nucleotidase SurE OS=Gemmatimonas aurantiaca (strain T-27 / DSM 14586 / JCM 11422 / NBRC 100505) GN=surE PE=3 SV=1 21 164 5.0E-06
sp|Q1D402|SURE_MYXXD 5'-nucleotidase SurE OS=Myxococcus xanthus (strain DK 1622) GN=surE PE=3 SV=1 21 238 6.0E-06
sp|Q4QML8|SURE_HAEI8 5'-nucleotidase SurE OS=Haemophilus influenzae (strain 86-028NP) GN=surE PE=3 SV=1 21 164 6.0E-06
sp|B8IN19|SURE_METNO 5'-nucleotidase SurE OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=surE PE=3 SV=1 21 168 6.0E-06
sp|A5GUT4|SURE_SYNR3 5'-nucleotidase SurE OS=Synechococcus sp. (strain RCC307) GN=surE PE=3 SV=1 22 164 6.0E-06
sp|A5UE24|SURE_HAEIE 5'-nucleotidase SurE OS=Haemophilus influenzae (strain PittEE) GN=surE PE=3 SV=1 21 164 6.0E-06
sp|Q7M8G1|SURE_WOLSU 5'-nucleotidase SurE OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=surE PE=3 SV=1 21 164 6.0E-06
sp|A1TZ53|SURE_MARHV 5'-nucleotidase SurE OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=surE PE=3 SV=1 21 164 6.0E-06
sp|B0KSC7|SURE_PSEPG 5'-nucleotidase SurE OS=Pseudomonas putida (strain GB-1) GN=surE PE=3 SV=1 21 164 6.0E-06
sp|Q88MF1|SURE_PSEPK 5'-nucleotidase SurE OS=Pseudomonas putida (strain KT2440) GN=surE PE=3 SV=1 21 164 6.0E-06
sp|Q2NDM8|SURE_ERYLH 5'-nucleotidase SurE OS=Erythrobacter litoralis (strain HTCC2594) GN=surE PE=3 SV=1 21 164 7.0E-06
sp|P45681|SURE_HAEIN 5'-nucleotidase SurE OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=surE PE=3 SV=1 21 164 7.0E-06
sp|B2UXL6|SURE_CLOBA 5'-nucleotidase SurE OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=surE PE=3 SV=1 23 164 7.0E-06
sp|Q746M5|SURE2_THET2 5'-nucleotidase SurE 2 OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=surE2 PE=3 SV=1 21 164 8.0E-06
sp|A7H8F6|SURE_ANADF 5'-nucleotidase SurE OS=Anaeromyxobacter sp. (strain Fw109-5) GN=surE PE=3 SV=1 21 164 9.0E-06
sp|A1AXG6|SURE_RUTMC 5'-nucleotidase SurE OS=Ruthia magnifica subsp. Calyptogena magnifica GN=surE PE=3 SV=1 22 175 9.0E-06
sp|A6WR23|SURE_SHEB8 5'-nucleotidase SurE OS=Shewanella baltica (strain OS185) GN=surE PE=3 SV=1 22 175 9.0E-06
sp|A3D790|SURE_SHEB5 5'-nucleotidase SurE OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=surE PE=3 SV=1 22 175 9.0E-06
sp|B8E8T6|SURE_SHEB2 5'-nucleotidase SurE OS=Shewanella baltica (strain OS223) GN=surE PE=3 SV=1 22 175 9.0E-06
sp|Q5FHG1|SURE_EHRRG 5'-nucleotidase SurE OS=Ehrlichia ruminantium (strain Gardel) GN=surE PE=3 SV=2 21 166 1.0E-05
sp|A9B1D4|SURE_HERA2 5'-nucleotidase SurE OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=surE PE=3 SV=1 21 164 1.0E-05
sp|Q5HBM5|SURE_EHRRW 5'-nucleotidase SurE OS=Ehrlichia ruminantium (strain Welgevonden) GN=surE PE=3 SV=1 21 166 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 1.83 0.27 3.40
Initials Initials knots 3.77 1.35 6.20
Pileal_Stipeal_center Stage I stipe center 1.50 0.40 2.61
Pileal_Stipeal_shell Stage I stipe shell 1.46 0.34 2.59
DIF_stipe_center Stage II stipe center 1.18 0.23 2.12
DIF_stipe_shell Stage II stipe shell 1.30 0.26 2.34
DIF_stipe_skin Stage II stipe skin 1.07 0.20 1.94
DIF_cap_skin Stage II cap skin 0.56 0.03 1.09
DIF_cap_tissue Stage II cap tissue 0.68 0.06 1.30
DIF_gill_tissue Stage II gill tissue 1.37 0.35 2.38
YFB_stipe_center Young fruiting body stipe center 0.58 0.00 1.22
YFB_stipe_shell Young fruiting body stipe shell 0.73 0.07 1.39
YFB_stipe_skin Young fruiting body stipe skin 1.11 0.23 1.98
YFB_cap_skin Young fruiting body cap skin 0.97 0.16 1.77
YFB_cap_tissue Young fruiting body cap tissue 0.23 0.00 0.52
YFB_gill_tissue Young fruiting body gill tissue 1.92 0.41 3.43
YFB_veil Young fruiting body veil 1.60 0.34 2.85

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.704700 no
Casing YFB_stipe_center 0.086585 no
Casing YFB_stipe_shell 0.159322 no
Casing YFB_stipe_skin 0.461401 no
Casing YFB_cap_skin 0.314520 no
Casing YFB_cap_tissue 0.024187 yes
Casing YFB_gill_tissue 0.962842 no
Casing YFB_veil 0.891315 no
Casing Initials 0.166056 no
Casing Pileal_Stipeal_center 0.822869 no
Casing Pileal_Stipeal_shell 0.789183 no
Casing DIF_stipe_center 0.533921 no
Casing DIF_stipe_shell 0.663042 no
Casing DIF_stipe_skin 0.422001 no
Casing DIF_cap_skin 0.058147 no
Casing DIF_cap_tissue 0.126175 no
DIF_gill_tissue YFB_stipe_center 0.217972 no
DIF_gill_tissue YFB_stipe_shell 0.371148 no
DIF_gill_tissue YFB_stipe_skin 0.811721 no
DIF_gill_tissue YFB_cap_skin 0.649255 no
DIF_gill_tissue YFB_cap_tissue 0.044844 yes
DIF_gill_tissue YFB_gill_tissue 0.635876 no
DIF_gill_tissue YFB_veil 0.869671 no
YFB_stipe_center YFB_stipe_shell 0.850283 no
YFB_stipe_center YFB_stipe_skin 0.412815 no
YFB_stipe_center YFB_cap_skin 0.546630 no
YFB_stipe_center YFB_cap_tissue 0.316421 no
YFB_stipe_center YFB_gill_tissue 0.070862 no
YFB_stipe_center YFB_veil 0.147277 no
YFB_stipe_shell YFB_stipe_skin 0.626136 no
YFB_stipe_shell YFB_cap_skin 0.772165 no
YFB_stipe_shell YFB_cap_tissue 0.185093 no
YFB_stipe_shell YFB_gill_tissue 0.133562 no
YFB_stipe_shell YFB_veil 0.266138 no
YFB_stipe_skin YFB_cap_skin 0.893401 no
YFB_stipe_skin YFB_cap_tissue 0.072150 no
YFB_stipe_skin YFB_gill_tissue 0.392110 no
YFB_stipe_skin YFB_veil 0.648446 no
YFB_cap_skin YFB_cap_tissue 0.091998 no
YFB_cap_skin YFB_gill_tissue 0.249946 no
YFB_cap_skin YFB_veil 0.484539 no
YFB_cap_tissue YFB_gill_tissue 0.019987 yes
YFB_cap_tissue YFB_veil 0.026461 yes
YFB_gill_tissue YFB_veil 0.841706 no
Initials DIF_gill_tissue 0.033906 yes
Initials YFB_stipe_center 0.006742 yes
Initials YFB_stipe_shell 0.006387 yes
Initials YFB_stipe_skin 0.020523 yes
Initials YFB_cap_skin 0.007092 yes
Initials YFB_cap_tissue 0.006032 yes
Initials YFB_gill_tissue 0.187178 no
Initials YFB_veil 0.108546 no
Initials Pileal_Stipeal_center 0.059513 no
Initials Pileal_Stipeal_shell 0.046536 yes
Initials DIF_stipe_center 0.025458 yes
Initials DIF_stipe_shell 0.038942 yes
Initials DIF_stipe_skin 0.012880 yes
Initials DIF_cap_skin 0.002084 yes
Initials DIF_cap_tissue 0.007092 yes
Pileal_Stipeal_center DIF_gill_tissue 0.921552 no
Pileal_Stipeal_center YFB_stipe_center 0.165288 no
Pileal_Stipeal_center YFB_stipe_shell 0.288991 no
Pileal_Stipeal_center YFB_stipe_skin 0.696428 no
Pileal_Stipeal_center YFB_cap_skin 0.527828 no
Pileal_Stipeal_center YFB_cap_tissue 0.037818 yes
Pileal_Stipeal_center YFB_gill_tissue 0.761105 no
Pileal_Stipeal_center YFB_veil 0.956710 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.977412 no
Pileal_Stipeal_center DIF_stipe_center 0.771880 no
Pileal_Stipeal_center DIF_stipe_shell 0.881223 no
Pileal_Stipeal_center DIF_stipe_skin 0.653561 no
Pileal_Stipeal_center DIF_cap_skin 0.115346 no
Pileal_Stipeal_center DIF_cap_tissue 0.238543 no
Pileal_Stipeal_shell DIF_gill_tissue 0.947556 no
Pileal_Stipeal_shell YFB_stipe_center 0.177188 no
Pileal_Stipeal_shell YFB_stipe_shell 0.300200 no
Pileal_Stipeal_shell YFB_stipe_skin 0.729408 no
Pileal_Stipeal_shell YFB_cap_skin 0.555161 no
Pileal_Stipeal_shell YFB_cap_tissue 0.043121 yes
Pileal_Stipeal_shell YFB_gill_tissue 0.722335 no
Pileal_Stipeal_shell YFB_veil 0.932996 no
Pileal_Stipeal_shell DIF_stipe_center 0.806363 no
Pileal_Stipeal_shell DIF_stipe_shell 0.908567 no
Pileal_Stipeal_shell DIF_stipe_skin 0.684468 no
Pileal_Stipeal_shell DIF_cap_skin 0.125729 no
Pileal_Stipeal_shell DIF_cap_tissue 0.254326 no
DIF_stipe_center DIF_gill_tissue 0.874634 no
DIF_stipe_center YFB_stipe_center 0.353442 no
DIF_stipe_center YFB_stipe_shell 0.553272 no
DIF_stipe_center YFB_stipe_skin 0.955558 no
DIF_stipe_center YFB_cap_skin 0.836065 no
DIF_stipe_center YFB_cap_tissue 0.063376 no
DIF_stipe_center YFB_gill_tissue 0.459539 no
DIF_stipe_center YFB_veil 0.720826 no
DIF_stipe_center DIF_stipe_shell 0.924300 no
DIF_stipe_center DIF_stipe_skin 0.928873 no
DIF_stipe_center DIF_cap_skin 0.282901 no
DIF_stipe_center DIF_cap_tissue 0.477432 no
DIF_stipe_shell DIF_gill_tissue 0.963094 no
DIF_stipe_shell YFB_stipe_center 0.272537 no
DIF_stipe_shell YFB_stipe_shell 0.448191 no
DIF_stipe_shell YFB_stipe_skin 0.868764 no
DIF_stipe_shell YFB_cap_skin 0.719173 no
DIF_stipe_shell YFB_cap_tissue 0.051723 no
DIF_stipe_shell YFB_gill_tissue 0.589839 no
DIF_stipe_shell YFB_veil 0.827477 no
DIF_stipe_shell DIF_stipe_skin 0.830635 no
DIF_stipe_shell DIF_cap_skin 0.206807 no
DIF_stipe_shell DIF_cap_tissue 0.376394 no
DIF_stipe_skin DIF_gill_tissue 0.773249 no
DIF_stipe_skin YFB_stipe_center 0.444501 no
DIF_stipe_skin YFB_stipe_shell 0.665109 no
DIF_stipe_skin YFB_stipe_skin 0.976367 no
DIF_stipe_skin YFB_cap_skin 0.926006 no
DIF_stipe_skin YFB_cap_tissue 0.072685 no
DIF_stipe_skin YFB_gill_tissue 0.355529 no
DIF_stipe_skin YFB_veil 0.609027 no
DIF_stipe_skin DIF_cap_skin 0.371897 no
DIF_stipe_skin DIF_cap_tissue 0.580751 no
DIF_cap_skin DIF_gill_tissue 0.155040 no
DIF_cap_skin YFB_stipe_center 0.985341 no
DIF_cap_skin YFB_stipe_shell 0.811474 no
DIF_cap_skin YFB_stipe_skin 0.336860 no
DIF_cap_skin YFB_cap_skin 0.477783 no
DIF_cap_skin YFB_cap_tissue 0.297777 no
DIF_cap_skin YFB_gill_tissue 0.038278 yes
DIF_cap_skin YFB_veil 0.100731 no
DIF_cap_skin DIF_cap_tissue 0.874179 no
DIF_cap_tissue DIF_gill_tissue 0.300200 no
DIF_cap_tissue YFB_stipe_center 0.905932 no
DIF_cap_tissue YFB_stipe_shell 0.955815 no
DIF_cap_tissue YFB_stipe_skin 0.544343 no
DIF_cap_tissue YFB_cap_skin 0.697061 no
DIF_cap_tissue YFB_cap_tissue 0.201753 no
DIF_cap_tissue YFB_gill_tissue 0.098771 no
DIF_cap_tissue YFB_veil 0.212824 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|037620
MKASFVKLLALTTLICGTAAQKIVLANDDGWATANIREEYKELVAAGFEVILSAPPVDRSGTGRSTATPTPMNVT
CEFDTCAVGSPAIGTDPHDRNIHYVHAFPADAVRVGIQDLAKARWGKNPDFVVAGVNIGRNLGPTVHISGTDSAA
CEAANLGIPSFAFSGQSGSFVSFTTLETDPKGQSTIDAKIYTALVRKFLSAYLAGHSSLQDSYKSSGHSSGHSSD
HSSGYSSHHSSDPSRLVPAGTTVNINFSATSSCNNNADNFKFIATKSFPDTPGGDTERCGSRQLPLEQTVSDAGC
FATVSVINSTTEDNALAAEQKAVFDRAHSLLTCM*
Coding >AgabiH97|037620
ATGAAGGCCTCTTTCGTCAAGCTTCTCGCTCTCACCACTCTCATCTGCGGTACGGCCGCTCAAAAGATTGTGCTC
GCCAATGATGACGGCTGGGCGACCGCCAATATCCGTGAAGAGTACAAGGAACTCGTGGCGGCAGGTTTCGAGGTC
ATTCTCTCTGCGCCCCCCGTGGACAGGTCTGGCACTGGAAGGAGCACAGCGACACCTACGCCTATGAATGTAACT
TGCGAGTTCGACACCTGTGCTGTCGGTTCTCCGGCCATTGGTACAGACCCCCATGATCGAAACATTCACTATGTC
CATGCGTTCCCCGCCGACGCCGTTCGCGTTGGTATTCAAGATCTCGCTAAAGCTCGTTGGGGTAAGAATCCCGAC
TTTGTCGTCGCTGGCGTTAATATCGGCCGTAACTTGGGCCCCACTGTTCACATCTCTGGCACTGATAGCGCCGCT
TGCGAGGCTGCGAACTTGGGGATTCCCTCTTTCGCTTTTTCTGGCCAATCTGGTTCATTTGTCTCTTTTACGACT
CTCGAAACCGACCCCAAAGGCCAATCCACCATCGACGCTAAAATATACACGGCGCTCGTTCGGAAATTCCTTTCT
GCCTACCTTGCAGGCCATTCTTCCCTCCAAGATTCCTACAAATCTTCCGGCCATTCTTCTGGCCATTCTTCCGAT
CATTCTTCTGGCTATTCTTCCCATCATTCTTCCGACCCTTCCCGACTTGTGCCCGCAGGAACCACTGTCAACATC
AATTTCAGTGCTACGAGCAGTTGCAATAATAACGCAGATAACTTCAAATTCATTGCTACCAAATCATTCCCTGAT
ACGCCAGGTGGTGATACGGAGAGGTGTGGGTCACGTCAACTTCCCCTTGAACAGACAGTGTCGGACGCGGGTTGT
TTTGCGACCGTGAGTGTGATTAACTCGACGACGGAAGACAATGCGTTGGCCGCGGAGCAAAAGGCGGTCTTCGAT
AGGGCGCACTCGTTGTTGACTTGTATGTAG
Transcript >AgabiH97|037620
ATGAAGGCCTCTTTCGTCAAGCTTCTCGCTCTCACCACTCTCATCTGCGGTACGGCCGCTCAAAAGATTGTGCTC
GCCAATGATGACGGCTGGGCGACCGCCAATATCCGTGAAGAGTACAAGGAACTCGTGGCGGCAGGTTTCGAGGTC
ATTCTCTCTGCGCCCCCCGTGGACAGGTCTGGCACTGGAAGGAGCACAGCGACACCTACGCCTATGAATGTAACT
TGCGAGTTCGACACCTGTGCTGTCGGTTCTCCGGCCATTGGTACAGACCCCCATGATCGAAACATTCACTATGTC
CATGCGTTCCCCGCCGACGCCGTTCGCGTTGGTATTCAAGATCTCGCTAAAGCTCGTTGGGGTAAGAATCCCGAC
TTTGTCGTCGCTGGCGTTAATATCGGCCGTAACTTGGGCCCCACTGTTCACATCTCTGGCACTGATAGCGCCGCT
TGCGAGGCTGCGAACTTGGGGATTCCCTCTTTCGCTTTTTCTGGCCAATCTGGTTCATTTGTCTCTTTTACGACT
CTCGAAACCGACCCCAAAGGCCAATCCACCATCGACGCTAAAATATACACGGCGCTCGTTCGGAAATTCCTTTCT
GCCTACCTTGCAGGCCATTCTTCCCTCCAAGATTCCTACAAATCTTCCGGCCATTCTTCTGGCCATTCTTCCGAT
CATTCTTCTGGCTATTCTTCCCATCATTCTTCCGACCCTTCCCGACTTGTGCCCGCAGGAACCACTGTCAACATC
AATTTCAGTGCTACGAGCAGTTGCAATAATAACGCAGATAACTTCAAATTCATTGCTACCAAATCATTCCCTGAT
ACGCCAGGTGGTGATACGGAGAGGTGTGGGTCACGTCAACTTCCCCTTGAACAGACAGTGTCGGACGCGGGTTGT
TTTGCGACCGTGAGTGTGATTAACTCGACGACGGAAGACAATGCGTTGGCCGCGGAGCAAAAGGCGGTCTTCGAT
AGGGCGCACTCGTTGTTGACTTGTATGTAG
Gene >AgabiH97|037620
ATGAAGGCCTCTTTCGTCAAGCTTCTCGCTCTCACCACTCTCATCTGCGGTACGGCCGCTCAAAAGATTGTGCTC
GCCAATGATGACGGCTGGGCGACCGCCAATATCCGTGAAGAGTACAAGGAACTCGTGGCGGCAGGTTTCGAGGTG
AATATCACTCTTGACCATGAGGCATCTTCATGTTCATTCAAAATTGATAATTGTTAGGTCATTCTCTCTGCGCCC
CCCGTGGACAGGTCTGGCACTGGAAGGAGCACAGCGACACCTACGCCTATGAATGTAACTTGCGAGTTCGACACC
TGTGCTGTCGGTTCTCCGGCCATTGGTACAGACCCCCATGATCGTAAGTTCTACTTCTTCCTGACATGGATATGT
CTAATGTTCAACAACAGGAAACATTCACTATGTCCATGCGTTCCCGTATGTTCATTAATGTGAACATATATGCGC
AAGGTTGATATTCTCTATTTTGATTTTAGCGCCGACGCCGTTCGCGTTGGTATTCAAGATCTCGCTAAAGCTCGT
TGGGGTAAGAATCCCGACTTTGTCGTCGCTGGCGTTAATATCGGCCGTACGTACACGAACTAAATCTCAAGAGTG
CAATAATGAACGCATCCTTTTCTAGGTAACTTGGGCCCCACTGTTCACATCTCTGGCACTGAGTAAGTTACACAT
GTATCTCTTCTTTGCGATGGCTCTTACTTATTCTTATACTACAGTAGCGCCGCTTGCGAGGCTGCGAACTTGGGG
ATTCCCTCTTTCGCTTTTTCTGGCCAATCTGGTTCATTTGTCTCTTTTACGACTCTCGAAACCGACCCCAAAGGC
CAATCCACCATCGACGCTAAAATATACACGGCGCTCGTTCGGAAATTCCTTTCTGCCTACCTTGCAGGCCATTCT
TCCCTCCAAGATTCCTACAAATCTTCCGGCCATTCTTCTGGCCATTCTTCCGATCATTCTTCTGGCTATTCTTCC
CATCATTCTTCCGACCCTTCCCGACTTGTGCCCGCAGGAACCACTGTCAACATCAATTTCAGTGCTACGAGCAGT
TGCAATAATAACGCAGATAACTTCAAATTCATTGCTACCAAATCATTCCCTGATACGCCAGGTGGTGATACGGAG
AGGTGTGGGTCACGTCAACTTCCCCTTGAACAGACAGTGTCGGACGCGGGTTGTTTTGCGACCGTGAGTGTGATT
AACTCGACGACGGAAGACAATGCGTTGGCCGCGGAGCAAAAGGCGGTCTTCGATAGGGCGCACTCGTTGTTGACT
TGTATGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail