© 2022 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | AgabiH97|037500 |
| Gene name | |
| Location | scaffold_13:1031914..1033150 |
| Strand | + |
| Gene length (bp) | 1236 |
| Transcript length (bp) | 645 |
| Coding sequence length (bp) | 645 |
| Protein length (aa) | 215 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|P0DN32|CUPR1_ARTBC | Probable GPI-anchored cupredoxin ARB_05732-1 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05732-1 PE=1 SV=1 | 35 | 129 | 2.0E-09 |
| sp|D4B3I5|A3024_ARTBC | Extracellular serine-rich protein ARB_03024 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_03024 PE=1 SV=1 | 28 | 146 | 3.0E-09 |
| SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
|---|---|---|
| Yes | 1 - 19 | 0.45 |
| Domain # | Start | End | Length |
|---|---|---|---|
| 1 | 4 | 26 | 22 |
Expression values
| Label | Description | Expression (RPKM) | Confidence interval (low) | Confidence interval (high) |
|---|---|---|---|---|
| Casing | Casing mycelium | 265.71 | 154.13 | 377.29 |
| Initials | Initials knots | 141.37 | 83.99 | 198.75 |
| Pileal_Stipeal_center | Stage I stipe center | 192.85 | 111.38 | 274.32 |
| Pileal_Stipeal_shell | Stage I stipe shell | 82.96 | 47.37 | 118.54 |
| DIF_stipe_center | Stage II stipe center | 142.81 | 84.85 | 200.76 |
| DIF_stipe_shell | Stage II stipe shell | 242.73 | 145.36 | 340.10 |
| DIF_stipe_skin | Stage II stipe skin | 213.47 | 128.20 | 298.74 |
| DIF_cap_skin | Stage II cap skin | 170.24 | 101.29 | 239.19 |
| DIF_cap_tissue | Stage II cap tissue | 113.20 | 64.01 | 162.39 |
| DIF_gill_tissue | Stage II gill tissue | 64.13 | 35.53 | 92.72 |
| YFB_stipe_center | Young fruiting body stipe center | 303.50 | 180.28 | 426.72 |
| YFB_stipe_shell | Young fruiting body stipe shell | 399.20 | 236.46 | 561.94 |
| YFB_stipe_skin | Young fruiting body stipe skin | 314.75 | 186.59 | 442.91 |
| YFB_cap_skin | Young fruiting body cap skin | 244.04 | 146.47 | 341.62 |
| YFB_cap_tissue | Young fruiting body cap tissue | 205.27 | 122.54 | 288.00 |
| YFB_gill_tissue | Young fruiting body gill tissue | 227.36 | 132.61 | 322.11 |
| YFB_veil | Young fruiting body veil | 131.27 | 75.62 | 186.93 |
Differential expression
| Label1 | Label2 | Q-value | Significant difference |
|---|---|---|---|
| Casing | DIF_gill_tissue | 0.000613 | yes |
| Casing | YFB_stipe_center | 0.766966 | no |
| Casing | YFB_stipe_shell | 0.170233 | no |
| Casing | YFB_stipe_skin | 0.677959 | no |
| Casing | YFB_cap_skin | 0.861706 | no |
| Casing | YFB_cap_tissue | 0.465106 | no |
| Casing | YFB_gill_tissue | 0.712686 | no |
| Casing | YFB_veil | 0.012274 | yes |
| Casing | Initials | 0.019715 | yes |
| Casing | Pileal_Stipeal_center | 0.341051 | no |
| Casing | Pileal_Stipeal_shell | 0.000613 | yes |
| Casing | DIF_stipe_center | 0.020790 | yes |
| Casing | DIF_stipe_shell | 0.851371 | no |
| Casing | DIF_stipe_skin | 0.547747 | no |
| Casing | DIF_cap_skin | 0.129247 | no |
| Casing | DIF_cap_tissue | 0.001140 | yes |
| DIF_gill_tissue | YFB_stipe_center | 0.000613 | yes |
| DIF_gill_tissue | YFB_stipe_shell | 0.000613 | yes |
| DIF_gill_tissue | YFB_stipe_skin | 0.000613 | yes |
| DIF_gill_tissue | YFB_cap_skin | 0.000613 | yes |
| DIF_gill_tissue | YFB_cap_tissue | 0.000613 | yes |
| DIF_gill_tissue | YFB_gill_tissue | 0.000613 | yes |
| DIF_gill_tissue | YFB_veil | 0.010093 | yes |
| YFB_stipe_center | YFB_stipe_shell | 0.411559 | no |
| YFB_stipe_center | YFB_stipe_skin | 0.947935 | no |
| YFB_stipe_center | YFB_cap_skin | 0.541013 | no |
| YFB_stipe_center | YFB_cap_tissue | 0.191098 | no |
| YFB_stipe_center | YFB_gill_tissue | 0.380066 | no |
| YFB_stipe_center | YFB_veil | 0.000613 | yes |
| YFB_stipe_shell | YFB_stipe_skin | 0.497139 | no |
| YFB_stipe_shell | YFB_cap_skin | 0.068461 | no |
| YFB_stipe_shell | YFB_cap_tissue | 0.008457 | yes |
| YFB_stipe_shell | YFB_gill_tissue | 0.036683 | yes |
| YFB_stipe_shell | YFB_veil | 0.000613 | yes |
| YFB_stipe_skin | YFB_cap_skin | 0.443025 | no |
| YFB_stipe_skin | YFB_cap_tissue | 0.136885 | no |
| YFB_stipe_skin | YFB_gill_tissue | 0.296798 | no |
| YFB_stipe_skin | YFB_veil | 0.000613 | yes |
| YFB_cap_skin | YFB_cap_tissue | 0.660410 | no |
| YFB_cap_skin | YFB_gill_tissue | 0.888070 | no |
| YFB_cap_skin | YFB_veil | 0.022892 | yes |
| YFB_cap_tissue | YFB_gill_tissue | 0.825955 | no |
| YFB_cap_tissue | YFB_veil | 0.130818 | no |
| YFB_gill_tissue | YFB_veil | 0.050706 | no |
| Initials | DIF_gill_tissue | 0.003765 | yes |
| Initials | YFB_stipe_center | 0.000613 | yes |
| Initials | YFB_stipe_shell | 0.000613 | yes |
| Initials | YFB_stipe_skin | 0.001625 | yes |
| Initials | YFB_cap_skin | 0.034604 | yes |
| Initials | YFB_cap_tissue | 0.217423 | no |
| Initials | YFB_gill_tissue | 0.091330 | no |
| Initials | YFB_veil | 0.884211 | no |
| Initials | Pileal_Stipeal_center | 0.346251 | no |
| Initials | Pileal_Stipeal_shell | 0.054375 | no |
| Initials | DIF_stipe_center | 0.985425 | no |
| Initials | DIF_stipe_shell | 0.038278 | yes |
| Initials | DIF_stipe_skin | 0.150844 | no |
| Initials | DIF_cap_skin | 0.632764 | no |
| Initials | DIF_cap_tissue | 0.555043 | no |
| Pileal_Stipeal_center | DIF_gill_tissue | 0.000613 | yes |
| Pileal_Stipeal_center | YFB_stipe_center | 0.121416 | no |
| Pileal_Stipeal_center | YFB_stipe_shell | 0.006387 | yes |
| Pileal_Stipeal_center | YFB_stipe_skin | 0.085898 | no |
| Pileal_Stipeal_center | YFB_cap_skin | 0.505372 | no |
| Pileal_Stipeal_center | YFB_cap_tissue | 0.906022 | no |
| Pileal_Stipeal_center | YFB_gill_tissue | 0.692408 | no |
| Pileal_Stipeal_center | YFB_veil | 0.227705 | no |
| Pileal_Stipeal_center | Pileal_Stipeal_shell | 0.000613 | yes |
| Pileal_Stipeal_center | DIF_stipe_center | 0.374561 | no |
| Pileal_Stipeal_center | DIF_stipe_shell | 0.522943 | no |
| Pileal_Stipeal_center | DIF_stipe_skin | 0.826699 | no |
| Pileal_Stipeal_center | DIF_cap_skin | 0.783520 | no |
| Pileal_Stipeal_center | DIF_cap_tissue | 0.066395 | no |
| Pileal_Stipeal_shell | DIF_gill_tissue | 0.501225 | no |
| Pileal_Stipeal_shell | YFB_stipe_center | 0.000613 | yes |
| Pileal_Stipeal_shell | YFB_stipe_shell | 0.000613 | yes |
| Pileal_Stipeal_shell | YFB_stipe_skin | 0.000613 | yes |
| Pileal_Stipeal_shell | YFB_cap_skin | 0.000613 | yes |
| Pileal_Stipeal_shell | YFB_cap_tissue | 0.000613 | yes |
| Pileal_Stipeal_shell | YFB_gill_tissue | 0.000613 | yes |
| Pileal_Stipeal_shell | YFB_veil | 0.127200 | no |
| Pileal_Stipeal_shell | DIF_stipe_center | 0.051318 | no |
| Pileal_Stipeal_shell | DIF_stipe_shell | 0.000613 | yes |
| Pileal_Stipeal_shell | DIF_stipe_skin | 0.000613 | yes |
| Pileal_Stipeal_shell | DIF_cap_skin | 0.004548 | yes |
| Pileal_Stipeal_shell | DIF_cap_tissue | 0.364167 | no |
| DIF_stipe_center | DIF_gill_tissue | 0.003765 | yes |
| DIF_stipe_center | YFB_stipe_center | 0.001140 | yes |
| DIF_stipe_center | YFB_stipe_shell | 0.000613 | yes |
| DIF_stipe_center | YFB_stipe_skin | 0.001625 | yes |
| DIF_stipe_center | YFB_cap_skin | 0.040058 | yes |
| DIF_stipe_center | YFB_cap_tissue | 0.233752 | no |
| DIF_stipe_center | YFB_gill_tissue | 0.098939 | no |
| DIF_stipe_center | YFB_veil | 0.867462 | no |
| DIF_stipe_center | DIF_stipe_shell | 0.044844 | yes |
| DIF_stipe_center | DIF_stipe_skin | 0.162765 | no |
| DIF_stipe_center | DIF_cap_skin | 0.661865 | no |
| DIF_stipe_center | DIF_cap_tissue | 0.532921 | no |
| DIF_stipe_shell | DIF_gill_tissue | 0.000613 | yes |
| DIF_stipe_shell | YFB_stipe_center | 0.528641 | no |
| DIF_stipe_shell | YFB_stipe_shell | 0.064141 | no |
| DIF_stipe_shell | YFB_stipe_skin | 0.439090 | no |
| DIF_stipe_shell | YFB_cap_skin | 0.991645 | no |
| DIF_stipe_shell | YFB_cap_tissue | 0.673578 | no |
| DIF_stipe_shell | YFB_gill_tissue | 0.897607 | no |
| DIF_stipe_shell | YFB_veil | 0.025711 | yes |
| DIF_stipe_shell | DIF_stipe_skin | 0.758720 | no |
| DIF_stipe_shell | DIF_cap_skin | 0.239857 | no |
| DIF_stipe_shell | DIF_cap_tissue | 0.003765 | yes |
| DIF_stipe_skin | DIF_gill_tissue | 0.000613 | yes |
| DIF_stipe_skin | YFB_stipe_center | 0.238109 | no |
| DIF_stipe_skin | YFB_stipe_shell | 0.013485 | yes |
| DIF_stipe_skin | YFB_stipe_skin | 0.178958 | no |
| DIF_stipe_skin | YFB_cap_skin | 0.744738 | no |
| DIF_stipe_skin | YFB_cap_tissue | 0.941037 | no |
| DIF_stipe_skin | YFB_gill_tissue | 0.901469 | no |
| DIF_stipe_skin | YFB_veil | 0.086914 | no |
| DIF_stipe_skin | DIF_cap_skin | 0.526158 | no |
| DIF_stipe_skin | DIF_cap_tissue | 0.017226 | yes |
| DIF_cap_skin | DIF_gill_tissue | 0.000613 | yes |
| DIF_cap_skin | YFB_stipe_center | 0.026461 | yes |
| DIF_cap_skin | YFB_stipe_shell | 0.001140 | yes |
| DIF_cap_skin | YFB_stipe_skin | 0.015242 | yes |
| DIF_cap_skin | YFB_cap_skin | 0.222588 | no |
| DIF_cap_skin | YFB_cap_tissue | 0.635217 | no |
| DIF_cap_skin | YFB_gill_tissue | 0.378554 | no |
| DIF_cap_skin | YFB_veil | 0.462958 | no |
| DIF_cap_skin | DIF_cap_tissue | 0.184076 | no |
| DIF_cap_tissue | DIF_gill_tissue | 0.051723 | no |
| DIF_cap_tissue | YFB_stipe_center | 0.000613 | yes |
| DIF_cap_tissue | YFB_stipe_shell | 0.000613 | yes |
| DIF_cap_tissue | YFB_stipe_skin | 0.000613 | yes |
| DIF_cap_tissue | YFB_cap_skin | 0.002951 | yes |
| DIF_cap_tissue | YFB_cap_tissue | 0.031088 | yes |
| DIF_cap_tissue | YFB_gill_tissue | 0.007439 | yes |
| DIF_cap_tissue | YFB_veil | 0.739428 | no |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >AgabiH97|037500 MKSAALVALLFGSSYVLAAEYLVGVGKDETTGKKGIGFDPSVIHPLAGDVVTFEFRSGEHSAVQTTFETPCIPLD GGFNSGIFTVADNISVDAPNLPTARLTINDTSPIWFFDQASRQCQQGAVFAINPTLAQTPAQFKDNAAKSPVAPL TSTDPAPSSTESPGTPAQTSGTGEPNGASRLIIHGVGDFSVAGILTILDNVCEGRNGMILAIND* |
| Coding | >AgabiH97|037500 ATGAAATCCGCTGCTCTCGTCGCTCTTTTATTTGGATCTTCCTATGTTCTTGCAGCTGAATATCTTGTCGGGGTT GGAAAGGACGAGACAACTGGCAAGAAAGGCATTGGCTTCGATCCTTCCGTTATTCACCCTTTGGCTGGGGATGTC GTTACATTCGAGTTCAGAAGCGGTGAACATAGTGCTGTTCAAACAACGTTTGAGACGCCATGCATACCGCTCGAT GGAGGATTCAATAGTGGCATATTCACCGTTGCAGATAATATTTCTGTTGATGCCCCGAATCTGCCCACTGCCAGA CTAACAATCAATGACACCAGTCCTATCTGGTTCTTCGACCAAGCATCCAGGCAATGCCAACAAGGAGCGGTATTC GCTATCAACCCGACATTGGCACAAACGCCGGCACAATTCAAAGATAACGCTGCCAAGTCACCTGTCGCTCCTTTA ACTTCGACTGACCCAGCTCCATCTTCAACAGAGAGCCCCGGTACTCCCGCTCAAACTTCTGGAACTGGCGAGCCT AACGGCGCGTCGAGGCTGATTATCCACGGAGTAGGCGATTTTTCTGTGGCTGGTATCCTGACAATCCTTGATAAC GTTTGCGAGGGGCGTAACGGAATGATTTTGGCGATCAATGACTGA |
| Transcript | >AgabiH97|037500 ATGAAATCCGCTGCTCTCGTCGCTCTTTTATTTGGATCTTCCTATGTTCTTGCAGCTGAATATCTTGTCGGGGTT GGAAAGGACGAGACAACTGGCAAGAAAGGCATTGGCTTCGATCCTTCCGTTATTCACCCTTTGGCTGGGGATGTC GTTACATTCGAGTTCAGAAGCGGTGAACATAGTGCTGTTCAAACAACGTTTGAGACGCCATGCATACCGCTCGAT GGAGGATTCAATAGTGGCATATTCACCGTTGCAGATAATATTTCTGTTGATGCCCCGAATCTGCCCACTGCCAGA CTAACAATCAATGACACCAGTCCTATCTGGTTCTTCGACCAAGCATCCAGGCAATGCCAACAAGGAGCGGTATTC GCTATCAACCCGACATTGGCACAAACGCCGGCACAATTCAAAGATAACGCTGCCAAGTCACCTGTCGCTCCTTTA ACTTCGACTGACCCAGCTCCATCTTCAACAGAGAGCCCCGGTACTCCCGCTCAAACTTCTGGAACTGGCGAGCCT AACGGCGCGTCGAGGCTGATTATCCACGGAGTAGGCGATTTTTCTGTGGCTGGTATCCTGACAATCCTTGATAAC GTTTGCGAGGGGCGTAACGGAATGATTTTGGCGATCAATGACTGA |
| Gene | >AgabiH97|037500 ATGAAATCCGCTGCTCTCGTCGCTCTTTTATTTGGATCTTCCTATGTTCTTGCAGCTGAATATCTTGTCGGGGTT GGAAAGGACGAGACAACTGGGTATGTTTGACAAACTCAAATTTAAACTGTGACTGAAACTACCTGCTTCTTTAGC AAGAAAGGCATTGGCTTCGATCCTTCCGTTATTCACCCTTTGGCTGGGGATGTCGTTACATTCGAGTTCAGAAGC GGTGAACATAGTGCTGTTCGTGAGTGCTGGATCTGTTTTTTTCTATTGCTTATGATGTTGCTAAAGGCTGGTTAT ACTTAGAAACAACGTTTGAGACGCCATGCATACCGCTCGATGGAGGATTCAATAGTGGCATATTCACCGTAGGTG GTCAACAGTCTCCAGAATAGAGCAGTTCATAGAATGATGTCACTCTCGGACTAGGTTGCAGATAATATTTCTGTT GATGCCCCGAATCTGCCCACTGCCAGACTAACAATCAATGACACCAGTCCTATCTGGTATGCTGTCCTGATGTTC TGAGCAAAGACTTACTCATTCGTTCTTGGTGTCTGGCAGGTTCTTCGACCAAGCATCCAGGCAATGCCAACAAGG AGCGGTATTCGCTATCAACCCGACATTGGCACAAACGCCGGCACAATTCAAAGATAACGCTGCCAAGTCACCTGT CGCTCCTTTAACTTCGACTGACCCAGCTCCATCTTCAACAGAGAGCCCCGGTACTCCCGCTCAAACTTCTGGAAC TGGCGAGCCTAACGGCGCGTCGAGGCTGATTATCCACGGAGTAGGCGTGGGTCTGACTGGTATGGGATTGAATGC TCTAATTGCATTTCTGCTTTGATTTATAATGGAATGTTATGCCTGAACAATTGCTTGCTAATTTCGACCACGCTC TCTTACCTAGTCATACCCCTACACGCTTTTAGGATTTTTCTGTGGTCCGTGTATAACTCTGGAAATGCATTCACT TACTTTGAGCATTAAAGAAAGGCTGGTATCCTGACAATCCTTGATAACGTTTGCGAGGTCACCGCGAAACAGTGC TTGCCCAGCAACTTGATATATCCGCGTTCACTTAGGGGCTATTGGATACAATATTGGCCTCATTGATGTTGTCGA GTTGATAGGGGCGTAACGGAATGGTAGGTACTGGGTGATCTATGTATTCACCAAAGCGATTTATTAAACACTCAT CGACATCTGTCTCAGATTTTGGCGATCAATGACTGA |