Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|037520
Gene name
Locationscaffold_13:1035462..1037497
Strand-
Gene length (bp)2035
Transcript length (bp)1395
Coding sequence length (bp)1395
Protein length (aa) 465

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00295 Glyco_hydro_28 Glycosyl hydrolases family 28 2.4E-34 124 347

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q0CXI3|PGXC_ASPTN Probable exopolygalacturonase C OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=pgxC PE=3 SV=1 4 429 2.0E-81
sp|B0XYC4|PGXC_ASPFC Probable exopolygalacturonase C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=pgxC PE=3 SV=1 4 427 1.0E-77
sp|Q4WX94|PGXC_ASPFU Probable exopolygalacturonase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pgxC PE=3 SV=1 4 427 3.0E-77
sp|A1D7I1|PGXC_NEOFI Probable exopolygalacturonase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=pgxC PE=3 SV=1 4 427 2.0E-76
sp|Q2UQ40|PGXC_ASPOR Probable exopolygalacturonase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pgxC PE=3 SV=1 21 427 6.0E-74
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q0CXI3|PGXC_ASPTN Probable exopolygalacturonase C OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=pgxC PE=3 SV=1 4 429 2.0E-81
sp|B0XYC4|PGXC_ASPFC Probable exopolygalacturonase C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=pgxC PE=3 SV=1 4 427 1.0E-77
sp|Q4WX94|PGXC_ASPFU Probable exopolygalacturonase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pgxC PE=3 SV=1 4 427 3.0E-77
sp|A1D7I1|PGXC_NEOFI Probable exopolygalacturonase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=pgxC PE=3 SV=1 4 427 2.0E-76
sp|Q2UQ40|PGXC_ASPOR Probable exopolygalacturonase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pgxC PE=3 SV=1 21 427 6.0E-74
sp|B8MZZ6|PGXC_ASPFN Probable exopolygalacturonase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=pgxC PE=3 SV=1 21 427 6.0E-74
sp|Q27UB0|PGXC_ASPNG Exopolygalacturonase C OS=Aspergillus niger GN=pgxC PE=2 SV=1 19 427 2.0E-72
sp|A2QEW2|PGXC_ASPNC Probable exopolygalacturonase C OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=pgxC PE=3 SV=2 19 427 2.0E-72
sp|I1BYN5|RPG14_RHIO9 Exopolygalacturonase rpg14 OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=rpg14 PE=1 SV=1 2 347 3.0E-29
sp|I1BYN6|RPG16_RHIO9 Exopolygalacturonase rpg16 OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=rpg16 PE=1 SV=1 4 344 1.0E-28
sp|I1BYM7|RPG15_RHIO9 Exopolygalacturonase rpg15 OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=rpg15 PE=1 SV=1 4 371 2.0E-26
sp|P35336|PGLR_ACTDE Polygalacturonase OS=Actinidia deliciosa PE=2 SV=1 14 348 3.0E-24
sp|Q5ASG9|PGLX1_EMENI Exopolygalacturonase X-1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pgaX-1 PE=1 SV=1 12 391 2.0E-23
sp|A1DLC1|PGLRX_NEOFI Probable exopolygalacturonase X OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=pgaX PE=3 SV=2 12 347 2.0E-23
sp|Q4WCZ8|PGLRX_ASPFU Probable exopolygalacturonase X OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pgaX PE=3 SV=2 12 347 3.0E-23
sp|B0YDE8|PGLRX_ASPFC Probable exopolygalacturonase X OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=pgaX PE=3 SV=2 12 347 3.0E-23
sp|Q9SFB7|QRT2_ARATH Polygalacturonase QRT2 OS=Arabidopsis thaliana GN=QRT2 PE=1 SV=2 200 344 6.0E-22
sp|Q00293|PGLRX_ASPTU Exopolygalacturonase X OS=Aspergillus tubingensis GN=pgaX PE=1 SV=1 12 347 1.0E-20
sp|Q27UB3|PGLRX_ASPNG Exopolygalacturonase X OS=Aspergillus niger GN=pgaX PE=3 SV=1 12 347 3.0E-20
sp|A2R060|PGLRX_ASPNC Probable exopolygalacturonase X OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=pgaX PE=3 SV=1 12 347 3.0E-20
sp|B8NG16|PGLRX_ASPFN Probable exopolygalacturonase X OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=pgaX PE=3 SV=1 12 343 4.0E-20
sp|P48978|PGLR_MALDO Polygalacturonase OS=Malus domestica PE=2 SV=1 31 364 1.0E-19
sp|Q94AJ5|PGLR5_ARATH Probable polygalacturonase At1g80170 OS=Arabidopsis thaliana GN=At1g80170 PE=1 SV=1 28 363 1.0E-19
sp|Q9P4W3|PGLRB_ASPNG Endopolygalacturonase B OS=Aspergillus niger GN=pgaB PE=1 SV=1 104 369 4.0E-19
sp|A2QCV8|PGLRB_ASPNC Probable endopolygalacturonase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=pgaB PE=3 SV=1 104 369 4.0E-19
sp|Q1HAY5|PGLRB_ASPKA Probable endopolygalacturonase B OS=Aspergillus kawachii GN=pgaB PE=3 SV=1 47 369 5.0E-19
sp|Q9LW07|PGLR3_ARATH Probable polygalacturonase At3g15720 OS=Arabidopsis thaliana GN=At3g15720 PE=1 SV=1 124 381 5.0E-19
sp|Q0CGP0|PGLRX_ASPTN Probable exopolygalacturonase X OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=pgaX PE=3 SV=1 12 347 6.0E-19
sp|Q02096|PGLR_PERAE Polygalacturonase OS=Persea americana PE=2 SV=1 31 365 1.0E-18
sp|P41749|PGLRA_ASPFL Endopolygalacturonase A OS=Aspergillus flavus GN=pgaA PE=2 SV=1 126 351 1.0E-18
sp|P05117|PGLR_SOLLC Polygalacturonase-2 OS=Solanum lycopersicum GN=PG2 PE=1 SV=1 200 346 1.0E-18
sp|Q39766|PGLR_GOSBA Polygalacturonase OS=Gossypium barbadense GN=G9 PE=2 SV=1 72 346 2.0E-18
sp|P24548|PGLR_OENOR Exopolygalacturonase (Fragment) OS=Oenothera organensis PE=2 SV=1 124 344 2.0E-18
sp|B8N7Z8|PGLRB_ASPFN Probable endopolygalacturonase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=pgaB PE=3 SV=1 126 351 2.0E-18
sp|P35335|PGLRB_ASPOR Endopolygalacturonase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pgaB PE=2 SV=2 126 351 2.0E-18
sp|B0YAH0|PGLRB_ASPFC Probable endopolygalacturonase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=pgaB PE=3 SV=1 130 362 3.0E-18
sp|Q4WBE1|PGLRB_ASPFU Probable endopolygalacturonase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pgaB PE=3 SV=1 130 362 3.0E-18
sp|Q39786|PGLR_GOSHI Polygalacturonase OS=Gossypium hirsutum GN=G9 PE=2 SV=1 72 346 3.0E-18
sp|A1DAQ2|PGLRB_NEOFI Probable endopolygalacturonase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=pgaB PE=3 SV=1 130 362 7.0E-18
sp|O23147|ADPG1_ARATH Polygalacturonase ADPG1 OS=Arabidopsis thaliana GN=ADPG1 PE=2 SV=1 97 348 8.0E-18
sp|P49575|PGLRA_ASPPA Probable endopolygalacturonase A OS=Aspergillus parasiticus GN=pgaA PE=2 SV=1 126 351 8.0E-18
sp|Q00359|PGLRX_COCCA Exopolygalacturonase OS=Cochliobolus carbonum GN=PGX1 PE=3 SV=1 28 392 1.0E-17
sp|Q27UB1|PGXB_ASPNG Exopolygalacturonase B OS=Aspergillus niger GN=pgxB PE=3 SV=1 52 357 2.0E-17
sp|A2QHG0|PGXB_ASPNC Probable exopolygalacturonase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=pgxB PE=3 SV=1 52 357 2.0E-17
sp|A2QG68|RGXB_ASPNC Alpha-L-rhamnosidase rgxB OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=rgxB PE=2 SV=2 22 286 2.0E-17
sp|P49063|PGLR2_ARATH Exopolygalacturonase clone GBGA483 OS=Arabidopsis thaliana GN=At3g07850 PE=2 SV=2 173 346 4.0E-17
sp|Q949Z1|PGLR4_ARATH Polygalacturonase At1g48100 OS=Arabidopsis thaliana GN=At1g48100 PE=2 SV=1 28 344 6.0E-17
sp|O74213|PGLR1_ASPAC Endopolygalacturonase I OS=Aspergillus aculeatus GN=pgaI PE=1 SV=1 101 363 8.0E-17
sp|Q5B508|PGLRB_EMENI Endopolygalacturonase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pgaB PE=1 SV=2 130 369 8.0E-17
sp|A1DBR6|PGLRD_NEOFI Probable endopolygalacturonase D OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=pgaD PE=3 SV=1 200 346 2.0E-16
sp|I1BPS7|RPG13_RHIO9 Exopolygalacturonase rpg13 OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=rpg13 PE=1 SV=1 4 371 3.0E-16
sp|Q0C7H7|PGXB_ASPTN Probable exopolygalacturonase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=pgxB PE=3 SV=1 62 357 1.0E-15
sp|Q8NK99|PGLRA_ASPKW Probable endopolygalacturonase A OS=Aspergillus kawachii (strain NBRC 4308) GN=pgaA PE=3 SV=1 104 354 1.0E-15
sp|Q8RY29|ADPG2_ARATH Polygalacturonase ADPG2 OS=Arabidopsis thaliana GN=ADPG2 PE=2 SV=2 28 347 1.0E-15
sp|Q9P4W4|PGLRA_ASPNG Endopolygalacturonase A OS=Aspergillus niger GN=pgaA PE=1 SV=1 104 354 2.0E-15
sp|A2R8F8|PGLRA_ASPNC Probable endopolygalacturonase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=pgaA PE=3 SV=1 104 354 2.0E-15
sp|Q9P4W2|PGLRD_ASPNG Endopolygalacturonase D OS=Aspergillus niger GN=pgaD PE=3 SV=1 200 363 3.0E-15
sp|A2QTU0|PGLRD_ASPNC Probable endopolygalacturonase D OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=pgaD PE=3 SV=1 200 363 3.0E-15
sp|A1DAX2|PGXB_NEOFI Probable exopolygalacturonase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=pgxB PE=3 SV=1 62 316 4.0E-15
sp|Q40312|PGLR_MEDSA Polygalacturonase OS=Medicago sativa PE=2 SV=1 200 344 4.0E-15
sp|Q2TW03|PGXB_ASPOR Probable exopolygalacturonase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pgxB PE=3 SV=2 62 423 5.0E-15
sp|B8NX60|PGXB_ASPFN Probable exopolygalacturonase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=pgxB PE=3 SV=1 62 357 7.0E-15
sp|Q07181|PGLR_GIBFU Polygalacturonase OS=Gibberella fujikuroi GN=PGA PE=1 SV=1 200 351 8.0E-15
sp|P49062|PGLR1_ARATH Exopolygalacturonase clone GBGE184 OS=Arabidopsis thaliana GN=PGA3 PE=2 SV=1 99 344 9.0E-15
sp|A2QBB6|PGLRE_ASPNC Probable endopolygalacturonase E OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=pgaE PE=3 SV=1 101 362 1.0E-14
sp|Q9P358|PGLRA_ASPAW Endopolygalacturonase A OS=Aspergillus awamori GN=pgaA PE=1 SV=1 104 354 1.0E-14
sp|O42809|PGLRE_ASPNG Endopolygalacturonase E OS=Aspergillus niger GN=pgaE PE=1 SV=1 101 362 5.0E-14
sp|Q9FY19|PGLR2_JUNAS Polygalacturonase OS=Juniperus ashei GN=JNA2 PE=1 SV=1 200 361 7.0E-14
sp|O93883|PGLR_PENGR Polygalacturonase OS=Penicillium griseoroseum GN=PGG1 PE=3 SV=1 15 362 8.0E-14
sp|P35337|PGLR_BRANA Polygalacturonase OS=Brassica napus PE=2 SV=1 200 344 1.0E-13
sp|Q5ATQ3|PGLR_EMENI Endopolygalacturonase AN8327 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN8327 PE=1 SV=1 104 363 1.0E-13
sp|Q9Y833|PGLR2_PENOL Polygalacturonase 2 OS=Penicillium olsonii GN=PG2 PE=3 SV=1 101 363 1.0E-13
sp|Q2UT29|PGLRD_ASPOR Probable endopolygalacturonase D OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pgaD PE=3 SV=2 200 363 2.0E-13
sp|Q5AYH4|PGLRD_EMENI Probable endopolygalacturonase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pgaD PE=3 SV=1 200 354 2.0E-13
sp|B8MW78|PGLRD_ASPFN Probable endopolygalacturonase D OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=pgaD PE=3 SV=1 200 363 2.0E-13
sp|Q70HJ4|PGLR2_ASPAC Probable endopolygalacturonase II OS=Aspergillus aculeatus GN=pgaII PE=2 SV=1 104 363 3.0E-13
sp|P43212|PGLR2_CRYJA Polygalacturonase OS=Cryptomeria japonica PE=1 SV=1 105 346 8.0E-13
sp|O42824|PGLR_PENJA Polygalacturonase OS=Penicillium janthinellum PE=3 SV=1 101 371 3.0E-12
sp|P48979|PGLR_PRUPE Polygalacturonase OS=Prunus persica PE=2 SV=1 200 346 3.0E-12
sp|P26213|PGLR1_ASPNG Endopolygalacturonase I OS=Aspergillus niger GN=pgaI PE=1 SV=1 104 363 5.0E-12
sp|A2QAH3|PGLR1_ASPNC Probable endopolygalacturonase I OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=pgaI PE=3 SV=1 104 363 5.0E-12
sp|O22818|PGLR6_ARATH Probable polygalacturonase At2g43860 OS=Arabidopsis thaliana GN=At2g43860 PE=2 SV=1 200 344 7.0E-12
sp|P19805|PGLR2_ASPTU Endopolygalacturonase II OS=Aspergillus tubingensis GN=pgaII PE=1 SV=1 47 381 8.0E-12
sp|O59925|PGLR_PENEN Polygalacturonase OS=Penicillium expansum GN=PEPG1 PE=3 SV=1 193 351 9.0E-12
sp|Q27UB2|PGXA_ASPNG Exopolygalacturonase A OS=Aspergillus niger GN=pgxA PE=3 SV=1 31 398 1.0E-11
sp|A2QW66|PGXA_ASPNC Probable exopolygalacturonase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=pgxA PE=3 SV=1 31 398 1.0E-11
sp|Q70HJ3|PGLRC_ASPAC Probable endopolygalacturonase C OS=Aspergillus aculeatus GN=pgaC PE=2 SV=1 104 359 2.0E-11
sp|Q7M1E7|PGLR2_CHAOB Polygalacturonase OS=Chamaecyparis obtusa PE=1 SV=1 105 359 2.0E-11
sp|A2RAY7|RGXC_ASPNC Putative galacturan 1,4-alpha-galacturonidase C OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=rgxC PE=2 SV=1 1 361 2.0E-11
sp|Q6H9K0|PGLR2_PLAAC Exopolygalacturonase (Fragment) OS=Platanus acerifolia GN=plaa2 PE=1 SV=1 194 344 4.0E-11
sp|Q12554|PGLRC_ASPNG Probable endopolygalacturonase C OS=Aspergillus niger GN=pgaC PE=3 SV=1 104 359 6.0E-11
sp|Q5ARN5|PGLX2_EMENI Exopolygalacturonase X-2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pgaX-2 PE=2 SV=1 31 297 8.0E-11
sp|A2QL39|PGLRC_ASPNC Probable endopolygalacturonase C OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=pgaC PE=3 SV=1 104 359 8.0E-11
sp|Q8NK98|PGLR2_ASPKW Probable endopolygalacturonase II OS=Aspergillus kawachii (strain NBRC 4308) GN=pgaII PE=3 SV=2 47 381 8.0E-11
sp|Q4WQT2|PGLRA_ASPFU Probable endopolygalacturonase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pgaA PE=3 SV=1 101 363 1.0E-10
sp|B0Y4Z4|PGLRA_ASPFC Probable endopolygalacturonase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=pgaA PE=3 SV=1 101 363 1.0E-10
sp|A1D415|RGXC_NEOFI Putative galacturan 1,4-alpha-galacturonidase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=rgxC PE=3 SV=1 2 361 2.0E-10
sp|A1CVV8|PGLRA_NEOFI Probable endopolygalacturonase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=pgaA PE=3 SV=1 101 363 2.0E-10
sp|P26214|PGLR2_ASPNG Endopolygalacturonase II OS=Aspergillus niger GN=pgaII PE=1 SV=1 47 381 2.0E-10
sp|A2R5S4|PGLR2_ASPNC Probable endopolygalacturonase II OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=pgaII PE=3 SV=1 47 381 2.0E-10
sp|P26215|PGLR_COCCA Polygalacturonase OS=Cochliobolus carbonum GN=PGN1 PE=3 SV=1 104 351 3.0E-10
sp|Q05967|PGLR_TOBAC Polygalacturonase OS=Nicotiana tabacum GN=PG1 PE=2 SV=1 200 344 4.0E-10
sp|B8NGP8|RHGC_ASPFN Probable rhamnogalacturonase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=rhgC PE=3 SV=2 28 348 5.0E-10
sp|Q9P359|PGLR2_ASPAW Endopolygalacturonase II OS=Aspergillus awamori GN=pgaII PE=1 SV=1 47 363 7.0E-10
sp|Q12708|PGLR1_SCLSC Endo-polygalacturonase OS=Sclerotinia sclerotiorum GN=PG1 PE=3 SV=1 190 351 1.0E-09
sp|Q2UFD2|RHGC_ASPOR Probable rhamnogalacturonase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=rhgC PE=3 SV=1 28 348 1.0E-09
sp|Q4WR80|PGLR_ASPFU Probable endopolygalacturonase AFUA_1G17220 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_1G17220 PE=3 SV=1 219 346 4.0E-09
sp|B0XPA1|PGLR_ASPFC Probable endopolygalacturonase AFUB_016610 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=AFUB_016610 PE=3 SV=1 219 346 4.0E-09
sp|Q2UHL4|PGLR1_ASPOR Endopolygalacturonase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pgaI PE=1 SV=1 67 363 5.0E-09
sp|B8N8M2|PGLR1_ASPFN Probable endopolygalacturonase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=pgaI PE=3 SV=1 67 363 5.0E-09
sp|Q9Y834|PGLR1_PENOL Polygalacturonase 1 OS=Penicillium olsonii GN=PG1 PE=3 SV=1 104 351 5.0E-09
sp|Q5B7U1|XGHA_EMENI Probable endo-xylogalacturonan hydrolase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=xghA PE=3 SV=1 15 349 3.0E-08
sp|Q2UP32|RGXA_ASPOR Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=rgxA PE=3 SV=1 13 406 5.0E-08
sp|B8NJB0|RGXA_ASPFN Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=rgxA PE=3 SV=2 13 406 5.0E-08
sp|A2QWT2|RHGD_ASPNC Putative rhamnogalacturonase D OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=rhgD PE=3 SV=1 31 344 6.0E-08
sp|A1D145|PGLR_NEOFI Probable endopolygalacturonase NFIA_008150 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NFIA_008150 PE=3 SV=1 219 346 7.0E-08
sp|A1DBT5|XGHA_NEOFI Probable endo-xylogalacturonan hydrolase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=xghA PE=3 SV=1 20 314 8.0E-08
sp|P41750|PGLRB_ASPFL Endopolygalacturonase B OS=Aspergillus flavus GN=pgaB PE=2 SV=1 180 363 3.0E-07
sp|B8NPS8|XGHA_ASPFN Probable endo-xylogalacturonan hydrolase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=xghA PE=3 SV=1 1 318 6.0E-07
sp|Q2EQQ2|RGXA_ASPNG Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus niger GN=rgxA PE=2 SV=1 6 351 7.0E-07
sp|Q2UBD8|XGHA_ASPOR Probable endo-xylogalacturonan hydrolase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=xghA PE=3 SV=1 1 318 9.0E-07
sp|P26216|PGLR1_MAIZE Exopolygalacturonase OS=Zea mays GN=PG1 PE=1 SV=1 69 344 2.0E-06
sp|A2QBB4|RGXA_ASPNC Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=rgxA PE=2 SV=2 6 351 4.0E-06
sp|P35338|PGLR2_MAIZE Exopolygalacturonase OS=Zea mays GN=PG9 PE=2 SV=1 69 344 5.0E-06
sp|Q4WBT4|XGHA_ASPFU Probable endo-xylogalacturonan hydrolase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=xghA PE=3 SV=2 173 318 5.0E-06
sp|P35339|PGLR3_MAIZE Exopolygalacturonase OS=Zea mays GN=PG2C PE=2 SV=1 61 344 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005975 carbohydrate metabolic process Yes
GO:0004650 polygalacturonase activity Yes
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0008152 metabolic process No
GO:0003674 molecular_function No
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds No
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|037520
MLRLSSLLLLSLPITRVLSAECTVSHSGSEDDSPAILKAFSDCQVDSVITFQQANYSAFTPISLTGLKNVTVHLN
GNLLLPNNISRVQHEINVTNNQPSTYATPWFYFQGEDVSIVGSDDMEWGAFHGFGEQWWNIGNRILRPQLATFNV
TNGLLRKLKVVKPIAWGWNLPGKNLRVEDHFVDAAPHNGTRDNTVSFPFNTDGLNLSGQNITVDGYYGHNGDDCI
SVINGGKDIVAQNGYCGFCSHGLSIGSLGKGGAVQTVQNVLFKNWTMDGAVYGARFKSWTGGRGFADNVKWEDIT
LVGVSTGILVTQNYYDQDKGGRPENTNSSSTKVSNFEFKNFKGSLAANWTDGTCISDPCWNYVPGIDNTKAIIFD
LYPETALNLTVENIDIHPQNLDSDKTTVLCDPSTLVSGEQMTLGFECQDGPYRATDIKLPSGALGSVAERRNIFV
VLSSIFIASLMLCI*
Coding >AgabiH97|037520
ATGTTACGACTGAGTTCACTCCTCTTACTTTCTCTTCCGATAACTAGAGTTCTCTCCGCCGAGTGTACTGTATCC
CATTCTGGAAGTGAAGATGACTCCCCGGCAATTTTGAAGGCCTTCTCGGACTGTCAAGTTGATTCTGTAATCACA
TTTCAACAAGCAAACTATAGTGCTTTCACCCCCATTTCTCTCACTGGCCTGAAAAATGTTACAGTCCATCTCAAT
GGAAATCTCCTCCTCCCCAACAATATTTCAAGGGTACAGCATGAGATAAATGTCACAAACAATCAGCCTAGTACC
TATGCAACCCCATGGTTCTATTTTCAGGGAGAAGATGTCTCCATTGTTGGATCGGATGATATGGAATGGGGCGCA
TTCCATGGGTTTGGCGAGCAGTGGTGGAACATCGGGAATAGGATCCTTCGCCCACAACTGGCGACTTTCAATGTC
ACAAACGGACTTCTCCGAAAGTTGAAAGTTGTCAAGCCTATTGCATGGGGCTGGAATCTTCCTGGAAAGAACTTG
CGAGTGGAAGATCATTTCGTGGACGCAGCACCACATAATGGAACGCGCGACAATACTGTGAGCTTCCCTTTCAAT
ACAGATGGCCTCAATCTATCAGGACAGAACATCACTGTTGATGGGTATTATGGACACAACGGTGATGATTGTATA
TCCGTCATCAACGGCGGGAAAGATATAGTCGCTCAGAACGGGTATTGCGGATTTTGTTCACATGGTCTTTCAATC
GGTTCGCTAGGCAAGGGTGGGGCCGTGCAAACGGTTCAGAATGTACTATTCAAGAATTGGACTATGGATGGGGCG
GTCTATGGAGCCAGGTTCAAAAGCTGGACCGGAGGACGGGGATTTGCAGATAATGTAAAATGGGAAGACATCACA
CTTGTCGGGGTGTCAACTGGCATCCTCGTCACTCAAAACTACTACGACCAAGACAAAGGTGGTCGTCCCGAAAAC
ACAAACAGCTCGAGTACTAAGGTCTCCAATTTCGAATTCAAAAATTTCAAGGGTAGTCTTGCCGCAAACTGGACT
GATGGAACTTGTATAAGTGATCCATGCTGGAATTATGTTCCAGGCATCGACAACACTAAGGCCATTATTTTTGAC
CTTTATCCTGAGACGGCTTTGAATCTCACAGTCGAAAATATTGACATCCACCCGCAAAATCTAGACTCTGACAAG
ACGACAGTGTTATGTGATCCCAGCACCCTCGTTTCCGGAGAACAAATGACTCTTGGTTTCGAATGTCAGGACGGA
CCATATAGGGCTACCGACATCAAATTGCCGTCGGGCGCTCTGGGATCCGTAGCGGAAAGACGAAATATCTTCGTT
GTGCTTAGCTCGATTTTCATCGCATCTTTGATGTTATGTATCTGA
Transcript >AgabiH97|037520
ATGTTACGACTGAGTTCACTCCTCTTACTTTCTCTTCCGATAACTAGAGTTCTCTCCGCCGAGTGTACTGTATCC
CATTCTGGAAGTGAAGATGACTCCCCGGCAATTTTGAAGGCCTTCTCGGACTGTCAAGTTGATTCTGTAATCACA
TTTCAACAAGCAAACTATAGTGCTTTCACCCCCATTTCTCTCACTGGCCTGAAAAATGTTACAGTCCATCTCAAT
GGAAATCTCCTCCTCCCCAACAATATTTCAAGGGTACAGCATGAGATAAATGTCACAAACAATCAGCCTAGTACC
TATGCAACCCCATGGTTCTATTTTCAGGGAGAAGATGTCTCCATTGTTGGATCGGATGATATGGAATGGGGCGCA
TTCCATGGGTTTGGCGAGCAGTGGTGGAACATCGGGAATAGGATCCTTCGCCCACAACTGGCGACTTTCAATGTC
ACAAACGGACTTCTCCGAAAGTTGAAAGTTGTCAAGCCTATTGCATGGGGCTGGAATCTTCCTGGAAAGAACTTG
CGAGTGGAAGATCATTTCGTGGACGCAGCACCACATAATGGAACGCGCGACAATACTGTGAGCTTCCCTTTCAAT
ACAGATGGCCTCAATCTATCAGGACAGAACATCACTGTTGATGGGTATTATGGACACAACGGTGATGATTGTATA
TCCGTCATCAACGGCGGGAAAGATATAGTCGCTCAGAACGGGTATTGCGGATTTTGTTCACATGGTCTTTCAATC
GGTTCGCTAGGCAAGGGTGGGGCCGTGCAAACGGTTCAGAATGTACTATTCAAGAATTGGACTATGGATGGGGCG
GTCTATGGAGCCAGGTTCAAAAGCTGGACCGGAGGACGGGGATTTGCAGATAATGTAAAATGGGAAGACATCACA
CTTGTCGGGGTGTCAACTGGCATCCTCGTCACTCAAAACTACTACGACCAAGACAAAGGTGGTCGTCCCGAAAAC
ACAAACAGCTCGAGTACTAAGGTCTCCAATTTCGAATTCAAAAATTTCAAGGGTAGTCTTGCCGCAAACTGGACT
GATGGAACTTGTATAAGTGATCCATGCTGGAATTATGTTCCAGGCATCGACAACACTAAGGCCATTATTTTTGAC
CTTTATCCTGAGACGGCTTTGAATCTCACAGTCGAAAATATTGACATCCACCCGCAAAATCTAGACTCTGACAAG
ACGACAGTGTTATGTGATCCCAGCACCCTCGTTTCCGGAGAACAAATGACTCTTGGTTTCGAATGTCAGGACGGA
CCATATAGGGCTACCGACATCAAATTGCCGTCGGGCGCTCTGGGATCCGTAGCGGAAAGACGAAATATCTTCGTT
GTGCTTAGCTCGATTTTCATCGCATCTTTGATGTTATGTATCTGA
Gene >AgabiH97|037520
ATGTTACGACTGAGTTCACTCCTCTTACTTTCTCTTCCGATAACTAGAGTTCTCTCCGCCGAGTGTACTGTATCC
CATTCTGGAAGTGAAGATGACTCCCCGGCAATTTTGAAGGCCTTCTCGGACTGTCAAGTTGATTCTGTAATCACA
TTTCAACAAGCAAACTATAGTGCTTTCACCCCCATTTCTCTCACTGGCCTGAGTACGTGTCTATCTCTTGAACCA
CATAGTACGATACGCTAACAAGTCATGCACCAGAAAATGTTACAGTCCATCTCAATGGAAATCTCCTCCTCCCCA
ACAATATTTCAAGGGTACAGCATGAGATAAATGTCACAAACAATCAGCCTAGTGTGCGTGTCTAGCAGCTGATTT
TGACCTTGTTCTGATTCGTAGTTGGTAGACCTATGCAACCCCATGGTTCTATTTTCAGGGAGAAGATGTCTCCAT
TGTTGGATCGGATGATATGGAATGGGGCGCATTCCATGGGTTTGGCGAGCAGTGGTGGAACATCGGGAATAGGGT
CATCTATCTTTCCTCGAAATAGGTTCATCGCTGATCTTTTCTACGTAGATCCTTCGCCCACAACTGGCGACTTTC
AATGTCACAAACGGACTTCTCCGAAAGTTGAAAGTTGTCAAGCCTATTGCATGGGGCTGGAATCTTCCTGGAAAG
AACTTGCGAGTGGAAGATCATTTCGTGGACGCAGCACCACATAATGGAACGCGCGACAATACTGTGGTATGTCCG
TTCTAAGTTAGCATTCGAGGCATTCACGCATTTTCGAACCTGCGCCATAGAGCTTCCCTTTCAATACGTGAGTCT
GAATACATTACTTTGATCAGAAGCTGATGAACATTTACAGAGATGGTATCATCCTATCCTCTGGAGTTGTCCTTT
TCGATAACAGCGCGTCCCTATAGGCCTCAATCTATCAGGACAGAACATCACTGTTGATGGGTGCGCCAATTTAGC
CACTCTGCGAATGCCTTCATTCAAATGTAAATTGCAGGTATTATGGACACAACGGTGATGATTGTATATCCGTCA
TCAACGGCGGGAAAGATATAGTCGCTCAGAACGGGTATTGCGGATTTTGTTCACATGGTCTTTCAATCGGTTCGC
TAGGCAAGGGTGGGGCCGTGCAAACGGTTCAGAATGTACTATTCAAGAATTGGACTATGGATGGGGCGGTCTATG
GAGCCAGGGTTAGTTTTGTTTGAAGCATGGTGAACTACATGAATGACTCATTGCTGAGTAGTTCAAAAGCTGGAC
CGGAGGACGGGGATTTGCAGATAATGTAAAATGGGAAGACATCACACTTGTCGGGGTGTCAACTGGCATCCTCGT
CACTCAAAAGTAAGTGGACTCAAAGTAGTGCTGAGCGCTCGCTGATGCCGTCGTTTCAGCTACTACGACCAAGTT
TGTGTCTTCTTTTACTTGATCATTCAGTTATTCAAAGATGTGACATCGTAGGACAAAGGTGGTCGTCCCGAAAAC
ACAAACAGCTCGAGTACTAAGGTCTCCAATTTCGAATTCAAAAATTTCAAGGGTAGTCTTGCCGCAAACTGGAGT
AAGTGTTCCTGATCAGGACAGAGTCCCTGGTTCTGACTTTTCACTACAGCTGATGGAACTTGTATAAGTGATCCA
TGCTGGAATTATGTTCCAGGCATCGACAACACTAAGGCCATTATTTTTGACCTTTATCCTGAGACGGGTGCGCAG
AACGTTACCTTCCTCACTCTGAATCACCGTATTTACCATAGTCGGCCTACTTCTAGCTTTGAATCTCACAGTCGA
AAATATTGACATCCACCCGCAAAATCTAGACTCTGACAAGACGACAGTGTTATGTGATCCCAGCACCCTCGTTTC
CGGAGAACAAATGACTCTTGGTTTCGAATGTCAGGACGGACCATATAGGGCTACCGACATCAAATTGCCGTCGGG
CGCTCTGGGATCCGTAGCGGAAAGACGAAATATCTTCGTTGTGCTTAGCTCGATTTTCATCGCATCTTTGATGTT
ATGTATCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail