Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|037530
Gene name
Locationscaffold_13:1038728..1040605
Strand-
Gene length (bp)1877
Transcript length (bp)1566
Coding sequence length (bp)1566
Protein length (aa) 522

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 484.25 211.10 757.40
Initials Initials knots 204.70 116.07 293.33
Pileal_Stipeal_center Stage I stipe center 383.13 201.54 564.72
Pileal_Stipeal_shell Stage I stipe shell 239.57 134.18 344.95
DIF_stipe_center Stage II stipe center 332.37 176.79 487.94
DIF_stipe_shell Stage II stipe shell 218.27 120.68 315.86
DIF_stipe_skin Stage II stipe skin 264.41 126.01 402.80
DIF_cap_skin Stage II cap skin 196.06 111.86 280.26
DIF_cap_tissue Stage II cap tissue 279.47 153.76 405.19
DIF_gill_tissue Stage II gill tissue 364.32 179.42 549.22
YFB_stipe_center Young fruiting body stipe center 277.23 138.26 416.20
YFB_stipe_shell Young fruiting body stipe shell 140.53 81.13 199.94
YFB_stipe_skin Young fruiting body stipe skin 384.07 194.86 573.29
YFB_cap_skin Young fruiting body cap skin 202.20 115.32 289.07
YFB_cap_tissue Young fruiting body cap tissue 467.06 230.46 703.67
YFB_gill_tissue Young fruiting body gill tissue 143.12 73.99 212.25
YFB_veil Young fruiting body veil 187.18 106.60 267.76

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.562694 no
Casing YFB_stipe_center 0.141674 no
Casing YFB_stipe_shell 0.000613 yes
Casing YFB_stipe_skin 0.652200 no
Casing YFB_cap_skin 0.009123 yes
Casing YFB_cap_tissue 0.959501 no
Casing YFB_gill_tissue 0.000613 yes
Casing YFB_veil 0.004928 yes
Casing Initials 0.010093 yes
Casing Pileal_Stipeal_center 0.642028 no
Casing Pileal_Stipeal_shell 0.040947 yes
Casing DIF_stipe_center 0.356545 no
Casing DIF_stipe_shell 0.020523 yes
Casing DIF_stipe_skin 0.112257 no
Casing DIF_cap_skin 0.006387 yes
Casing DIF_cap_tissue 0.136312 no
DIF_gill_tissue YFB_stipe_center 0.537304 no
DIF_gill_tissue YFB_stipe_shell 0.001140 yes
DIF_gill_tissue YFB_stipe_skin 0.936445 no
DIF_gill_tissue YFB_cap_skin 0.070862 no
DIF_gill_tissue YFB_cap_tissue 0.600995 no
DIF_gill_tissue YFB_gill_tissue 0.002951 yes
DIF_gill_tissue YFB_veil 0.035765 yes
YFB_stipe_center YFB_stipe_shell 0.024187 yes
YFB_stipe_center YFB_stipe_skin 0.426972 no
YFB_stipe_center YFB_cap_skin 0.396501 no
YFB_stipe_center YFB_cap_tissue 0.143900 no
YFB_stipe_center YFB_gill_tissue 0.039612 yes
YFB_stipe_center YFB_veil 0.263696 no
YFB_stipe_shell YFB_stipe_skin 0.000613 yes
YFB_stipe_shell YFB_cap_skin 0.265846 no
YFB_stipe_shell YFB_cap_tissue 0.000613 yes
YFB_stipe_shell YFB_gill_tissue 0.976402 no
YFB_stipe_shell YFB_veil 0.422501 no
YFB_stipe_skin YFB_cap_skin 0.039165 yes
YFB_stipe_skin YFB_cap_tissue 0.703835 no
YFB_stipe_skin YFB_gill_tissue 0.001140 yes
YFB_stipe_skin YFB_veil 0.017783 yes
YFB_cap_skin YFB_cap_tissue 0.005302 yes
YFB_cap_skin YFB_gill_tissue 0.336860 no
YFB_cap_skin YFB_veil 0.881492 no
YFB_cap_tissue YFB_gill_tissue 0.000613 yes
YFB_cap_tissue YFB_veil 0.001140 yes
YFB_gill_tissue YFB_veil 0.499498 no
Initials DIF_gill_tissue 0.076262 no
Initials YFB_stipe_center 0.430690 no
Initials YFB_stipe_shell 0.241143 no
Initials YFB_stipe_skin 0.042475 yes
Initials YFB_cap_skin 0.983554 no
Initials YFB_cap_tissue 0.005671 yes
Initials YFB_gill_tissue 0.315510 no
Initials YFB_veil 0.859320 no
Initials Pileal_Stipeal_center 0.038047 yes
Initials Pileal_Stipeal_shell 0.726896 no
Initials DIF_stipe_center 0.116868 no
Initials DIF_stipe_shell 0.905042 no
Initials DIF_stipe_skin 0.550636 no
Initials DIF_cap_skin 0.939658 no
Initials DIF_cap_tissue 0.387205 no
Pileal_Stipeal_center DIF_gill_tissue 0.939857 no
Pileal_Stipeal_center YFB_stipe_center 0.423390 no
Pileal_Stipeal_center YFB_stipe_shell 0.001140 yes
Pileal_Stipeal_center YFB_stipe_skin 0.996364 no
Pileal_Stipeal_center YFB_cap_skin 0.034837 yes
Pileal_Stipeal_center YFB_cap_tissue 0.687384 no
Pileal_Stipeal_center YFB_gill_tissue 0.001625 yes
Pileal_Stipeal_center YFB_veil 0.017226 yes
Pileal_Stipeal_center Pileal_Stipeal_shell 0.160253 no
Pileal_Stipeal_center DIF_stipe_center 0.779887 no
Pileal_Stipeal_center DIF_stipe_shell 0.072330 no
Pileal_Stipeal_center DIF_stipe_skin 0.358572 no
Pileal_Stipeal_center DIF_cap_skin 0.025711 yes
Pileal_Stipeal_center DIF_cap_tissue 0.411911 no
Pileal_Stipeal_shell DIF_gill_tissue 0.246193 no
Pileal_Stipeal_shell YFB_stipe_center 0.769593 no
Pileal_Stipeal_shell YFB_stipe_shell 0.071968 no
Pileal_Stipeal_shell YFB_stipe_skin 0.166446 no
Pileal_Stipeal_shell YFB_cap_skin 0.695094 no
Pileal_Stipeal_shell YFB_cap_tissue 0.035765 yes
Pileal_Stipeal_shell YFB_gill_tissue 0.111334 no
Pileal_Stipeal_shell YFB_veil 0.523497 no
Pileal_Stipeal_shell DIF_stipe_center 0.362726 no
Pileal_Stipeal_shell DIF_stipe_shell 0.856255 no
Pileal_Stipeal_shell DIF_stipe_skin 0.866359 no
Pileal_Stipeal_shell DIF_cap_skin 0.626514 no
Pileal_Stipeal_shell DIF_cap_tissue 0.743888 no
DIF_stipe_center DIF_gill_tissue 0.876147 no
DIF_stipe_center YFB_stipe_center 0.702761 no
DIF_stipe_center YFB_stipe_shell 0.001140 yes
DIF_stipe_center YFB_stipe_skin 0.781518 no
DIF_stipe_center YFB_cap_skin 0.112874 no
DIF_stipe_center YFB_cap_tissue 0.389377 no
DIF_stipe_center YFB_gill_tissue 0.002951 yes
DIF_stipe_center YFB_veil 0.056958 no
DIF_stipe_center DIF_stipe_shell 0.208451 no
DIF_stipe_center DIF_stipe_skin 0.626650 no
DIF_stipe_center DIF_cap_skin 0.093007 no
DIF_stipe_center DIF_cap_tissue 0.708608 no
DIF_stipe_shell DIF_gill_tissue 0.129397 no
DIF_stipe_shell YFB_stipe_center 0.564908 no
DIF_stipe_shell YFB_stipe_shell 0.155976 no
DIF_stipe_shell YFB_stipe_skin 0.077698 no
DIF_stipe_shell YFB_cap_skin 0.887570 no
DIF_stipe_shell YFB_cap_tissue 0.012577 yes
DIF_stipe_shell YFB_gill_tissue 0.215620 no
DIF_stipe_shell YFB_veil 0.732664 no
DIF_stipe_shell DIF_stipe_skin 0.687482 no
DIF_stipe_shell DIF_cap_skin 0.831485 no
DIF_stipe_shell DIF_cap_tissue 0.529214 no
DIF_stipe_skin DIF_gill_tissue 0.468557 no
DIF_stipe_skin YFB_stipe_center 0.942464 no
DIF_stipe_skin YFB_stipe_shell 0.052948 no
DIF_stipe_skin YFB_stipe_skin 0.364018 no
DIF_stipe_skin YFB_cap_skin 0.523681 no
DIF_stipe_skin YFB_cap_tissue 0.119615 no
DIF_stipe_skin YFB_gill_tissue 0.075734 no
DIF_stipe_skin YFB_veil 0.371072 no
DIF_stipe_skin DIF_cap_skin 0.463020 no
DIF_stipe_skin DIF_cap_tissue 0.929316 no
DIF_cap_skin DIF_gill_tissue 0.054776 no
DIF_cap_skin YFB_stipe_center 0.347907 no
DIF_cap_skin YFB_stipe_shell 0.321718 no
DIF_cap_skin YFB_stipe_skin 0.030372 yes
DIF_cap_skin YFB_cap_skin 0.958779 no
DIF_cap_skin YFB_cap_tissue 0.002084 yes
DIF_cap_skin YFB_gill_tissue 0.400463 no
DIF_cap_skin YFB_veil 0.934218 no
DIF_cap_skin DIF_cap_tissue 0.304013 no
DIF_cap_tissue DIF_gill_tissue 0.532556 no
DIF_cap_tissue YFB_stipe_center 0.989426 no
DIF_cap_tissue YFB_stipe_shell 0.013186 yes
DIF_cap_tissue YFB_stipe_skin 0.415145 no
DIF_cap_tissue YFB_cap_skin 0.352090 no
DIF_cap_tissue YFB_cap_tissue 0.130818 no
DIF_cap_tissue YFB_gill_tissue 0.026461 yes
DIF_cap_tissue YFB_veil 0.223259 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|037530
MFSQKLCVAFLTLALFSFSAQAAPQYHHLAGRDILSSRTGTAIAVAARQDGGFGDRRKGGGNNNGGNNNGGNNQQ
GGGNNQGGGNNNQGGNNNQGGNQGGNNGANDAQTSLTLDPAVIAQGFANDGQDVPTDGQVASLTSTNNFINFCLT
VDLPISNGKQVKGGSCNPAPMGTIASTSNMPSSKFTFPQNFGAVKSNTPFTIKMAIKNLQTGNFVNADSNYYSAP
QQLNAQGTIIGHSHVVVEQLDAIDQTTPTDPNKFAFFKGLNVAAVNGELSADVSSGLPAGVYKLSSINAAANHQP
VLVAVAQHGSLDDAVYFFVTDDGQPPAGAGAGNGAGAGNGAGAGNGAGNGNGAGNGNGAGAGDDAGAGAGAGDDA
GAGAGSGDDAGAGDDAGAGNGAGAGNGGNGKNGNGKGGKGSGKGGNGKGAAAGDATASATATATATDQDGAATAT
ASSADPAATDAPAGNDNADNGKGASGDQNTKGGSRPSRGSNDNGFPRGSGRGGFGRPSGGNRPRFGFQGRN*
Coding >AgabiH97|037530
ATGTTCTCGCAAAAGCTTTGCGTCGCCTTCTTGACTCTCGCTCTCTTCTCGTTTTCTGCTCAGGCAGCTCCTCAA
TATCACCATCTTGCTGGCCGCGATATACTTTCTAGTCGAACTGGAACCGCAATCGCCGTTGCTGCCAGACAGGAT
GGAGGTTTCGGTGACAGAAGGAAGGGTGGTGGCAACAACAACGGAGGCAACAACAACGGAGGCAACAACCAACAA
GGTGGCGGCAACAATCAAGGTGGAGGCAACAACAACCAAGGTGGAAACAATAATCAAGGTGGTAACCAAGGCGGA
AACAATGGCGCCAATGACGCTCAAACGTCTCTGACGCTTGATCCCGCGGTCATTGCCCAAGGATTCGCCAATGAC
GGACAAGACGTTCCCACTGATGGCCAGGTGGCCTCTCTGACGTCGACCAACAACTTCATCAACTTTTGCTTGACT
GTCGACCTTCCCATCTCCAATGGCAAACAGGTCAAAGGCGGTTCCTGTAACCCCGCCCCCATGGGCACTATTGCT
TCTACTAGCAACATGCCTTCGTCCAAGTTTACTTTCCCCCAGAACTTTGGAGCCGTAAAATCGAACACGCCTTTC
ACGATCAAAATGGCGATAAAGAACTTACAGACCGGTAACTTTGTCAACGCCGACAGTAACTACTATTCGGCGCCT
CAACAGCTTAACGCTCAAGGCACAATTATCGGTCACTCCCATGTCGTTGTTGAACAGCTGGATGCCATCGATCAG
ACGACGCCCACCGATCCCAATAAGTTTGCATTCTTCAAGGGCTTAAATGTCGCCGCTGTCAATGGTGAACTCTCT
GCCGATGTATCGAGCGGTCTTCCTGCCGGTGTCTATAAATTGTCTTCTATCAATGCCGCCGCCAACCATCAACCC
GTCCTGGTCGCTGTCGCTCAACATGGTTCCCTTGACGACGCCGTCTATTTCTTTGTTACCGATGACGGTCAACCT
CCTGCTGGTGCTGGTGCTGGTAATGGTGCCGGCGCAGGCAATGGCGCTGGTGCTGGCAATGGTGCTGGTAATGGC
AATGGTGCTGGTAATGGCAATGGTGCTGGCGCTGGTGACGATGCTGGCGCTGGTGCTGGTGCTGGTGACGATGCT
GGTGCTGGTGCTGGTAGTGGCGATGATGCCGGTGCTGGTGATGATGCTGGTGCTGGCAATGGTGCTGGCGCTGGC
AACGGTGGCAATGGCAAAAACGGGAATGGCAAGGGCGGTAAAGGCAGTGGCAAGGGCGGTAACGGCAAAGGCGCT
GCCGCAGGGGATGCCACTGCTTCTGCTACGGCGACTGCTACTGCAACCGATCAGGATGGCGCTGCCACCGCTACT
GCTTCTTCCGCCGACCCCGCCGCCACTGATGCCCCAGCTGGCAACGACAACGCCGATAATGGAAAGGGAGCTTCA
GGTGACCAGAATACGAAAGGTGGCTCTAGGCCGTCAAGGGGTTCAAACGACAACGGCTTCCCCAGAGGTTCCGGT
AGGGGGGGTTTTGGACGTCCATCTGGCGGTAACCGCCCGAGGTTTGGTTTTCAAGGAAGGAACTGA
Transcript >AgabiH97|037530
ATGTTCTCGCAAAAGCTTTGCGTCGCCTTCTTGACTCTCGCTCTCTTCTCGTTTTCTGCTCAGGCAGCTCCTCAA
TATCACCATCTTGCTGGCCGCGATATACTTTCTAGTCGAACTGGAACCGCAATCGCCGTTGCTGCCAGACAGGAT
GGAGGTTTCGGTGACAGAAGGAAGGGTGGTGGCAACAACAACGGAGGCAACAACAACGGAGGCAACAACCAACAA
GGTGGCGGCAACAATCAAGGTGGAGGCAACAACAACCAAGGTGGAAACAATAATCAAGGTGGTAACCAAGGCGGA
AACAATGGCGCCAATGACGCTCAAACGTCTCTGACGCTTGATCCCGCGGTCATTGCCCAAGGATTCGCCAATGAC
GGACAAGACGTTCCCACTGATGGCCAGGTGGCCTCTCTGACGTCGACCAACAACTTCATCAACTTTTGCTTGACT
GTCGACCTTCCCATCTCCAATGGCAAACAGGTCAAAGGCGGTTCCTGTAACCCCGCCCCCATGGGCACTATTGCT
TCTACTAGCAACATGCCTTCGTCCAAGTTTACTTTCCCCCAGAACTTTGGAGCCGTAAAATCGAACACGCCTTTC
ACGATCAAAATGGCGATAAAGAACTTACAGACCGGTAACTTTGTCAACGCCGACAGTAACTACTATTCGGCGCCT
CAACAGCTTAACGCTCAAGGCACAATTATCGGTCACTCCCATGTCGTTGTTGAACAGCTGGATGCCATCGATCAG
ACGACGCCCACCGATCCCAATAAGTTTGCATTCTTCAAGGGCTTAAATGTCGCCGCTGTCAATGGTGAACTCTCT
GCCGATGTATCGAGCGGTCTTCCTGCCGGTGTCTATAAATTGTCTTCTATCAATGCCGCCGCCAACCATCAACCC
GTCCTGGTCGCTGTCGCTCAACATGGTTCCCTTGACGACGCCGTCTATTTCTTTGTTACCGATGACGGTCAACCT
CCTGCTGGTGCTGGTGCTGGTAATGGTGCCGGCGCAGGCAATGGCGCTGGTGCTGGCAATGGTGCTGGTAATGGC
AATGGTGCTGGTAATGGCAATGGTGCTGGCGCTGGTGACGATGCTGGCGCTGGTGCTGGTGCTGGTGACGATGCT
GGTGCTGGTGCTGGTAGTGGCGATGATGCCGGTGCTGGTGATGATGCTGGTGCTGGCAATGGTGCTGGCGCTGGC
AACGGTGGCAATGGCAAAAACGGGAATGGCAAGGGCGGTAAAGGCAGTGGCAAGGGCGGTAACGGCAAAGGCGCT
GCCGCAGGGGATGCCACTGCTTCTGCTACGGCGACTGCTACTGCAACCGATCAGGATGGCGCTGCCACCGCTACT
GCTTCTTCCGCCGACCCCGCCGCCACTGATGCCCCAGCTGGCAACGACAACGCCGATAATGGAAAGGGAGCTTCA
GGTGACCAGAATACGAAAGGTGGCTCTAGGCCGTCAAGGGGTTCAAACGACAACGGCTTCCCCAGAGGTTCCGGT
AGGGGGGGTTTTGGACGTCCATCTGGCGGTAACCGCCCGAGGTTTGGTTTTCAAGGAAGGAACTGA
Gene >AgabiH97|037530
ATGTTCTCGCAAAAGCTTTGCGTCGCCTTCTTGACTCTCGCTCTCTTCTCGTTTTCTGCTCAGGCAGCTCCTCAA
TATCACCATCTTGCTGGCCGCGATATACTTTCTGTATGTTCTTATCTTTCCCGGCGGCGCTCGATTTGAAGTGCT
CATTATATGTGCGACTGACAGAGTCGAACTGGAACCGCAATCGCCGTTGCTGCCAGACAGGATGGAGGTTTCGGT
GAGTCGTGTTTTGTTTGCTACGTAGTGTTTTACTAAAGCTCCATCCCAGGTGACAGAAGGAAGGGTACGTGAATT
GTACTGTTAGTTTGGATTCCCAGAAACAGAAACTTTATACCACAGGTGGTGGCAACAACAACGGAGGCAACAACA
ACGGAGGCAACAACCAACAAGGTGGTGGCAACAACCAACAAGGTGGCGGCAACAATCAACAAGGTGGCGGCAACA
ATCAAGGTGGAGGCAACAACAACCAAGGTGGAAACAATAATCAAGGTGGTAACCAAGGCGGAAACAATGGCGCCA
ATGACGCTCAAACGTCTCTGAGTGAGTGGCCTCGCCTCGACGAGAGTGCATCCTGCTTAATTTTCTCCTAGCGCT
TGATCCCGCGGTCATTGCCCAAGGATTCGCCAATGACGGACAAGACGTTCCCACTGATGGCCAGGTGGCCTCTCT
GACGTCGACCAACAACTTCATCAACTTTTGCTTGACTGTCGACCTTCCCATCTCCAATGGCAAACAGGTCAAAGG
CGGTTCCTGTAACCCCGCCCCCATGGGCACTATTGCTTCTACTAGCAACATGCCTTCGTCCAAGTTTACTTTCCC
CCAGAACTTTGGAGCCGTAAAATCGAACACGCCTTTCACGATCAAAATGGCGATAAAGAACTTACAGACCGGTAA
CTTTGTCAACGCCGACAGTAACTACTATTCGGCGCCTCAACAGCTTAACGCTCAAGGCACAATTATCGGTCACTC
CCATGTCGTTGTTGAACAGCTGGATGCCATCGATCAGACGACGCCCACCGATCCCAATAAGTTTGCATTCTTCAA
GGGCTTAAATGTCGCCGCTGTCAATGGTGAACTCTCTGCCGATGTATCGAGCGGTCTTCCTGCCGGTGTCTATAA
ATTGTCTTCTATCAATGCCGCCGCCAACCATCAACCCGTCCTGGTCGCTGTCGCTCAACATGGTTCCCTTGACGA
CGCCGTCTATGTGAGTGCAATTATACTTCGGCGCTATCTTGGTCTGACCTTCCGCCTAGTTCTTTGTTACCGATG
ACGGTCAACCTCCTGCTGGTGCTGGTGCTGGTAATGGTGCCGGCGCAGGCAATGGCGCTGGTGCTGGCAATGGTG
CTGGTAATGGCAATGGTGCTGGTAATGGCAATGGTGCTGGCGCTGGTGACGATGCTGGCGCTGGTGCTGGTGCTG
GTGACGATGCTGGTGCTGGTGCTGGTAGTGGCGATGATGCCGGTGCTGGTGATGATGCTGGTGCTGGCAATGGTG
CTGGCGCTGGCAACGGTGGCAATGGCAAAAACGGGAATGGCAAGGGCGGTAAAGGCAGTGGCAAGGGCGGTAACG
GCAAAGGCGCTGCCGCAGGGGATGCCACTGCTTCTGCTACGGCGACTGCTACTGCAACCGATCAGGATGGCGCTG
CCACCGCTACTGCTTCTTCCGCCGACCCCGCCGCCACTGATGCCCCAGCTGGCAACGACAACGCCGATAATGGAA
AGGGAGCTTCAGGTGACCAGAATACGAAAGGTGGCTCTAGGCCGTCAAGGGGTTCAAACGACAACGGCTTCCCCA
GAGGTTCCGGTAGGGGGGGTTTTGGACGTCCATCTGGCGGTAACCGCCCGAGGTTTGGTTTTCAAGGAAGGAACT
GA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail