Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|037310
Gene name
Locationscaffold_13:981478..982315
Strand-
Gene length (bp)837
Transcript length (bp)291
Coding sequence length (bp)291
Protein length (aa) 97

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|037310
MFEVIALLVDTVLMGFSDVSPMANLQADVHQTVVPVYSLTRRYRLYRRTYYPKSHKHRRPGSWVLCIVNNQLIGT
LNTIVAINVQVTHYKYKTFLL*
Coding >AgabiH97|037310
ATGTTCGAAGTCATTGCTTTACTCGTGGATACTGTTCTGATGGGTTTTTCAGATGTATCGCCTATGGCAAACTTG
CAGGCGGATGTCCATCAAACAGTGGTTCCCGTTTATTCTCTGACTCGGCGGTATCGCTTGTACCGCCGCACATAT
TATCCTAAGAGTCATAAACATCGACGACCTGGATCATGGGTCTTATGCATTGTCAACAATCAATTGATTGGGACC
CTCAACACAATTGTGGCAATCAACGTTCAAGTTACGCACTACAAGTACAAGACCTTTTTACTATAA
Transcript >AgabiH97|037310
ATGTTCGAAGTCATTGCTTTACTCGTGGATACTGTTCTGATGGGTTTTTCAGATGTATCGCCTATGGCAAACTTG
CAGGCGGATGTCCATCAAACAGTGGTTCCCGTTTATTCTCTGACTCGGCGGTATCGCTTGTACCGCCGCACATAT
TATCCTAAGAGTCATAAACATCGACGACCTGGATCATGGGTCTTATGCATTGTCAACAATCAATTGATTGGGACC
CTCAACACAATTGTGGCAATCAACGTTCAAGTTACGCACTACAAGTACAAGACCTTTTTACTATAA
Gene >AgabiH97|037310
ATGTTCGAAGTCATTGCTTTACTCGTGGATACTGTTCTGGTAAGTCCATCCCCAAGAATGCAAAGAATGATAACT
CAGCTTTTCAGATGGGTTTTTCAGATGTATCGCCTATGGCAAACTTGCAGGCGGATGTCCATCAAACAGTGGTTC
CCGTTTATTCTCTGACTCGGCGGTATCGCTTGTACCGCCGCACATATTATCCTAAGAGTCATAAACATCGACGAC
CTGGATCATGGGTCTTATGCATTGTCAACAATCAATGTGAACGTCGGGCCTGGAATTGTGATGGTTTTGTTTCTA
GCTTGGACCATGGTGCTGAACGCCGCGGCATCGTTAAAAGCGAGTGACAAATTACGAAGGCACTTTTCCTTGCGT
CAGGACTCTTGATATGGTTTGGAAGACTTTACAACTCCGTGCAGTGCACCGAGGCAACTCCCACTTCTCATGCCT
TTTCTCATAGAATTTGGTGTTTTGAATCTCTCTATATGCATCACGCACTTCGCGGTCTATATTTGGCTATAACCG
CTTCGCCATCCACACAGTGATTGGGACCCTCGTGAGTCTTTGCAAGATTCCTTTTTAGAGGCCAAGGACTGAATT
TGGCATTCTTGTAGAACACAATTGTGGTTGGCATTGCGCGCAACCTTAGTATCATTCGCATCGGGAAGAATAGAT
AAGAAGAGGATGATTATAGCCCCATTAATTTCCCTGCAAAAGCCAGACTGTTGACGAGAGGTAGGCAATCAACGT
TAGGCGCACTGTATTCCCACCATGTACTGTACTGAGACGGCACAGGTTCAAGTTACGCACTACAAGTACAAGACC
TTTTTACTATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail