Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|037510
Gene name
Locationscaffold_13:1033507..1035329
Strand+
Gene length (bp)1822
Transcript length (bp)1650
Coding sequence length (bp)1650
Protein length (aa) 550

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01344 Kelch_1 Kelch motif 2.9E-06 218 254
PF01344 Kelch_1 Kelch motif 8.9E-07 265 307
PF01344 Kelch_1 Kelch motif 1.2E-04 319 351
PF01344 Kelch_1 Kelch motif 8.8E-06 393 432
PF13854 Kelch_5 Kelch motif 9.6E-08 316 351
PF13964 Kelch_6 Kelch motif 6.8E-06 218 255
PF13964 Kelch_6 Kelch motif 4.5E-07 319 351
PF13418 Kelch_4 Galactose oxidase, central domain 7.2E-07 218 254
PF13418 Kelch_4 Galactose oxidase, central domain 1.1E-04 319 352
PF13418 Kelch_4 Galactose oxidase, central domain 2.1E-04 393 431
PF13415 Kelch_3 Galactose oxidase, central domain 4.4E-06 226 273

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9MA55|ACBP4_ARATH Acyl-CoA-binding domain-containing protein 4 OS=Arabidopsis thaliana GN=ACBP4 PE=1 SV=1 219 516 2.0E-18
sp|Q8N653|LZTR1_HUMAN Leucine-zipper-like transcriptional regulator 1 OS=Homo sapiens GN=LZTR1 PE=1 SV=2 202 476 2.0E-18
sp|Q9CQ33|LZTR1_MOUSE Leucine-zipper-like transcriptional regulator 1 OS=Mus musculus GN=Lztr1 PE=1 SV=2 202 476 3.0E-18
sp|Q5R4Q7|LZTR1_PONAB Leucine-zipper-like transcriptional regulator 1 OS=Pongo abelii GN=LZTR1 PE=2 SV=1 202 476 5.0E-18
sp|Q8H4D4|TYW23_ORYSJ tRNA wybutosine-synthesizing protein 2/3/4 OS=Oryza sativa subsp. japonica GN=Os07g0515000 PE=2 SV=1 219 467 5.0E-17
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9MA55|ACBP4_ARATH Acyl-CoA-binding domain-containing protein 4 OS=Arabidopsis thaliana GN=ACBP4 PE=1 SV=1 219 516 2.0E-18
sp|Q8N653|LZTR1_HUMAN Leucine-zipper-like transcriptional regulator 1 OS=Homo sapiens GN=LZTR1 PE=1 SV=2 202 476 2.0E-18
sp|Q9CQ33|LZTR1_MOUSE Leucine-zipper-like transcriptional regulator 1 OS=Mus musculus GN=Lztr1 PE=1 SV=2 202 476 3.0E-18
sp|Q5R4Q7|LZTR1_PONAB Leucine-zipper-like transcriptional regulator 1 OS=Pongo abelii GN=LZTR1 PE=2 SV=1 202 476 5.0E-18
sp|Q8H4D4|TYW23_ORYSJ tRNA wybutosine-synthesizing protein 2/3/4 OS=Oryza sativa subsp. japonica GN=Os07g0515000 PE=2 SV=1 219 467 5.0E-17
sp|P87061|TEA1_SCHPO Tip elongation aberrant protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tea1 PE=1 SV=1 202 525 6.0E-17
sp|Q8VEM9|KLDC3_MOUSE Kelch domain-containing protein 3 OS=Mus musculus GN=Klhdc3 PE=2 SV=1 269 542 2.0E-16
sp|Q6AYI2|KLDC3_RAT Kelch domain-containing protein 3 OS=Rattus norvegicus GN=Klhdc3 PE=2 SV=1 269 542 2.0E-16
sp|Q58CV6|KLDC3_BOVIN Kelch domain-containing protein 3 OS=Bos taurus GN=KLHDC3 PE=2 SV=2 269 542 4.0E-16
sp|Q9BQ90|KLDC3_HUMAN Kelch domain-containing protein 3 OS=Homo sapiens GN=KLHDC3 PE=2 SV=1 269 542 6.0E-16
sp|Q58CV6|KLDC3_BOVIN Kelch domain-containing protein 3 OS=Bos taurus GN=KLHDC3 PE=2 SV=2 218 511 2.0E-15
sp|Q7M3S9|RNGB_DICDI RING finger protein B OS=Dictyostelium discoideum GN=rngB PE=2 SV=2 219 526 2.0E-15
sp|Q8VEM9|KLDC3_MOUSE Kelch domain-containing protein 3 OS=Mus musculus GN=Klhdc3 PE=2 SV=1 218 511 3.0E-15
sp|Q6AYI2|KLDC3_RAT Kelch domain-containing protein 3 OS=Rattus norvegicus GN=Klhdc3 PE=2 SV=1 218 511 3.0E-15
sp|Q86L99|GACHH_DICDI Rho GTPase-activating protein gacHH OS=Dictyostelium discoideum GN=gacHH PE=3 SV=1 194 349 6.0E-15
sp|Q8RWD9|ACBP5_ARATH Acyl-CoA-binding domain-containing protein 5 OS=Arabidopsis thaliana GN=ACBP5 PE=1 SV=1 203 479 3.0E-14
sp|Q5EA50|RABEK_BOVIN Rab9 effector protein with kelch motifs OS=Bos taurus GN=RABEPK PE=2 SV=1 225 463 6.0E-14
sp|Q5EA50|RABEK_BOVIN Rab9 effector protein with kelch motifs OS=Bos taurus GN=RABEPK PE=2 SV=1 202 449 1.0E-13
sp|Q8W4K1|TYW23_ARATH tRNA wybutosine-synthesizing protein 2/3/4 OS=Arabidopsis thaliana GN=At4g04670 PE=2 SV=1 219 481 2.0E-13
sp|Q8RWD9|ACBP5_ARATH Acyl-CoA-binding domain-containing protein 5 OS=Arabidopsis thaliana GN=ACBP5 PE=1 SV=1 291 531 3.0E-13
sp|Q9MA55|ACBP4_ARATH Acyl-CoA-binding domain-containing protein 4 OS=Arabidopsis thaliana GN=ACBP4 PE=1 SV=1 241 531 4.0E-13
sp|Q5ZJ37|RABEK_CHICK Rab9 effector protein with kelch motifs OS=Gallus gallus GN=RABEPK PE=2 SV=1 227 431 5.0E-13
sp|Q7Z6M1|RABEK_HUMAN Rab9 effector protein with kelch motifs OS=Homo sapiens GN=RABEPK PE=1 SV=1 202 431 9.0E-13
sp|Q8W4K1|TYW23_ARATH tRNA wybutosine-synthesizing protein 2/3/4 OS=Arabidopsis thaliana GN=At4g04670 PE=2 SV=1 391 539 2.0E-12
sp|Q8RWD9|ACBP5_ARATH Acyl-CoA-binding domain-containing protein 5 OS=Arabidopsis thaliana GN=ACBP5 PE=1 SV=1 219 505 6.0E-12
sp|Q7M3S9|RNGB_DICDI RING finger protein B OS=Dictyostelium discoideum GN=rngB PE=2 SV=2 188 350 1.0E-11
sp|Q6AXB2|RABEK_XENLA Rab9 effector protein with kelch motifs OS=Xenopus laevis GN=rabepk PE=2 SV=1 182 420 1.0E-11
sp|Q6AXB2|RABEK_XENLA Rab9 effector protein with kelch motifs OS=Xenopus laevis GN=rabepk PE=2 SV=1 184 500 2.0E-11
sp|P50090|KEL2_YEAST Kelch repeat-containing protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KEL2 PE=1 SV=1 216 370 2.0E-11
sp|P50090|KEL2_YEAST Kelch repeat-containing protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KEL2 PE=1 SV=1 219 469 2.0E-11
sp|Q5U3Y0|KLD10_RAT Kelch domain-containing protein 10 OS=Rattus norvegicus GN=Klhdc10 PE=2 SV=1 201 431 2.0E-11
sp|Q8VEM9|KLDC3_MOUSE Kelch domain-containing protein 3 OS=Mus musculus GN=Klhdc3 PE=2 SV=1 219 476 3.0E-11
sp|Q6AYI2|KLDC3_RAT Kelch domain-containing protein 3 OS=Rattus norvegicus GN=Klhdc3 PE=2 SV=1 219 476 3.0E-11
sp|Q58CV6|KLDC3_BOVIN Kelch domain-containing protein 3 OS=Bos taurus GN=KLHDC3 PE=2 SV=2 219 476 3.0E-11
sp|Q8W4K1|TYW23_ARATH tRNA wybutosine-synthesizing protein 2/3/4 OS=Arabidopsis thaliana GN=At4g04670 PE=2 SV=1 268 518 3.0E-11
sp|Q6PAR0|KLD10_MOUSE Kelch domain-containing protein 10 OS=Mus musculus GN=Klhdc10 PE=1 SV=1 201 431 3.0E-11
sp|Q93XW5|NSP5_ARATH Nitrile-specifier protein 5 OS=Arabidopsis thaliana GN=NSP5 PE=2 SV=1 202 462 5.0E-11
sp|Q7Z6M1|RABEK_HUMAN Rab9 effector protein with kelch motifs OS=Homo sapiens GN=RABEPK PE=1 SV=1 225 463 6.0E-11
sp|Q6AXB2|RABEK_XENLA Rab9 effector protein with kelch motifs OS=Xenopus laevis GN=rabepk PE=2 SV=1 169 325 6.0E-11
sp|Q9BQ90|KLDC3_HUMAN Kelch domain-containing protein 3 OS=Homo sapiens GN=KLHDC3 PE=2 SV=1 159 476 7.0E-11
sp|Q0IIC2|KLD10_BOVIN Kelch domain-containing protein 10 OS=Bos taurus GN=KLHDC10 PE=2 SV=1 201 431 1.0E-10
sp|Q6PID8|KLD10_HUMAN Kelch domain-containing protein 10 OS=Homo sapiens GN=KLHDC10 PE=1 SV=1 201 431 1.0E-10
sp|Q8H4D4|TYW23_ORYSJ tRNA wybutosine-synthesizing protein 2/3/4 OS=Oryza sativa subsp. japonica GN=Os07g0515000 PE=2 SV=1 263 518 2.0E-10
sp|Q86L99|GACHH_DICDI Rho GTPase-activating protein gacHH OS=Dictyostelium discoideum GN=gacHH PE=3 SV=1 391 514 4.0E-10
sp|Q8N7A1|KLDC1_HUMAN Kelch domain-containing protein 1 OS=Homo sapiens GN=KLHDC1 PE=2 SV=2 201 462 4.0E-10
sp|Q8VCH5|RABEK_MOUSE Rab9 effector protein with kelch motifs OS=Mus musculus GN=Rabepk PE=1 SV=2 229 351 7.0E-10
sp|Q9SDM9|JAL28_ARATH Nitrile-specifier protein 1 OS=Arabidopsis thaliana GN=NSP1 PE=2 SV=2 202 528 9.0E-10
sp|Q8RWD9|ACBP5_ARATH Acyl-CoA-binding domain-containing protein 5 OS=Arabidopsis thaliana GN=ACBP5 PE=1 SV=1 188 354 1.0E-09
sp|Q80YG3|KLDC1_MOUSE Kelch domain-containing protein 1 OS=Mus musculus GN=Klhdc1 PE=2 SV=1 201 462 1.0E-09
sp|Q4V8F4|RABEK_RAT Rab9 effector protein with kelch motifs OS=Rattus norvegicus GN=Rabepk PE=2 SV=1 229 351 1.0E-09
sp|Q9LR78|BSU1_ARATH Serine/threonine-protein phosphatase BSU1 OS=Arabidopsis thaliana GN=BSU1 PE=1 SV=2 261 511 1.0E-09
sp|Q86L99|GACHH_DICDI Rho GTPase-activating protein gacHH OS=Dictyostelium discoideum GN=gacHH PE=3 SV=1 211 346 2.0E-09
sp|P50090|KEL2_YEAST Kelch repeat-containing protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KEL2 PE=1 SV=1 193 517 2.0E-09
sp|O04316|JAL29_ARATH Nitrile-specifier protein 4 OS=Arabidopsis thaliana GN=NSP4 PE=2 SV=1 218 528 2.0E-09
sp|Q9SHS7|BSL3_ARATH Serine/threonine-protein phosphatase BSL3 OS=Arabidopsis thaliana GN=BSL3 PE=1 SV=2 242 463 4.0E-09
sp|Q54C94|GEFF_DICDI Ras guanine nucleotide exchange factor F OS=Dictyostelium discoideum GN=gefF PE=2 SV=1 264 525 4.0E-09
sp|Q54C94|GEFF_DICDI Ras guanine nucleotide exchange factor F OS=Dictyostelium discoideum GN=gefF PE=2 SV=1 208 463 4.0E-09
sp|Q5U580|KLD10_XENLA Kelch domain-containing protein 10 OS=Xenopus laevis GN=klhdc10 PE=2 SV=1 201 431 4.0E-09
sp|O04318|JAL27_ARATH Nitrile-specifier protein 3 OS=Arabidopsis thaliana GN=NSP3 PE=2 SV=1 202 529 9.0E-09
sp|P38853|KEL1_YEAST Kelch repeat-containing protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KEL1 PE=1 SV=1 228 467 1.0E-08
sp|Q9SJF0|BSL2_ARATH Serine/threonine-protein phosphatase BSL2 OS=Arabidopsis thaliana GN=BSL2 PE=1 SV=2 242 463 2.0E-08
sp|Q28DE7|KLD10_XENTR Kelch domain-containing protein 10 OS=Xenopus tropicalis GN=klhdc10 PE=2 SV=2 201 431 2.0E-08
sp|Q9Y5Z7|HCFC2_HUMAN Host cell factor 2 OS=Homo sapiens GN=HCFC2 PE=1 SV=1 227 375 4.0E-08
sp|Q2QM47|BSL2_ORYSJ Serine/threonine-protein phosphatase BSL2 homolog OS=Oryza sativa subsp. japonica GN=BSL2 PE=2 SV=2 242 463 4.0E-08
sp|Q4V8F4|RABEK_RAT Rab9 effector protein with kelch motifs OS=Rattus norvegicus GN=Rabepk PE=2 SV=1 260 522 5.0E-08
sp|Q8RY71|ESP_ARATH Epithiospecifier protein OS=Arabidopsis thaliana GN=ESP PE=1 SV=2 218 511 5.0E-08
sp|Q5RKG2|HCFC2_RAT Host cell factor 2 OS=Rattus norvegicus GN=Hcfc2 PE=2 SV=1 227 375 5.0E-08
sp|P80197|AFK_PHYPO Actin-fragmin kinase OS=Physarum polycephalum PE=1 SV=2 217 471 6.0E-08
sp|Q9V4C8|HCF_DROME Host cell factor OS=Drosophila melanogaster GN=Hcf PE=1 SV=2 219 535 6.0E-08
sp|Q86L99|GACHH_DICDI Rho GTPase-activating protein gacHH OS=Dictyostelium discoideum GN=gacHH PE=3 SV=1 206 308 7.0E-08
sp|O14248|TEA3_SCHPO Tip elongation aberrant protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tea3 PE=1 SV=1 219 352 7.0E-08
sp|Q80YG3|KLDC1_MOUSE Kelch domain-containing protein 1 OS=Mus musculus GN=Klhdc1 PE=2 SV=1 219 520 1.0E-07
sp|O14248|TEA3_SCHPO Tip elongation aberrant protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tea3 PE=1 SV=1 219 431 1.0E-07
sp|Q6GQN7|RABEK_DANRE Rab9 effector protein with kelch motifs OS=Danio rerio GN=rabepk PE=2 SV=1 201 351 1.0E-07
sp|P51611|HCFC1_MESAU Host cell factor 1 OS=Mesocricetus auratus GN=HCFC1 PE=1 SV=1 167 380 1.0E-07
sp|Q61191|HCFC1_MOUSE Host cell factor 1 OS=Mus musculus GN=Hcfc1 PE=1 SV=2 167 380 1.0E-07
sp|Q5EA50|RABEK_BOVIN Rab9 effector protein with kelch motifs OS=Bos taurus GN=RABEPK PE=2 SV=1 312 531 2.0E-07
sp|Q6GQN7|RABEK_DANRE Rab9 effector protein with kelch motifs OS=Danio rerio GN=rabepk PE=2 SV=1 229 453 2.0E-07
sp|O49326|JAL21_ARATH Nitrile-specifier protein 2 OS=Arabidopsis thaliana GN=NSP2 PE=2 SV=1 218 462 2.0E-07
sp|O14248|TEA3_SCHPO Tip elongation aberrant protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tea3 PE=1 SV=1 218 374 4.0E-07
sp|O14248|TEA3_SCHPO Tip elongation aberrant protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tea3 PE=1 SV=1 229 462 4.0E-07
sp|P51611|HCFC1_MESAU Host cell factor 1 OS=Mesocricetus auratus GN=HCFC1 PE=1 SV=1 219 414 4.0E-07
sp|P51611|HCFC1_MESAU Host cell factor 1 OS=Mesocricetus auratus GN=HCFC1 PE=1 SV=1 258 511 4.0E-07
sp|Q61191|HCFC1_MOUSE Host cell factor 1 OS=Mus musculus GN=Hcfc1 PE=1 SV=2 219 414 4.0E-07
sp|Q8VCH5|RABEK_MOUSE Rab9 effector protein with kelch motifs OS=Mus musculus GN=Rabepk PE=1 SV=2 226 431 5.0E-07
sp|Q4V8F4|RABEK_RAT Rab9 effector protein with kelch motifs OS=Rattus norvegicus GN=Rabepk PE=2 SV=1 313 531 5.0E-07
sp|Q9V4C8|HCF_DROME Host cell factor OS=Drosophila melanogaster GN=Hcf PE=1 SV=2 242 371 5.0E-07
sp|Q61191|HCFC1_MOUSE Host cell factor 1 OS=Mus musculus GN=Hcfc1 PE=1 SV=2 258 511 5.0E-07
sp|P51610|HCFC1_HUMAN Host cell factor 1 OS=Homo sapiens GN=HCFC1 PE=1 SV=2 167 380 5.0E-07
sp|P51610|HCFC1_HUMAN Host cell factor 1 OS=Homo sapiens GN=HCFC1 PE=1 SV=2 219 414 6.0E-07
sp|P51610|HCFC1_HUMAN Host cell factor 1 OS=Homo sapiens GN=HCFC1 PE=1 SV=2 258 511 6.0E-07
sp|Q7Z6M1|RABEK_HUMAN Rab9 effector protein with kelch motifs OS=Homo sapiens GN=RABEPK PE=1 SV=1 260 522 9.0E-07
sp|Q55A09|Y9963_DICDI Probable serine/threonine-protein kinase DDB_G0272254 OS=Dictyostelium discoideum GN=DDB_G0272254 PE=3 SV=1 217 411 1.0E-06
sp|Q8H4D4|TYW23_ORYSJ tRNA wybutosine-synthesizing protein 2/3/4 OS=Oryza sativa subsp. japonica GN=Os07g0515000 PE=2 SV=1 315 526 2.0E-06
sp|Q5EA50|RABEK_BOVIN Rab9 effector protein with kelch motifs OS=Bos taurus GN=RABEPK PE=2 SV=1 260 522 2.0E-06
sp|Q5ZJ37|RABEK_CHICK Rab9 effector protein with kelch motifs OS=Gallus gallus GN=RABEPK PE=2 SV=1 202 466 2.0E-06
sp|Q4V8F4|RABEK_RAT Rab9 effector protein with kelch motifs OS=Rattus norvegicus GN=Rabepk PE=2 SV=1 225 431 2.0E-06
sp|Q9LR78|BSU1_ARATH Serine/threonine-protein phosphatase BSU1 OS=Arabidopsis thaliana GN=BSU1 PE=1 SV=2 243 463 2.0E-06
sp|P87061|TEA1_SCHPO Tip elongation aberrant protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tea1 PE=1 SV=1 406 529 3.0E-06
sp|Q8VCH5|RABEK_MOUSE Rab9 effector protein with kelch motifs OS=Mus musculus GN=Rabepk PE=1 SV=2 313 531 3.0E-06
sp|Q9V4C8|HCF_DROME Host cell factor OS=Drosophila melanogaster GN=Hcf PE=1 SV=2 260 511 3.0E-06
sp|Q6GQN7|RABEK_DANRE Rab9 effector protein with kelch motifs OS=Danio rerio GN=rabepk PE=2 SV=1 202 514 3.0E-06
sp|Q8L7U5|BSL1_ARATH Serine/threonine-protein phosphatase BSL1 OS=Arabidopsis thaliana GN=BSL1 PE=1 SV=2 253 512 4.0E-06
sp|Q8N7A1|KLDC1_HUMAN Kelch domain-containing protein 1 OS=Homo sapiens GN=KLHDC1 PE=2 SV=2 219 512 5.0E-06
sp|A8JAM0|DRC7_CHLRE Dynein regulatory complex subunit 7 (Fragment) OS=Chlamydomonas reinhardtii GN=DRC7 PE=1 SV=1 219 465 6.0E-06
sp|Q6GQN7|RABEK_DANRE Rab9 effector protein with kelch motifs OS=Danio rerio GN=rabepk PE=2 SV=1 219 323 7.0E-06
sp|O49326|JAL21_ARATH Nitrile-specifier protein 2 OS=Arabidopsis thaliana GN=NSP2 PE=2 SV=1 202 411 7.0E-06
sp|Q55A09|Y9963_DICDI Probable serine/threonine-protein kinase DDB_G0272254 OS=Dictyostelium discoideum GN=DDB_G0272254 PE=3 SV=1 249 464 7.0E-06
sp|Q5EA50|RABEK_BOVIN Rab9 effector protein with kelch motifs OS=Bos taurus GN=RABEPK PE=2 SV=1 181 325 8.0E-06
sp|Q5RKG2|HCFC2_RAT Host cell factor 2 OS=Rattus norvegicus GN=Hcfc2 PE=2 SV=1 258 511 8.0E-06
sp|Q4G5Y1|KLDC2_MOUSE Kelch domain-containing protein 2 OS=Mus musculus GN=Klhdc2 PE=2 SV=3 230 466 8.0E-06
sp|Q39610|DYHA_CHLRE Dynein alpha chain, flagellar outer arm OS=Chlamydomonas reinhardtii GN=ODA11 PE=3 SV=2 250 450 9.0E-06
sp|Q3KRE6|KLDC2_RAT Kelch domain-containing protein 2 OS=Rattus norvegicus GN=Klhdc2 PE=2 SV=1 230 466 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|037510
MSRSQEPRPLPVPPSTRSPFEPPSSEPRTTPPPPSETSEGAYTTFGRHILPCISLGEEIPQPHETGPSTLLPSII
IEMPKRTSNDQTSRKTSINDDTNQAYLSSLSSHSDLQCNAIDTSPGHPRPRHSSFSMVSPRTASEPHQPRSQTTL
SLKQPSRGAAPKRNFPAHGLQDKYTSHPKYKSGVKIVHNKDEEAMPTSGLLWYRGPVYGALPGRTLRSHSTTTIR
NKAWVIGGYDDKQSYRDIYCLDLETLQWSHPEYKGDIPLPCRGHTATAVDHRIFVIGGMSTHATSEPITVYVFDT
LTLSWTRPRIALGSSPVQRRAHSAVYWDEKIWIFGGGNGFTALNDVWSLDVSPIINGRRTVIYRTEPSALKWEKV
EKQDNSPDSTPCGNWPDARGYHTADVVDNFMFIIGGADGQNVLDSIWVLNLGTKVWYHVDWLKGSSLTSRLAHSS
TRLGPYLFIFGGVGKEYNSELHLLNLVTLQEERRRVYGKAPIPRGYHTTVHGNGRIHVIGGANATYGFDDVWILE
LASLAYLPQITDFKVEPLEDIGWY*
Coding >AgabiH97|037510
ATGTCACGAAGTCAGGAGCCCCGACCGTTGCCAGTACCACCCTCAACTCGATCTCCCTTCGAGCCACCTTCATCT
GAGCCTCGCACCACCCCACCTCCACCTAGTGAAACTAGCGAGGGAGCGTATACGACTTTCGGAAGGCACATCCTG
CCCTGTATATCTTTAGGGGAAGAAATTCCACAGCCACACGAAACGGGTCCTTCCACCCTCCTCCCTTCAATCATA
ATAGAAATGCCGAAACGCACTTCAAATGATCAGACATCACGCAAGACCAGTATAAATGATGATACGAACCAGGCG
TATCTGAGTTCGCTATCTTCGCATTCTGATTTACAGTGCAATGCGATAGATACAAGCCCAGGCCATCCTCGACCA
CGCCATTCATCGTTTTCGATGGTATCCCCGCGTACAGCATCAGAACCTCACCAACCACGCTCACAAACAACTCTG
TCGTTGAAGCAGCCCTCAAGAGGAGCAGCCCCAAAACGCAACTTTCCTGCGCATGGTTTGCAGGATAAATATACC
AGCCATCCAAAATACAAATCAGGAGTTAAAATTGTGCACAACAAAGACGAGGAAGCTATGCCAACCTCGGGTTTA
TTGTGGTACCGTGGACCAGTTTACGGTGCTCTTCCTGGACGCACTTTGCGTTCCCACTCGACGACGACGATCAGG
AATAAGGCATGGGTTATTGGAGGGTACGACGACAAGCAAAGCTACCGAGATATCTATTGCCTCGACCTTGAAACC
CTGCAATGGTCGCATCCGGAGTATAAAGGTGACATCCCCCTACCTTGCAGAGGTCACACTGCCACGGCTGTGGAT
CACAGGATCTTCGTTATTGGTGGAATGTCCACTCATGCGACATCAGAACCAATCACTGTTTACGTCTTCGATACC
CTTACACTATCCTGGACGCGACCACGCATTGCACTAGGAAGCTCACCTGTACAACGTCGAGCCCATTCAGCTGTT
TACTGGGACGAAAAAATATGGATATTTGGTGGAGGAAATGGATTCACCGCCTTGAATGATGTCTGGTCTTTGGAC
GTCAGTCCAATAATTAATGGCCGAAGAACAGTAATATATCGAACAGAACCATCAGCTTTGAAATGGGAGAAGGTT
GAAAAGCAAGATAATTCACCCGATTCTACCCCATGCGGAAACTGGCCGGATGCCAGGGGTTACCACACTGCGGAT
GTTGTGGATAATTTCATGTTTATTATCGGAGGCGCAGACGGTCAAAACGTCTTAGATTCCATTTGGGTACTTAAC
CTCGGCACGAAAGTGTGGTATCATGTAGACTGGTTGAAAGGGTCGTCCCTGACTTCACGACTCGCACACTCGTCA
ACGCGACTTGGTCCATATCTCTTTATATTTGGGGGAGTAGGTAAGGAATACAACTCTGAACTTCACTTGCTTAAC
CTTGTGACTCTTCAAGAAGAAAGACGACGTGTATATGGAAAAGCACCCATACCACGAGGTTACCATACCACGGTA
CATGGTAATGGTAGGATACATGTCATTGGTGGCGCGAATGCTACCTATGGCTTCGACGACGTATGGATTTTGGAA
CTAGCCTCTCTTGCTTACCTTCCTCAAATCACGGATTTTAAAGTCGAGCCTCTTGAGGATATCGGATGGTATTAA
Transcript >AgabiH97|037510
ATGTCACGAAGTCAGGAGCCCCGACCGTTGCCAGTACCACCCTCAACTCGATCTCCCTTCGAGCCACCTTCATCT
GAGCCTCGCACCACCCCACCTCCACCTAGTGAAACTAGCGAGGGAGCGTATACGACTTTCGGAAGGCACATCCTG
CCCTGTATATCTTTAGGGGAAGAAATTCCACAGCCACACGAAACGGGTCCTTCCACCCTCCTCCCTTCAATCATA
ATAGAAATGCCGAAACGCACTTCAAATGATCAGACATCACGCAAGACCAGTATAAATGATGATACGAACCAGGCG
TATCTGAGTTCGCTATCTTCGCATTCTGATTTACAGTGCAATGCGATAGATACAAGCCCAGGCCATCCTCGACCA
CGCCATTCATCGTTTTCGATGGTATCCCCGCGTACAGCATCAGAACCTCACCAACCACGCTCACAAACAACTCTG
TCGTTGAAGCAGCCCTCAAGAGGAGCAGCCCCAAAACGCAACTTTCCTGCGCATGGTTTGCAGGATAAATATACC
AGCCATCCAAAATACAAATCAGGAGTTAAAATTGTGCACAACAAAGACGAGGAAGCTATGCCAACCTCGGGTTTA
TTGTGGTACCGTGGACCAGTTTACGGTGCTCTTCCTGGACGCACTTTGCGTTCCCACTCGACGACGACGATCAGG
AATAAGGCATGGGTTATTGGAGGGTACGACGACAAGCAAAGCTACCGAGATATCTATTGCCTCGACCTTGAAACC
CTGCAATGGTCGCATCCGGAGTATAAAGGTGACATCCCCCTACCTTGCAGAGGTCACACTGCCACGGCTGTGGAT
CACAGGATCTTCGTTATTGGTGGAATGTCCACTCATGCGACATCAGAACCAATCACTGTTTACGTCTTCGATACC
CTTACACTATCCTGGACGCGACCACGCATTGCACTAGGAAGCTCACCTGTACAACGTCGAGCCCATTCAGCTGTT
TACTGGGACGAAAAAATATGGATATTTGGTGGAGGAAATGGATTCACCGCCTTGAATGATGTCTGGTCTTTGGAC
GTCAGTCCAATAATTAATGGCCGAAGAACAGTAATATATCGAACAGAACCATCAGCTTTGAAATGGGAGAAGGTT
GAAAAGCAAGATAATTCACCCGATTCTACCCCATGCGGAAACTGGCCGGATGCCAGGGGTTACCACACTGCGGAT
GTTGTGGATAATTTCATGTTTATTATCGGAGGCGCAGACGGTCAAAACGTCTTAGATTCCATTTGGGTACTTAAC
CTCGGCACGAAAGTGTGGTATCATGTAGACTGGTTGAAAGGGTCGTCCCTGACTTCACGACTCGCACACTCGTCA
ACGCGACTTGGTCCATATCTCTTTATATTTGGGGGAGTAGGTAAGGAATACAACTCTGAACTTCACTTGCTTAAC
CTTGTGACTCTTCAAGAAGAAAGACGACGTGTATATGGAAAAGCACCCATACCACGAGGTTACCATACCACGGTA
CATGGTAATGGTAGGATACATGTCATTGGTGGCGCGAATGCTACCTATGGCTTCGACGACGTATGGATTTTGGAA
CTAGCCTCTCTTGCTTACCTTCCTCAAATCACGGATTTTAAAGTCGAGCCTCTTGAGGATATCGGATGGTATTAA
Gene >AgabiH97|037510
ATGTCACGAAGTCAGGAGCCCCGACCGTTGCCAGTACCACCCTCAACTCGATCTCCCTTCGAGCCACCTTCATCT
GAGCCTCGCACCACCCCACCTCCACCTAGTGAAACTAGCGAGGGAGCGTATACGACTTTCGGAAGGCACATCCTG
CCCTGTATATCTTTAGGGGAAGAAATTCCACAGCCACACGAAACGGGTCCTTCCACCCTCCTCCCTTCAATCATA
ATAGAAATGCCGAAACGCACTTCAAATGATCAGACATCACGCAAGACCAGTATAAATGATGATACGAACCAGGCG
TATCTGAGTTCGCTATCTTCGCATTCTGATTTACAGTGCAATGCGATAGATACAAGCCCAGGCCATCCTCGACCA
CGCCATTCATCGTTTTCGATGGTATCCCCGCGTACAGCATCAGAACCTCACCAACCACGCTCACAAACAACTCTG
TCGTTGAAGCAGCCCTCAAGAGGAGCAGCCCCAAAACGCAACTTTCCTGCGCATGGTTTGCAGGATAAATATACC
AGCCATCCAAAATACAAATCAGGAGTTAAAATTGTGCACAACAAAGACGAGGAAGCTATGCCAACCTCGGGTTTA
TTGTGGTACCGTGGACCAGTTTACGGTGCTCTTCCTGGACGCACTTTGCGTTCCCACTCGACGACGACGATCAGG
AATAAGGCATGGGTTATTGGAGGGTACGACGACAAGCAAAGCTACCGAGATATCTATTGCCTCGACCTTGGTACG
ACATTCCTAATTTTCTTTTTACGGTTGGACACTAAATTTCACCTAGAAACCCTGCAATGGTCGCATCCGGAGTAT
AAAGGTGACATCCCCCTACCTTGCAGAGGTCACACTGCCACGGCTGTGGATCACAGGATCTTCGTTATTGGTGGA
ATGTCCACTCATGCGACATCAGAACCAATCACTGTTTACGTCTTCGATACCCTTACACTATCCTGGACGCGACCA
CGCATTGCACTAGGAAGCTCACCTGTACAACGTCGAGCCCATTCAGCTGTTTACTGGGACGAAAAAATATGGATA
TTTGGTGGAGGAAATGGATTCACCGCCTTGAATGATGTCTGGTCTTTGGACGTCAGTCCAATAATTAATGGCCGA
AGAACAGTAATATATCGAACAGAACCATCAGCTTTGAAATGGGAGAAGGTTGAAAAGCAAGATAATTCACCCGAT
TCTACCCCATGCGGAAACTGGCCGGATGCCAGGGGTTACCACACTGCGGATGTTGTGGATAATTTCATGTTTATT
ATCGGAGGCGCAGACGGTCAAAACGTCTTAGATTCCATTTGGGTACTTAACCTCGGTGCGCAATGATTTATTTCT
TTCATTCCTCGAAAAACAGCTCTCCTAATCAAGTCTTGTGAATTCTCAAGGCACGAAAGTGTGGTATCATGTAGA
CTGGTTGAAAGGGTCGTCCCTGACTTCACGACTCGCACACTCGTCAACGCGACTTGGTCCATATCTCTTTATATT
TGGGGGAGTAGGTAAGGAATACAACTCTGAACTTCACTTGCTTAACCTTGGTGGGCTCTTTCTTCCTGATTGACC
ATTGATATTTTATGATGATCCTTCAGTGACTCTTCAAGAAGAAAGACGACGTGTATATGGAAAAGCACCCATACC
ACGAGGTTACCATACCACGGTACATGGTAATGGTAGGATACATGTCATTGGTGGCGCGAATGCTACCTATGGCTT
CGACGACGTATGGATTTTGGAACTAGCCTCTCTTGCTTACCTTCCTCAAATCACGGATTTTAAAGTCGAGCCTCT
TGAGGATATCGGATGGTATTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail