Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|037500
Gene name
Locationscaffold_13:1031914..1033150
Strand+
Gene length (bp)1236
Transcript length (bp)645
Coding sequence length (bp)645
Protein length (aa) 215

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P0DN32|CUPR1_ARTBC Probable GPI-anchored cupredoxin ARB_05732-1 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05732-1 PE=1 SV=1 35 129 2.0E-09
sp|D4B3I5|A3024_ARTBC Extracellular serine-rich protein ARB_03024 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_03024 PE=1 SV=1 28 146 3.0E-09

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

Domain # Start End Length
1 4 26 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|037500
MKSAALVALLFGSSYVLAAEYLVGVGKDETTGKKGIGFDPSVIHPLAGDVVTFEFRSGEHSAVQTTFETPCIPLD
GGFNSGIFTVADNISVDAPNLPTARLTINDTSPIWFFDQASRQCQQGAVFAINPTLAQTPAQFKDNAAKSPVAPL
TSTDPAPSSTESPGTPAQTSGTGEPNGASRLIIHGVGDFSVAGILTILDNVCEGRNGMILAIND*
Coding >AgabiH97|037500
ATGAAATCCGCTGCTCTCGTCGCTCTTTTATTTGGATCTTCCTATGTTCTTGCAGCTGAATATCTTGTCGGGGTT
GGAAAGGACGAGACAACTGGCAAGAAAGGCATTGGCTTCGATCCTTCCGTTATTCACCCTTTGGCTGGGGATGTC
GTTACATTCGAGTTCAGAAGCGGTGAACATAGTGCTGTTCAAACAACGTTTGAGACGCCATGCATACCGCTCGAT
GGAGGATTCAATAGTGGCATATTCACCGTTGCAGATAATATTTCTGTTGATGCCCCGAATCTGCCCACTGCCAGA
CTAACAATCAATGACACCAGTCCTATCTGGTTCTTCGACCAAGCATCCAGGCAATGCCAACAAGGAGCGGTATTC
GCTATCAACCCGACATTGGCACAAACGCCGGCACAATTCAAAGATAACGCTGCCAAGTCACCTGTCGCTCCTTTA
ACTTCGACTGACCCAGCTCCATCTTCAACAGAGAGCCCCGGTACTCCCGCTCAAACTTCTGGAACTGGCGAGCCT
AACGGCGCGTCGAGGCTGATTATCCACGGAGTAGGCGATTTTTCTGTGGCTGGTATCCTGACAATCCTTGATAAC
GTTTGCGAGGGGCGTAACGGAATGATTTTGGCGATCAATGACTGA
Transcript >AgabiH97|037500
ATGAAATCCGCTGCTCTCGTCGCTCTTTTATTTGGATCTTCCTATGTTCTTGCAGCTGAATATCTTGTCGGGGTT
GGAAAGGACGAGACAACTGGCAAGAAAGGCATTGGCTTCGATCCTTCCGTTATTCACCCTTTGGCTGGGGATGTC
GTTACATTCGAGTTCAGAAGCGGTGAACATAGTGCTGTTCAAACAACGTTTGAGACGCCATGCATACCGCTCGAT
GGAGGATTCAATAGTGGCATATTCACCGTTGCAGATAATATTTCTGTTGATGCCCCGAATCTGCCCACTGCCAGA
CTAACAATCAATGACACCAGTCCTATCTGGTTCTTCGACCAAGCATCCAGGCAATGCCAACAAGGAGCGGTATTC
GCTATCAACCCGACATTGGCACAAACGCCGGCACAATTCAAAGATAACGCTGCCAAGTCACCTGTCGCTCCTTTA
ACTTCGACTGACCCAGCTCCATCTTCAACAGAGAGCCCCGGTACTCCCGCTCAAACTTCTGGAACTGGCGAGCCT
AACGGCGCGTCGAGGCTGATTATCCACGGAGTAGGCGATTTTTCTGTGGCTGGTATCCTGACAATCCTTGATAAC
GTTTGCGAGGGGCGTAACGGAATGATTTTGGCGATCAATGACTGA
Gene >AgabiH97|037500
ATGAAATCCGCTGCTCTCGTCGCTCTTTTATTTGGATCTTCCTATGTTCTTGCAGCTGAATATCTTGTCGGGGTT
GGAAAGGACGAGACAACTGGGTATGTTTGACAAACTCAAATTTAAACTGTGACTGAAACTACCTGCTTCTTTAGC
AAGAAAGGCATTGGCTTCGATCCTTCCGTTATTCACCCTTTGGCTGGGGATGTCGTTACATTCGAGTTCAGAAGC
GGTGAACATAGTGCTGTTCGTGAGTGCTGGATCTGTTTTTTTCTATTGCTTATGATGTTGCTAAAGGCTGGTTAT
ACTTAGAAACAACGTTTGAGACGCCATGCATACCGCTCGATGGAGGATTCAATAGTGGCATATTCACCGTAGGTG
GTCAACAGTCTCCAGAATAGAGCAGTTCATAGAATGATGTCACTCTCGGACTAGGTTGCAGATAATATTTCTGTT
GATGCCCCGAATCTGCCCACTGCCAGACTAACAATCAATGACACCAGTCCTATCTGGTATGCTGTCCTGATGTTC
TGAGCAAAGACTTACTCATTCGTTCTTGGTGTCTGGCAGGTTCTTCGACCAAGCATCCAGGCAATGCCAACAAGG
AGCGGTATTCGCTATCAACCCGACATTGGCACAAACGCCGGCACAATTCAAAGATAACGCTGCCAAGTCACCTGT
CGCTCCTTTAACTTCGACTGACCCAGCTCCATCTTCAACAGAGAGCCCCGGTACTCCCGCTCAAACTTCTGGAAC
TGGCGAGCCTAACGGCGCGTCGAGGCTGATTATCCACGGAGTAGGCGTGGGTCTGACTGGTATGGGATTGAATGC
TCTAATTGCATTTCTGCTTTGATTTATAATGGAATGTTATGCCTGAACAATTGCTTGCTAATTTCGACCACGCTC
TCTTACCTAGTCATACCCCTACACGCTTTTAGGATTTTTCTGTGGTCCGTGTATAACTCTGGAAATGCATTCACT
TACTTTGAGCATTAAAGAAAGGCTGGTATCCTGACAATCCTTGATAACGTTTGCGAGGTCACCGCGAAACAGTGC
TTGCCCAGCAACTTGATATATCCGCGTTCACTTAGGGGCTATTGGATACAATATTGGCCTCATTGATGTTGTCGA
GTTGATAGGGGCGTAACGGAATGGTAGGTACTGGGTGATCTATGTATTCACCAAAGCGATTTATTAAACACTCAT
CGACATCTGTCTCAGATTTTGGCGATCAATGACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail