Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|037140
Gene name
Locationscaffold_13:948441..950896
Strand+
Gene length (bp)2455
Transcript length (bp)2028
Coding sequence length (bp)2028
Protein length (aa) 676

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00012 HSP70 Hsp70 protein 1.6E-261 50 655
PF06723 MreB_Mbl MreB/Mbl protein 4.1E-17 181 416

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P83616|GRP78_ASPNG 78 kDa glucose-regulated protein homolog OS=Aspergillus niger GN=bipA PE=2 SV=1 5 675 0.0E+00
sp|P83617|GRP78_ASPKA 78 kDa glucose-regulated protein homolog OS=Aspergillus kawachii GN=bipA PE=3 SV=1 5 675 0.0E+00
sp|P59769|GRP78_ASPAW 78 kDa glucose-regulated protein homolog OS=Aspergillus awamori GN=bipA PE=2 SV=1 5 675 0.0E+00
sp|P78695|GRP78_NEUCR 78 kDa glucose-regulated protein homolog OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=grp78 PE=3 SV=3 10 668 0.0E+00
sp|Q99170|GRP78_YARLI 78 kDa glucose-regulated protein homolog OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=KAR2 PE=3 SV=1 17 674 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P83616|GRP78_ASPNG 78 kDa glucose-regulated protein homolog OS=Aspergillus niger GN=bipA PE=2 SV=1 5 675 0.0E+00
sp|P83617|GRP78_ASPKA 78 kDa glucose-regulated protein homolog OS=Aspergillus kawachii GN=bipA PE=3 SV=1 5 675 0.0E+00
sp|P59769|GRP78_ASPAW 78 kDa glucose-regulated protein homolog OS=Aspergillus awamori GN=bipA PE=2 SV=1 5 675 0.0E+00
sp|P78695|GRP78_NEUCR 78 kDa glucose-regulated protein homolog OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=grp78 PE=3 SV=3 10 668 0.0E+00
sp|Q99170|GRP78_YARLI 78 kDa glucose-regulated protein homolog OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=KAR2 PE=3 SV=1 17 674 0.0E+00
sp|P19208|HSP7C_CAEBR Heat shock 70 kDa protein C OS=Caenorhabditis briggsae GN=hsp-3 PE=3 SV=2 17 675 0.0E+00
sp|P16474|GRP78_YEAST 78 kDa glucose-regulated protein homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KAR2 PE=1 SV=1 10 675 0.0E+00
sp|P36604|GRP78_SCHPO 78 kDa glucose-regulated protein homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bip1 PE=3 SV=2 10 654 0.0E+00
sp|Q90593|GRP78_CHICK 78 kDa glucose-regulated protein OS=Gallus gallus GN=HSPA5 PE=1 SV=1 38 667 0.0E+00
sp|P27420|HSP7C_CAEEL Heat shock 70 kDa protein C OS=Caenorhabditis elegans GN=hsp-3 PE=3 SV=2 17 675 0.0E+00
sp|P20029|GRP78_MOUSE 78 kDa glucose-regulated protein OS=Mus musculus GN=Hspa5 PE=1 SV=3 38 675 0.0E+00
sp|Q6FW50|GRP78_CANGA 78 kDa glucose-regulated protein homolog OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=KAR2 PE=3 SV=1 23 662 0.0E+00
sp|P07823|GRP78_MESAU 78 kDa glucose-regulated protein OS=Mesocricetus auratus GN=HSPA5 PE=1 SV=1 36 675 0.0E+00
sp|Q0VCX2|GRP78_BOVIN 78 kDa glucose-regulated protein OS=Bos taurus GN=HSPA5 PE=2 SV=1 38 675 0.0E+00
sp|P06761|GRP78_RAT 78 kDa glucose-regulated protein OS=Rattus norvegicus GN=Hspa5 PE=1 SV=1 38 675 0.0E+00
sp|P11021|GRP78_HUMAN 78 kDa glucose-regulated protein OS=Homo sapiens GN=HSPA5 PE=1 SV=2 41 667 0.0E+00
sp|Q91883|GRP78_XENLA 78 kDa glucose-regulated protein OS=Xenopus laevis GN=hspa5 PE=2 SV=1 25 662 0.0E+00
sp|Q3S4T7|GRP78_ICTTR 78 kDa glucose-regulated protein OS=Ictidomys tridecemlineatus GN=HSPA5 PE=2 SV=1 41 675 0.0E+00
sp|Q5R4P0|GRP78_PONAB 78 kDa glucose-regulated protein OS=Pongo abelii GN=HSPA5 PE=2 SV=1 41 667 0.0E+00
sp|Q6BZH1|GRP78_DEBHA 78 kDa glucose-regulated protein homolog OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=KAR2 PE=3 SV=1 10 675 0.0E+00
sp|Q75C78|GRP78_ASHGO 78 kDa glucose-regulated protein homolog OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=KAR2 PE=3 SV=1 24 675 0.0E+00
sp|Q42434|BIP_SPIOL Luminal-binding protein OS=Spinacia oleracea GN=HSC70 PE=2 SV=1 12 675 0.0E+00
sp|Q9HG01|GRP78_PICAN 78 kDa glucose-regulated protein homolog OS=Pichia angusta GN=BiP PE=3 SV=1 42 656 0.0E+00
sp|Q16956|GRP78_APLCA 78 kDa glucose-regulated protein OS=Aplysia californica PE=1 SV=1 20 664 0.0E+00
sp|Q03684|BIP4_TOBAC Luminal-binding protein 4 OS=Nicotiana tabacum GN=BIP4 PE=2 SV=1 21 675 0.0E+00
sp|P49118|BIP_SOLLC Luminal-binding protein OS=Solanum lycopersicum PE=2 SV=1 17 675 0.0E+00
sp|Q24895|GRP78_ECHMU 78 kDa glucose-regulated protein OS=Echinococcus multilocularis GN=GRP78 PE=2 SV=1 30 658 0.0E+00
sp|P22010|GRP78_KLULA 78 kDa glucose-regulated protein homolog OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=GRP78 PE=3 SV=1 16 659 0.0E+00
sp|Q24798|GRP78_ECHGR 78 kDa glucose-regulated protein OS=Echinococcus granulosus GN=GRP78 PE=2 SV=1 17 663 0.0E+00
sp|Q9LKR3|MD37A_ARATH Mediator of RNA polymerase II transcription subunit 37a OS=Arabidopsis thaliana GN=MED37A PE=1 SV=1 21 655 0.0E+00
sp|Q03685|BIP5_TOBAC Luminal-binding protein 5 OS=Nicotiana tabacum GN=BIP5 PE=2 SV=1 18 675 0.0E+00
sp|P29844|HSP7C_DROME Heat shock 70 kDa protein cognate 3 OS=Drosophila melanogaster GN=Hsc70-3 PE=2 SV=2 20 675 0.0E+00
sp|Q39043|MD37F_ARATH Mediator of RNA polymerase II transcription subunit 37f OS=Arabidopsis thaliana GN=MED37F PE=1 SV=2 21 675 0.0E+00
sp|P20163|HSP7D_CAEEL Heat shock 70 kDa protein D OS=Caenorhabditis elegans GN=hsp-4 PE=1 SV=2 17 675 0.0E+00
sp|O24581|BIP3_MAIZE Luminal-binding protein 3 OS=Zea mays GN=BIPE3 PE=2 SV=1 21 655 0.0E+00
sp|P24067|BIP2_MAIZE Luminal-binding protein 2 OS=Zea mays GN=BIPE2 PE=1 SV=3 21 655 0.0E+00
sp|Q8H1B3|MD37B_ARATH Probable mediator of RNA polymerase II transcription subunit 37b OS=Arabidopsis thaliana GN=MED37B PE=1 SV=1 9 655 0.0E+00
sp|O59855|HSP72_SCHPO Probable heat shock protein ssa2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ssa2 PE=1 SV=3 51 655 0.0E+00
sp|P26413|HSP70_SOYBN Heat shock 70 kDa protein OS=Glycine max GN=HSP70 PE=3 SV=1 48 665 0.0E+00
sp|Q10265|HSP71_SCHPO Probable heat shock protein ssa1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ssa1 PE=1 SV=2 51 655 0.0E+00
sp|Q9LHA8|MD37C_ARATH Probable mediator of RNA polymerase II transcription subunit 37c OS=Arabidopsis thaliana GN=MED37C PE=1 SV=1 48 667 0.0E+00
sp|Q96W30|HSP72_PARBA Heat shock 70 kDa protein 2 OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=HSP70-2 PE=2 SV=2 51 654 0.0E+00
sp|A5A8V7|HS71L_PIG Heat shock 70 kDa protein 1-like OS=Sus scrofa GN=HSPA1L PE=2 SV=1 48 663 0.0E+00
sp|Q8T869|BIP2_DICDI Luminal-binding protein 2 OS=Dictyostelium discoideum GN=bip2 PE=1 SV=1 46 675 0.0E+00
sp|Q4R888|HS71L_MACFA Heat shock 70 kDa protein 1-like OS=Macaca fascicularis GN=HSPA1L PE=2 SV=1 48 663 0.0E+00
sp|Q01233|HSP70_NEUCR Heat shock 70 kDa protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=hsps-1 PE=2 SV=2 51 654 0.0E+00
sp|P0CB32|HS71L_BOVIN Heat shock 70 kDa protein 1-like OS=Bos taurus GN=HSPA1L PE=3 SV=1 48 663 0.0E+00
sp|Q9S9N1|HSP7E_ARATH Heat shock 70 kDa protein 5 OS=Arabidopsis thaliana GN=HSP70-5 PE=2 SV=1 51 668 0.0E+00
sp|P08418|HSP70_SCHMA Heat shock 70 kDa protein homolog OS=Schistosoma mansoni PE=2 SV=2 49 661 0.0E+00
sp|P55063|HS71L_RAT Heat shock 70 kDa protein 1-like OS=Rattus norvegicus GN=Hspa1l PE=2 SV=2 48 663 0.0E+00
sp|P34931|HS71L_HUMAN Heat shock 70 kDa protein 1-like OS=Homo sapiens GN=HSPA1L PE=1 SV=2 48 663 0.0E+00
sp|P09189|HSP7C_PETHY Heat shock cognate 70 kDa protein OS=Petunia hybrida GN=HSP70 PE=2 SV=1 48 667 0.0E+00
sp|P16627|HS71L_MOUSE Heat shock 70 kDa protein 1-like OS=Mus musculus GN=Hspa1l PE=1 SV=4 48 663 0.0E+00
sp|Q5NVM9|HSP7C_PONAB Heat shock cognate 71 kDa protein OS=Pongo abelii GN=HSPA8 PE=2 SV=2 48 655 0.0E+00
sp|Q01877|HSP71_PUCGR Heat shock protein HSS1 OS=Puccinia graminis GN=HSS1 PE=3 SV=1 51 654 0.0E+00
sp|Q71U34|HSP7C_SAGOE Heat shock cognate 71 kDa protein OS=Saguinus oedipus GN=HSPA8 PE=2 SV=1 48 655 0.0E+00
sp|P63018|HSP7C_RAT Heat shock cognate 71 kDa protein OS=Rattus norvegicus GN=Hspa8 PE=1 SV=1 48 655 0.0E+00
sp|P63017|HSP7C_MOUSE Heat shock cognate 71 kDa protein OS=Mus musculus GN=Hspa8 PE=1 SV=1 48 655 0.0E+00
sp|P11142|HSP7C_HUMAN Heat shock cognate 71 kDa protein OS=Homo sapiens GN=HSPA8 PE=1 SV=1 48 655 0.0E+00
sp|A2Q0Z1|HSP7C_HORSE Heat shock cognate 71 kDa protein OS=Equus caballus GN=HSPA8 PE=2 SV=1 48 655 0.0E+00
sp|P19120|HSP7C_BOVIN Heat shock cognate 71 kDa protein OS=Bos taurus GN=HSPA8 PE=1 SV=2 48 655 0.0E+00
sp|P27322|HSP72_SOLLC Heat shock cognate 70 kDa protein 2 OS=Solanum lycopersicum GN=HSC-2 PE=2 SV=1 48 660 0.0E+00
sp|P22953|MD37E_ARATH Probable mediator of RNA polymerase II transcription subunit 37e OS=Arabidopsis thaliana GN=MED37E PE=1 SV=3 48 655 0.0E+00
sp|Q91233|HSP70_ONCTS Heat shock 70 kDa protein OS=Oncorhynchus tshawytscha GN=hsp70 PE=2 SV=1 48 665 0.0E+00
sp|P19378|HSP7C_CRIGR Heat shock cognate 71 kDa protein OS=Cricetulus griseus GN=HSPA8 PE=2 SV=1 48 655 0.0E+00
sp|O93866|HSP70_TRIRU Heat shock 70 kDa protein OS=Trichophyton rubrum GN=HSP70 PE=2 SV=1 51 654 0.0E+00
sp|P10591|HSP71_YEAST Heat shock protein SSA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSA1 PE=1 SV=4 51 655 0.0E+00
sp|Q9I8F9|HSP71_ORYLA Heat shock 70 kDa protein 1 OS=Oryzias latipes PE=3 SV=1 51 664 0.0E+00
sp|Q27965|HS71B_BOVIN Heat shock 70 kDa protein 1B OS=Bos taurus GN=HSPA1B PE=2 SV=1 49 654 0.0E+00
sp|Q27975|HS71A_BOVIN Heat shock 70 kDa protein 1A OS=Bos taurus GN=HSPA1A PE=1 SV=2 51 654 0.0E+00
sp|P02827|HSP70_XENLA Heat shock 70 kDa protein OS=Xenopus laevis PE=2 SV=1 48 655 0.0E+00
sp|Q4U0F3|HS71B_BOSMU Heat shock 70 kDa protein 1B OS=Bos mutus grunniens GN=HSPA1B PE=2 SV=1 49 654 0.0E+00
sp|Q9U639|HSP7D_MANSE Heat shock 70 kDa protein cognate 4 OS=Manduca sexta PE=2 SV=1 51 655 0.0E+00
sp|P41753|HSP70_ACHKL Heat shock 70 kDa protein OS=Achlya klebsiana GN=HSP70 PE=2 SV=1 48 654 0.0E+00
sp|P24629|HSP71_SOLLC Heat shock cognate 70 kDa protein 1 OS=Solanum lycopersicum GN=HSC-I PE=2 SV=1 48 667 0.0E+00
sp|P18694|HSP72_USTMA Heat shock 70 kDa protein 2 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UMS2 PE=3 SV=2 51 654 0.0E+00
sp|Q5R7D3|HSP71_PONAB Heat shock 70 kDa protein 1 OS=Pongo abelii GN=HSPA1 PE=2 SV=1 48 654 0.0E+00
sp|P0DMV9|HS71B_HUMAN Heat shock 70 kDa protein 1B OS=Homo sapiens GN=HSPA1B PE=1 SV=1 48 654 0.0E+00
sp|P0DMV8|HS71A_HUMAN Heat shock 70 kDa protein 1A OS=Homo sapiens GN=HSPA1A PE=1 SV=1 48 654 0.0E+00
sp|P10592|HSP72_YEAST Heat shock protein SSA2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSA2 PE=1 SV=3 51 659 0.0E+00
sp|Q7YQC6|HSP71_CANLF Heat shock 70 kDa protein 1 OS=Canis lupus familiaris GN=HSPA1 PE=2 SV=1 49 654 0.0E+00
sp|Q6S4N2|HS71B_PIG Heat shock 70 kDa protein 1B OS=Sus scrofa GN=HSPA1B PE=2 SV=1 51 654 0.0E+00
sp|P36415|HS7C1_DICDI Heat shock cognate 70 kDa protein 1 OS=Dictyostelium discoideum GN=hspB PE=1 SV=2 49 655 0.0E+00
sp|P22202|HSP74_YEAST Heat shock protein SSA4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSA4 PE=1 SV=3 51 654 0.0E+00
sp|O73885|HSP7C_CHICK Heat shock cognate 71 kDa protein OS=Gallus gallus GN=HSPA8 PE=1 SV=1 48 655 0.0E+00
sp|P0DMW1|HS71B_RAT Heat shock 70 kDa protein 1B OS=Rattus norvegicus GN=Hspa1a PE=2 SV=1 49 654 0.0E+00
sp|P0DMW0|HS71A_RAT Heat shock 70 kDa protein 1A OS=Rattus norvegicus GN=Hspa1a PE=2 SV=1 49 654 0.0E+00
sp|P09435|HSP73_YEAST Heat shock protein SSA3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSA3 PE=1 SV=3 51 654 0.0E+00
sp|P08106|HSP70_CHICK Heat shock 70 kDa protein OS=Gallus gallus PE=1 SV=1 48 655 0.0E+00
sp|O65719|HSP7C_ARATH Heat shock 70 kDa protein 3 OS=Arabidopsis thaliana GN=HSP70-3 PE=1 SV=1 48 655 0.0E+00
sp|P54652|HSP72_HUMAN Heat shock-related 70 kDa protein 2 OS=Homo sapiens GN=HSPA2 PE=1 SV=1 48 655 0.0E+00
sp|P08108|HSP70_ONCMY Heat shock cognate 70 kDa protein OS=Oncorhynchus mykiss GN=hsc71 PE=2 SV=2 48 655 0.0E+00
sp|Q9TUG3|HSP72_CAPHI Heat shock-related 70 kDa protein 2 OS=Capra hircus GN=HSPA2 PE=3 SV=1 48 655 0.0E+00
sp|Q5B2V1|HSP70_EMENI Heat shock 70 kDa protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=hsp70 PE=1 SV=1 51 651 0.0E+00
sp|Q05746|HSP70_PLACB Heat shock 70 kDa protein OS=Plasmodium cynomolgi (strain Berok) PE=2 SV=1 45 655 0.0E+00
sp|P17879|HS71B_MOUSE Heat shock 70 kDa protein 1B OS=Mus musculus GN=Hspa1b PE=1 SV=3 49 654 0.0E+00
sp|Q61696|HS71A_MOUSE Heat shock 70 kDa protein 1A OS=Mus musculus GN=Hspa1a PE=1 SV=2 49 654 0.0E+00
sp|P14659|HSP72_RAT Heat shock-related 70 kDa protein 2 OS=Rattus norvegicus GN=Hspa2 PE=1 SV=2 48 655 0.0E+00
sp|P17156|HSP72_MOUSE Heat shock-related 70 kDa protein 2 OS=Mus musculus GN=Hspa2 PE=1 SV=2 48 655 0.0E+00
sp|P34930|HS71A_PIG Heat shock 70 kDa protein 1A OS=Sus scrofa GN=HSPA1A PE=3 SV=1 51 655 0.0E+00
sp|P22954|MD37D_ARATH Probable mediator of RNA polymerase II transcription subunit 37c OS=Arabidopsis thaliana GN=MED37D PE=1 SV=2 48 655 0.0E+00
sp|P34933|HSP72_BOVIN Heat shock-related 70 kDa protein 2 OS=Bos taurus GN=HSPA2 PE=2 SV=2 48 655 0.0E+00
sp|P11144|HSP70_PLAFA Heat shock 70 kDa protein OS=Plasmodium falciparum PE=2 SV=2 45 655 0.0E+00
sp|Q05866|GRP78_PLAFO 78 kDa glucose-regulated protein homolog OS=Plasmodium falciparum (isolate NF54) PE=3 SV=1 48 675 0.0E+00
sp|Q90473|HSP7C_DANRE Heat shock cognate 71 kDa protein OS=Danio rerio GN=hspa8 PE=2 SV=1 48 657 0.0E+00
sp|P11143|HSP70_MAIZE Heat shock 70 kDa protein OS=Zea mays GN=HSP70 PE=3 SV=2 48 656 0.0E+00
sp|P11147|HSP7D_DROME Heat shock 70 kDa protein cognate 4 OS=Drosophila melanogaster GN=Hsc70-4 PE=1 SV=3 51 655 0.0E+00
sp|P53421|HSP71_PICAN Heat shock protein 70 1 OS=Pichia angusta GN=HSA1 PE=1 SV=2 51 654 0.0E+00
sp|P09446|HSP7A_CAEEL Heat shock 70 kDa protein A OS=Caenorhabditis elegans GN=hsp-1 PE=1 SV=2 49 655 0.0E+00
sp|P46587|HSP72_CANAL Heat shock protein SSA2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SSA2 PE=1 SV=3 51 659 0.0E+00
sp|Q05944|HSP70_HYDVU Heat shock 70 kDa protein OS=Hydra vulgaris GN=HSP70.1 PE=3 SV=1 51 656 0.0E+00
sp|P40918|HSP70_DAVTA Heat shock 70 kDa protein OS=Davidiella tassiana GN=HSP70 PE=1 SV=1 51 664 0.0E+00
sp|P41827|HSP74_ANOAL Heat shock protein 70 B2 OS=Anopheles albimanus GN=HSP70B2 PE=3 SV=1 49 663 0.0E+00
sp|P41797|HSP71_CANAL Heat shock protein SSA1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SSA1 PE=1 SV=2 51 651 0.0E+00
sp|P29843|HSP7A_DROME Heat shock 70 kDa protein cognate 1 OS=Drosophila melanogaster GN=Hsc70-1 PE=1 SV=1 51 662 0.0E+00
sp|P47773|HSP7C_ICTPU Heat shock cognate 71 kDa protein OS=Ictalurus punctatus GN=hsc70 PE=2 SV=1 48 655 0.0E+00
sp|P17066|HSP76_HUMAN Heat shock 70 kDa protein 6 OS=Homo sapiens GN=HSPA6 PE=1 SV=2 51 654 0.0E+00
sp|Q04967|HSP76_PIG Heat shock 70 kDa protein 6 OS=Sus scrofa GN=HSPA6 PE=2 SV=1 51 663 0.0E+00
sp|P27541|HSP70_BRUMA Heat shock 70 kDa protein OS=Brugia malayi GN=HSP70 PE=3 SV=1 49 655 0.0E+00
sp|Q07437|HSP70_LEIAM Heat shock 70 kDa protein OS=Leishmania amazonensis GN=HSP70 PE=2 SV=1 47 655 0.0E+00
sp|P41825|HSP71_ANOAL Heat shock protein 70 A1 OS=Anopheles albimanus GN=HSP70A1 PE=3 SV=1 49 662 0.0E+00
sp|P48720|HSP70_BLAEM Heat shock 70 kDa protein OS=Blastocladiella emersonii GN=HSP70 PE=3 SV=1 51 654 0.0E+00
sp|Q00043|HSP70_AJECA Heat shock 70 kDa protein OS=Ajellomyces capsulatus GN=HSP70 PE=3 SV=1 51 656 0.0E+00
sp|P41826|HSP72_ANOAL Heat shock protein 70 A2 OS=Anopheles albimanus GN=HSP70A2 PE=3 SV=1 49 662 0.0E+00
sp|P29357|HSP7E_SPIOL Chloroplast envelope membrane 70 kDa heat shock-related protein OS=Spinacia oleracea GN=SCE70 PE=1 SV=3 48 657 0.0E+00
sp|P17804|HSP70_LEIDO Heat shock 70 kDa protein OS=Leishmania donovani GN=HSP70 PE=3 SV=1 47 655 0.0E+00
sp|Q9N1U2|HSP76_SAGOE Heat shock 70 kDa protein 6 OS=Saguinus oedipus GN=HSPA6 PE=2 SV=1 51 654 0.0E+00
sp|Q54BE0|HS7C3_DICDI Heat shock cognate 70 kDa protein 3 OS=Dictyostelium discoideum GN=DDB_G0293674 PE=3 SV=1 51 663 0.0E+00
sp|Q9BIR7|HSP75_DROME Major heat shock 70 kDa protein Bc OS=Drosophila melanogaster GN=Hsp70Bc PE=2 SV=2 51 655 0.0E+00
sp|Q9BIS2|HSP73_DROME Major heat shock 70 kDa protein Bb OS=Drosophila melanogaster GN=Hsp70Bb PE=2 SV=2 51 655 0.0E+00
sp|Q8INI8|HSP72_DROME Major heat shock 70 kDa protein Ba OS=Drosophila melanogaster GN=Hsp70Ba PE=2 SV=2 51 655 0.0E+00
sp|P53623|HSP72_PICAN Heat shock protein 70 2 OS=Pichia angusta GN=HSA2 PE=3 SV=2 51 654 0.0E+00
sp|Q9GSU4|HSP72_DROSI Major heat shock 70 kDa protein Ba OS=Drosophila simulans GN=Hsp70Ba PE=3 SV=2 51 655 0.0E+00
sp|P87047|HSP71_PARBA Heat shock 70 kDa protein 1 OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=HSP70-1 PE=1 SV=1 51 654 0.0E+00
sp|P37899|HSP70_PYRSA Heat shock 70 kDa protein OS=Pyrenomonas salina GN=HSP70 PE=3 SV=1 48 655 0.0E+00
sp|P02825|HSP71_DROME Major heat shock 70 kDa protein Ab OS=Drosophila melanogaster GN=Hsp70Ab PE=2 SV=3 51 655 0.0E+00
sp|P82910|HSP70_DROME Major heat shock 70 kDa protein Aa OS=Drosophila melanogaster GN=Hsp70Aa PE=2 SV=2 51 655 0.0E+00
sp|Q24789|HSP70_ECHGR Heat shock cognate 70 kDa protein OS=Echinococcus granulosus GN=HSP70 PE=2 SV=1 48 657 0.0E+00
sp|Q557E0|HS7C2_DICDI Heat shock cognate 70 kDa protein 2 OS=Dictyostelium discoideum GN=hspE-1 PE=1 SV=1 49 662 0.0E+00
sp|Q27031|HSP70_THEPA Heat shock 70 kDa protein OS=Theileria parva GN=TP02_0148 PE=2 SV=2 48 665 0.0E+00
sp|Q9VG58|HSP74_DROME Major heat shock 70 kDa protein Bbb OS=Drosophila melanogaster GN=Hsp70Bbb PE=3 SV=2 51 655 0.0E+00
sp|P11145|HSP74_TRYBB Heat shock 70 kDa protein 4 OS=Trypanosoma brucei brucei PE=2 SV=2 47 655 0.0E+00
sp|Q06248|HSP74_PARLI Heat shock 70 kDa protein IV OS=Paracentrotus lividus GN=HSP70IV PE=3 SV=1 46 654 0.0E+00
sp|O97125|HSP68_DROME Heat shock protein 68 OS=Drosophila melanogaster GN=Hsp68 PE=1 SV=1 51 658 0.0E+00
sp|Q9GSU7|HSP71_DROSI Major heat shock 70 kDa protein Ab OS=Drosophila simulans GN=Hsp70Ab PE=3 SV=2 51 655 0.0E+00
sp|P05456|HSP70_TRYCR Heat shock 70 kDa protein OS=Trypanosoma cruzi GN=HSP70 PE=3 SV=1 47 655 0.0E+00
sp|Q9C7X7|HSP7N_ARATH Heat shock 70 kDa protein 18 OS=Arabidopsis thaliana GN=HSP70-18 PE=2 SV=1 48 656 0.0E+00
sp|Q91291|HSP70_PLEWA Heat shock 70 kDa protein OS=Pleurodeles waltl GN=HSP70 PE=2 SV=1 48 655 0.0E+00
sp|Q9W6Y1|HSP7C_ORYLA Heat shock cognate 71 kDa protein OS=Oryzias latipes GN=hsc70 PE=2 SV=1 48 658 0.0E+00
sp|P16019|HSP70_THEAN Heat shock 70 kDa protein OS=Theileria annulata GN=TA11610 PE=3 SV=2 48 662 0.0E+00
sp|P16394|HSP70_BRELC Heat shock 70 kDa protein OS=Bremia lactucae GN=HSP70 PE=3 SV=1 48 654 0.0E+00
sp|Q28222|HSP71_CHLAE Heat shock 70 kDa protein 1 OS=Chlorocebus aethiops GN=HSPA1 PE=2 SV=1 48 655 0.0E+00
sp|P25840|HSP70_CHLRE Heat shock 70 kDa protein OS=Chlamydomonas reinhardtii GN=HSP70 PE=2 SV=2 51 655 0.0E+00
sp|P26791|HSP70_DAUCA Heat shock 70 kDa protein OS=Daucus carota GN=HSP70 PE=3 SV=1 48 658 0.0E+00
sp|P11146|HSP7B_DROME Heat shock 70 kDa protein cognate 2 OS=Drosophila melanogaster GN=Hsc70-2 PE=1 SV=2 51 656 0.0E+00
sp|P91902|HSP70_CERCA Heat shock protein 70 OS=Ceratitis capitata PE=2 SV=1 51 654 0.0E+00
sp|P14834|HSP70_LEIMA Heat shock 70 kDa protein (Fragment) OS=Leishmania major GN=HSP70 PE=3 SV=1 47 554 0.0E+00
sp|Q5UQ49|HSP70_MIMIV Heat shock 70 kDa protein homolog OS=Acanthamoeba polyphaga mimivirus GN=HSP70 PE=3 SV=1 51 654 0.0E+00
sp|P41770|HSP75_KLUMA Heat shock protein SSB OS=Kluyveromyces marxianus GN=SSB PE=3 SV=2 47 637 0.0E+00
sp|Q6CQ83|HSP75_KLULA Heat shock protein SSB OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SSB PE=3 SV=3 47 637 0.0E+00
sp|Q707X3|HSP75_ZYGRC Heat shock protein SSB OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=SSB PE=3 SV=3 47 646 0.0E+00
sp|Q707W3|HSP75_KLUDE Heat shock protein SSB OS=Kluyveromyces delphensis GN=SSB PE=3 SV=3 47 596 0.0E+00
sp|Q876N3|HSP75_CANGA Heat shock protein SSB OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SSB1 PE=3 SV=3 47 596 0.0E+00
sp|P11484|HSP75_YEAST Heat shock protein SSB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSB1 PE=1 SV=3 47 612 0.0E+00
sp|P40150|HSP76_YEAST Heat shock protein SSB2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSB2 PE=1 SV=2 47 612 0.0E+00
sp|P87222|HSP75_CANAW Heat shock protein SSB1 OS=Candida albicans (strain WO-1) GN=SSB1 PE=3 SV=2 47 630 0.0E+00
sp|Q75E44|HSP75_ASHGO Heat shock protein SSB OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SSB PE=3 SV=3 47 630 0.0E+00
sp|Q10284|HSP75_SCHPO Heat shock protein sks2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sks2 PE=1 SV=2 47 639 0.0E+00
sp|Q6G554|DNAK_BARHE Chaperone protein DnaK OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=dnaK PE=3 SV=1 50 671 0.0E+00
sp|Q05981|DNAK_BRUO2 Chaperone protein DnaK OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=dnaK PE=2 SV=2 50 616 0.0E+00
sp|Q57AD7|DNAK_BRUAB Chaperone protein DnaK OS=Brucella abortus biovar 1 (strain 9-941) GN=dnaK PE=3 SV=1 50 616 0.0E+00
sp|Q54BD8|HS7C4_DICDI Heat shock cognate 70 kDa protein 4 OS=Dictyostelium discoideum GN=DDB_G0293678 PE=3 SV=1 51 564 0.0E+00
sp|Q8FXX2|DNAK_BRUSU Chaperone protein DnaK OS=Brucella suis biovar 1 (strain 1330) GN=dnaK PE=3 SV=1 50 616 0.0E+00
sp|Q8YE76|DNAK_BRUME Chaperone protein DnaK OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=dnaK PE=3 SV=2 50 616 0.0E+00
sp|B9JZ87|DNAK_AGRVS Chaperone protein DnaK OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=dnaK PE=3 SV=1 50 675 0.0E+00
sp|A9ILH7|DNAK_BART1 Chaperone protein DnaK OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=dnaK PE=3 SV=1 50 660 0.0E+00
sp|Q6G1F9|DNAK_BARQU Chaperone protein DnaK OS=Bartonella quintana (strain Toulouse) GN=dnaK PE=3 SV=1 50 642 0.0E+00
sp|Q5LWJ6|DNAK_RUEPO Chaperone protein DnaK OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=dnaK PE=3 SV=1 47 668 0.0E+00
sp|Q5NPS6|DNAK_ZYMMO Chaperone protein DnaK OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=dnaK PE=3 SV=1 48 655 0.0E+00
sp|B3PXH3|DNAK_RHIE6 Chaperone protein DnaK OS=Rhizobium etli (strain CIAT 652) GN=dnaK PE=3 SV=1 50 654 0.0E+00
sp|Q2KDW6|DNAK_RHIEC Chaperone protein DnaK OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=dnaK PE=3 SV=1 50 675 0.0E+00
sp|A1UUC3|DNAK_BARBK Chaperone protein DnaK OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=dnaK PE=3 SV=1 50 659 0.0E+00
sp|A6UEY0|DNAK_SINMW Chaperone protein DnaK OS=Sinorhizobium medicae (strain WSM419) GN=dnaK PE=3 SV=1 50 675 0.0E+00
sp|Q1GKS3|DNAK_RUEST Chaperone protein DnaK OS=Ruegeria sp. (strain TM1040) GN=dnaK PE=3 SV=1 50 667 0.0E+00
sp|A1B4E9|DNAK_PARDP Chaperone protein DnaK OS=Paracoccus denitrificans (strain Pd 1222) GN=dnaK PE=3 SV=1 50 665 0.0E+00
sp|Q1MN11|DNAK_RHIL3 Chaperone protein DnaK OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=dnaK PE=3 SV=1 50 675 0.0E+00
sp|Q11KJ6|DNAK_CHESB Chaperone protein DnaK OS=Chelativorans sp. (strain BNC1) GN=dnaK PE=3 SV=1 50 618 0.0E+00
sp|P50019|DNAK_AGRFC Chaperone protein DnaK OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=dnaK PE=2 SV=2 50 675 0.0E+00
sp|B8IHL3|DNAK_METNO Chaperone protein DnaK OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=dnaK PE=3 SV=1 48 619 0.0E+00
sp|A4WW89|DNAK_RHOS5 Chaperone protein DnaK OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=dnaK PE=3 SV=1 50 629 0.0E+00
sp|P42374|DNAK_RHIME Chaperone protein DnaK OS=Rhizobium meliloti (strain 1021) GN=dnaK PE=3 SV=2 50 675 0.0E+00
sp|Q8DI58|DNAK2_THEEB Chaperone protein dnaK2 OS=Thermosynechococcus elongatus (strain BP-1) GN=dnaK2 PE=3 SV=1 50 609 0.0E+00
sp|Q2LUH6|DNAK_SYNAS Chaperone protein DnaK OS=Syntrophus aciditrophicus (strain SB) GN=dnaK PE=3 SV=1 48 624 0.0E+00
sp|Q3IYM7|DNAK_RHOS4 Chaperone protein DnaK OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=dnaK PE=3 SV=1 50 625 0.0E+00
sp|A3PNM1|DNAK_RHOS1 Chaperone protein DnaK OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=dnaK PE=3 SV=1 50 625 0.0E+00
sp|B5ZWQ2|DNAK_RHILW Chaperone protein DnaK OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=dnaK PE=3 SV=1 50 624 0.0E+00
sp|Q92260|HSP70_PENCI Heat shock 70 kDa protein (Fragment) OS=Penicillium citrinum GN=HSP70 PE=1 SV=1 177 649 0.0E+00
sp|Q16D45|DNAK_ROSDO Chaperone protein DnaK OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=dnaK PE=3 SV=1 50 588 0.0E+00
sp|Q3SW76|DNAK_NITWN Chaperone protein DnaK OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=dnaK PE=3 SV=1 47 630 0.0E+00
sp|B3Q972|DNAK_RHOPT Chaperone protein DnaK OS=Rhodopseudomonas palustris (strain TIE-1) GN=dnaK PE=3 SV=1 47 630 0.0E+00
sp|Q6NCY4|DNAK_RHOPA Chaperone protein DnaK OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=dnaK PE=3 SV=1 47 630 0.0E+00
sp|Q52701|DNAK_RHOCA Chaperone protein DnaK OS=Rhodobacter capsulatus GN=dnaK PE=3 SV=1 50 667 0.0E+00
sp|Q3YRR6|DNAK_EHRCJ Chaperone protein DnaK OS=Ehrlichia canis (strain Jake) GN=dnaK PE=3 SV=1 49 657 0.0E+00
sp|O05700|DNAK_RHOS7 Chaperone protein DnaK OS=Rhodopseudomonas sp. (strain No.7) GN=dnaK PE=3 SV=1 47 630 0.0E+00
sp|B8EIP9|DNAK_METSB Chaperone protein DnaK OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=dnaK PE=3 SV=1 50 616 0.0E+00
sp|B2IBR4|DNAK_BEII9 Chaperone protein DnaK OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=dnaK PE=3 SV=1 48 626 0.0E+00
sp|B0UR84|DNAK_METS4 Chaperone protein DnaK OS=Methylobacterium sp. (strain 4-46) GN=dnaK PE=3 SV=1 48 619 0.0E+00
sp|A8GR22|DNAK_RICRS Chaperone protein DnaK OS=Rickettsia rickettsii (strain Sheila Smith) GN=dnaK PE=3 SV=1 48 666 0.0E+00
sp|B0BWH1|DNAK_RICRO Chaperone protein DnaK OS=Rickettsia rickettsii (strain Iowa) GN=dnaK PE=3 SV=1 48 666 0.0E+00
sp|B7KSZ4|DNAK_METC4 Chaperone protein DnaK OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=dnaK PE=3 SV=1 48 667 0.0E+00
sp|Q28VY3|DNAK_JANSC Chaperone protein DnaK OS=Jannaschia sp. (strain CCS1) GN=dnaK PE=3 SV=1 50 621 0.0E+00
sp|Q5PAB8|DNAK_ANAMM Chaperone protein DnaK OS=Anaplasma marginale (strain St. Maries) GN=dnaK PE=3 SV=1 50 632 0.0E+00
sp|B1LZ51|DNAK_METRJ Chaperone protein DnaK OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=dnaK PE=3 SV=1 48 647 0.0E+00
sp|A9W6R7|DNAK_METEP Chaperone protein DnaK OS=Methylobacterium extorquens (strain PA1) GN=dnaK PE=3 SV=1 48 667 0.0E+00
sp|B5YH59|DNAK_THEYD Chaperone protein DnaK OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=dnaK PE=3 SV=1 48 659 0.0E+00
sp|Q9XCB1|DNAK_RHOMR Chaperone protein DnaK OS=Rhodothermus marinus GN=dnaK PE=3 SV=1 48 666 0.0E+00
sp|Q5FFM4|DNAK_EHRRG Chaperone protein DnaK OS=Ehrlichia ruminantium (strain Gardel) GN=dnaK PE=3 SV=1 47 654 0.0E+00
sp|Q9ZDX9|DNAK_RICPR Chaperone protein DnaK OS=Rickettsia prowazekii (strain Madrid E) GN=dnaK PE=3 SV=1 48 616 0.0E+00
sp|B4S6P7|DNAK_PROA2 Chaperone protein DnaK OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=dnaK PE=3 SV=1 47 661 0.0E+00
sp|Q5HAY1|DNAK_EHRRW Chaperone protein DnaK OS=Ehrlichia ruminantium (strain Welgevonden) GN=dnaK PE=3 SV=1 47 654 0.0E+00
sp|B8DRD6|DNAK_DESVM Chaperone protein DnaK OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=dnaK PE=3 SV=1 47 641 0.0E+00
sp|A1BET8|DNAK_CHLPD Chaperone protein DnaK OS=Chlorobium phaeobacteroides (strain DSM 266) GN=dnaK PE=3 SV=1 47 660 0.0E+00
sp|B3EKT9|DNAK_CHLPB Chaperone protein DnaK OS=Chlorobium phaeobacteroides (strain BS1) GN=dnaK PE=3 SV=1 47 662 0.0E+00
sp|Q3APD2|DNAK_CHLCH Chaperone protein DnaK OS=Chlorobium chlorochromatii (strain CaD3) GN=dnaK PE=3 SV=1 47 659 0.0E+00
sp|Q98DD1|DNAK_RHILO Chaperone protein DnaK OS=Rhizobium loti (strain MAFF303099) GN=dnaK PE=3 SV=1 50 641 0.0E+00
sp|Q3A8C2|DNAK_PELCD Chaperone protein DnaK OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=dnaK PE=3 SV=1 47 621 0.0E+00
sp|Q7NDH1|DNAK_GLOVI Chaperone protein DnaK OS=Gloeobacter violaceus (strain PCC 7421) GN=dnaK PE=3 SV=1 48 667 0.0E+00
sp|P96133|DNAK_THERP Chaperone protein DnaK OS=Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) GN=dnaK PE=3 SV=2 48 666 0.0E+00
sp|Q1QRU1|DNAK_NITHX Chaperone protein DnaK OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=dnaK PE=3 SV=1 47 630 0.0E+00
sp|B1ZGR1|DNAK_METPB Chaperone protein DnaK OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=dnaK PE=3 SV=1 48 635 0.0E+00
sp|B3QMB2|DNAK_CHLP8 Chaperone protein DnaK OS=Chlorobaculum parvum (strain NCIB 8327) GN=dnaK PE=3 SV=1 48 661 0.0E+00
sp|Q6MNF8|DNAK_BDEBA Chaperone protein DnaK OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=dnaK PE=3 SV=1 48 659 0.0E+00
sp|Q1RHH0|DNAK_RICBR Chaperone protein DnaK OS=Rickettsia bellii (strain RML369-C) GN=dnaK PE=3 SV=1 48 667 0.0E+00
sp|Q2G6N0|DNAK_NOVAD Chaperone protein DnaK OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=dnaK PE=3 SV=1 50 667 0.0E+00
sp|Q8KEP3|DNAK_CHLTE Chaperone protein DnaK OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=dnaK PE=3 SV=1 48 660 0.0E+00
sp|Q3B577|DNAK_CHLL7 Chaperone protein DnaK OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=dnaK PE=3 SV=1 47 664 0.0E+00
sp|B6IVA4|DNAK_RHOCS Chaperone protein DnaK OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=dnaK PE=3 SV=1 50 618 0.0E+00
sp|C3PMM7|DNAK_RICAE Chaperone protein DnaK OS=Rickettsia africae (strain ESF-5) GN=dnaK PE=3 SV=1 48 639 0.0E+00
sp|Q2J320|DNAK_RHOP2 Chaperone protein DnaK OS=Rhodopseudomonas palustris (strain HaA2) GN=dnaK PE=3 SV=1 47 626 0.0E+00
sp|P61443|DNAK_LEPIN Chaperone protein DnaK OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=dnaK PE=3 SV=1 50 664 0.0E+00
sp|Q1MPW1|DNAK_LAWIP Chaperone protein DnaK OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=dnaK PE=3 SV=1 47 675 0.0E+00
sp|Q74H59|DNAK_GEOSL Chaperone protein DnaK OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=dnaK PE=3 SV=1 50 665 0.0E+00
sp|P83784|HSP77_CANAL Heat shock protein SSC1, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SSC1 PE=1 SV=2 34 658 0.0E+00
sp|Q68XI2|DNAK_RICTY Chaperone protein DnaK OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=dnaK PE=3 SV=1 48 624 0.0E+00
sp|Q4UJK7|DNAK_RICFE Chaperone protein DnaK OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=dnaK PE=3 SV=2 48 624 0.0E+00
sp|A8IPT1|DNAK_AZOC5 Chaperone protein DnaK OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=dnaK PE=3 SV=1 50 618 0.0E+00
sp|Q4FNP9|DNAK_PELUB Chaperone protein DnaK OS=Pelagibacter ubique (strain HTCC1062) GN=dnaK PE=3 SV=1 50 624 0.0E+00
sp|B6JCI3|DNAK_OLICO Chaperone protein DnaK OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=dnaK PE=3 SV=1 47 630 0.0E+00
sp|B3E7W9|DNAK_GEOLS Chaperone protein DnaK OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=dnaK PE=3 SV=1 50 665 0.0E+00
sp|P50021|DNAK2_SYNE7 Chaperone protein dnaK2 OS=Synechococcus elongatus (strain PCC 7942) GN=dnaK2 PE=3 SV=2 50 618 0.0E+00
sp|Q313S2|DNAK_DESAG Chaperone protein DnaK OS=Desulfovibrio alaskensis (strain G20) GN=dnaK PE=3 SV=1 48 641 0.0E+00
sp|A8GMF9|DNAK_RICAH Chaperone protein DnaK OS=Rickettsia akari (strain Hartford) GN=dnaK PE=3 SV=1 48 666 0.0E+00
sp|A6Q421|DNAK_NITSB Chaperone protein DnaK OS=Nitratiruptor sp. (strain SB155-2) GN=dnaK PE=3 SV=1 50 655 0.0E+00
sp|Q2VYT1|DNAK_MAGSA Chaperone protein DnaK OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=dnaK PE=3 SV=1 50 588 0.0E+00
sp|P38646|GRP75_HUMAN Stress-70 protein, mitochondrial OS=Homo sapiens GN=HSPA9 PE=1 SV=2 48 588 0.0E+00
sp|Q3ZCH0|GRP75_BOVIN Stress-70 protein, mitochondrial OS=Bos taurus GN=HSPA9 PE=2 SV=1 48 588 0.0E+00
sp|Q5R511|GRP75_PONAB Stress-70 protein, mitochondrial OS=Pongo abelii GN=HSPA9 PE=2 SV=1 48 588 0.0E+00
sp|Q01PM8|DNAK_SOLUE Chaperone protein DnaK OS=Solibacter usitatus (strain Ellin6076) GN=dnaK PE=3 SV=1 48 591 0.0E+00
sp|Q92J36|DNAK_RICCN Chaperone protein DnaK OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=dnaK PE=3 SV=1 48 609 0.0E+00
sp|Q07US6|DNAK_RHOP5 Chaperone protein DnaK OS=Rhodopseudomonas palustris (strain BisA53) GN=dnaK PE=3 SV=1 47 630 0.0E+00
sp|Q0BW82|DNAK_GRABC Chaperone protein DnaK OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=dnaK PE=3 SV=1 50 675 0.0E+00
sp|A8ZRW3|DNAK_DESOH Chaperone protein DnaK OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=dnaK PE=3 SV=1 51 674 0.0E+00
sp|P0CS91|HSP77_YEASX Heat shock protein SSC1, mitochondrial OS=Saccharomyces cerevisiae GN=SSC1 PE=1 SV=1 16 655 0.0E+00
sp|P0CS90|HSP77_YEAST Heat shock protein SSC1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSC1 PE=1 SV=1 16 655 0.0E+00
sp|Q73Q16|DNAK_TREDE Chaperone protein DnaK OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=dnaK PE=3 SV=1 48 659 0.0E+00
sp|B8J402|DNAK_DESDA Chaperone protein DnaK OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=dnaK PE=3 SV=1 50 612 0.0E+00
sp|P61442|DNAK_LEPIC Chaperone protein DnaK OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=dnaK PE=3 SV=1 50 654 0.0E+00
sp|O35501|GRP75_CRIGR Stress-70 protein, mitochondrial OS=Cricetulus griseus GN=HSPA9 PE=2 SV=1 48 588 0.0E+00
sp|C4K110|DNAK_RICPU Chaperone protein DnaK OS=Rickettsia peacockii (strain Rustic) GN=dnaK PE=3 SV=1 48 639 0.0E+00
sp|Q4FPS9|DNAK_PSYA2 Chaperone protein DnaK OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=dnaK PE=3 SV=1 47 672 0.0E+00
sp|Q04Y47|DNAK_LEPBL Chaperone protein DnaK OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=dnaK PE=3 SV=1 50 662 0.0E+00
sp|Q04VC8|DNAK_LEPBJ Chaperone protein DnaK OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=dnaK PE=3 SV=1 50 662 0.0E+00
sp|Q0BWZ9|DNAK_HYPNA Chaperone protein DnaK OS=Hyphomonas neptunium (strain ATCC 15444) GN=dnaK PE=3 SV=1 50 675 0.0E+00
sp|Q13E60|DNAK_RHOPS Chaperone protein DnaK OS=Rhodopseudomonas palustris (strain BisB5) GN=dnaK PE=3 SV=1 47 630 0.0E+00
sp|Q21CI2|DNAK_RHOPB Chaperone protein DnaK OS=Rhodopseudomonas palustris (strain BisB18) GN=dnaK PE=3 SV=1 47 630 0.0E+00
sp|P95334|DNAK_MYXXD Chaperone protein DnaK OS=Myxococcus xanthus (strain DK 1622) GN=dnaK PE=3 SV=2 48 656 0.0E+00
sp|B3EHR1|DNAK_CHLL2 Chaperone protein DnaK OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=dnaK PE=3 SV=1 47 664 0.0E+00
sp|P38647|GRP75_MOUSE Stress-70 protein, mitochondrial OS=Mus musculus GN=Hspa9 PE=1 SV=3 48 588 0.0E+00
sp|Q5N1J4|DNAK2_SYNP6 Chaperone protein DnaK 2 OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=dnaK2 PE=3 SV=1 50 618 0.0E+00
sp|Q5ZM98|GRP75_CHICK Stress-70 protein, mitochondrial OS=Gallus gallus GN=HSPA9 PE=1 SV=1 48 588 0.0E+00
sp|Q39PT7|DNAK_GEOMG Chaperone protein DnaK OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=dnaK PE=3 SV=1 50 669 0.0E+00
sp|A7IC65|DNAK_XANP2 Chaperone protein DnaK OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=dnaK PE=3 SV=1 50 596 0.0E+00
sp|Q6AMQ3|DNAK_DESPS Chaperone protein DnaK OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=dnaK PE=3 SV=1 47 642 0.0E+00
sp|A6VNB1|DNAK_ACTSZ Chaperone protein DnaK OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=dnaK PE=3 SV=1 47 624 0.0E+00
sp|A0L4Z2|DNAK_MAGMM Chaperone protein DnaK OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=dnaK PE=3 SV=1 47 612 0.0E+00
sp|A4SFB1|DNAK_CHLPM Chaperone protein DnaK OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=dnaK PE=3 SV=1 47 664 0.0E+00
sp|Q8YW74|DNAK2_NOSS1 Chaperone protein dnaK2 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=dnaK2 PE=3 SV=1 50 623 0.0E+00
sp|A5V5P9|DNAK_SPHWW Chaperone protein DnaK OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=dnaK PE=3 SV=1 50 642 0.0E+00
sp|Q1Q7X0|DNAK_PSYCK Chaperone protein DnaK OS=Psychrobacter cryohalolentis (strain K5) GN=dnaK PE=3 SV=1 47 659 0.0E+00
sp|Q85FW4|DNAK_CYAME Chaperone protein dnaK OS=Cyanidioschyzon merolae GN=dnaK PE=3 SV=1 50 647 0.0E+00
sp|A1VFG6|DNAK_DESVV Chaperone protein DnaK OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=dnaK PE=3 SV=1 47 662 0.0E+00
sp|Q72DW8|DNAK_DESVH Chaperone protein DnaK OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=dnaK PE=3 SV=1 47 662 0.0E+00
sp|B5RPM1|DNAK_BORRA Chaperone protein DnaK OS=Borrelia recurrentis (strain A1) GN=dnaK PE=3 SV=1 48 666 0.0E+00
sp|Q01899|HSP7M_PHAVU Heat shock 70 kDa protein, mitochondrial OS=Phaseolus vulgaris PE=2 SV=1 43 649 0.0E+00
sp|P48721|GRP75_RAT Stress-70 protein, mitochondrial OS=Rattus norvegicus GN=Hspa9 PE=1 SV=3 48 588 0.0E+00
sp|P94317|DNAK_BRADU Chaperone protein DnaK OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=dnaK PE=3 SV=1 47 630 0.0E+00
sp|B5RM75|DNAK_BORDL Chaperone protein DnaK OS=Borrelia duttonii (strain Ly) GN=dnaK PE=3 SV=1 48 662 0.0E+00
sp|Q3SIN4|DNAK_THIDA Chaperone protein DnaK OS=Thiobacillus denitrificans (strain ATCC 25259) GN=dnaK PE=3 SV=1 47 672 0.0E+00
sp|Q93GF1|DNAK_PRELO Chaperone protein DnaK OS=Prevotella loescheii GN=dnaK PE=3 SV=1 48 668 0.0E+00
sp|Q65U55|DNAK_MANSM Chaperone protein DnaK OS=Mannheimia succiniciproducens (strain MBEL55E) GN=dnaK PE=3 SV=2 47 654 0.0E+00
sp|A4JBS1|DNAK_BURVG Chaperone protein DnaK OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=dnaK PE=3 SV=1 48 654 0.0E+00
sp|P22358|DNAK2_SYNY3 Chaperone protein dnaK2 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=dnaK2 PE=2 SV=1 47 664 0.0E+00
sp|P29845|HSP7E_DROME Heat shock 70 kDa protein cognate 5 OS=Drosophila melanogaster GN=Hsc70-5 PE=1 SV=2 48 642 0.0E+00
sp|B0UWR4|DNAK_HISS2 Chaperone protein DnaK OS=Histophilus somni (strain 2336) GN=dnaK PE=3 SV=1 47 654 0.0E+00
sp|Q0I3V2|DNAK_HAES1 Chaperone protein DnaK OS=Haemophilus somnus (strain 129Pt) GN=dnaK PE=3 SV=1 47 654 0.0E+00
sp|Q7VVY2|DNAK_BORPE Chaperone protein DnaK OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=dnaK PE=3 SV=1 50 640 0.0E+00
sp|Q0SMZ0|DNAK_BORAP Chaperone protein DnaK OS=Borrelia afzelii (strain PKo) GN=dnaK PE=3 SV=1 48 663 0.0E+00
sp|P11141|HSP7F_CAEEL Heat shock 70 kDa protein F, mitochondrial OS=Caenorhabditis elegans GN=hsp-6 PE=1 SV=2 13 625 0.0E+00
sp|B4SDA0|DNAK_PELPB Chaperone protein DnaK OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=dnaK PE=3 SV=1 48 658 0.0E+00
sp|Q5FSL5|DNAK_GLUOX Chaperone protein DnaK OS=Gluconobacter oxydans (strain 621H) GN=dnaK PE=3 SV=1 50 609 0.0E+00
sp|B9M357|DNAK_GEODF Chaperone protein DnaK OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=dnaK PE=3 SV=1 50 621 0.0E+00
sp|P20442|DNAK_CAUCR Chaperone protein DnaK OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=dnaK PE=2 SV=2 50 647 0.0E+00
sp|Q7W519|DNAK_BORPA Chaperone protein DnaK OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=dnaK PE=3 SV=1 50 640 0.0E+00
sp|B7J282|DNAK_BORBZ Chaperone protein DnaK OS=Borrelia burgdorferi (strain ZS7) GN=dnaK PE=2 SV=1 48 625 0.0E+00
sp|P0C922|DNAK_BORBU Chaperone protein DnaK OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=dnaK PE=2 SV=1 48 625 0.0E+00
sp|Q7WGI4|DNAK_BORBR Chaperone protein DnaK OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=dnaK PE=3 SV=1 50 640 0.0E+00
sp|A9HEA3|DNAK_GLUDA Chaperone protein DnaK OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=dnaK PE=3 SV=1 50 609 0.0E+00
sp|Q661A3|DNAK_BORBP Chaperone protein DnaK OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=dnaK PE=3 SV=1 48 625 0.0E+00
sp|B8GNX1|DNAK_THISH Chaperone protein DnaK OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=dnaK PE=3 SV=1 47 644 0.0E+00
sp|Q1CV46|DNAK_HELPH Chaperone protein DnaK OS=Helicobacter pylori (strain HPAG1) GN=dnaK PE=3 SV=1 47 641 0.0E+00
sp|A5EYG3|DNAK_DICNV Chaperone protein DnaK OS=Dichelobacter nodosus (strain VCS1703A) GN=dnaK PE=3 SV=1 47 675 0.0E+00
sp|O68191|DNAK_BURPS Chaperone protein DnaK OS=Burkholderia pseudomallei (strain K96243) GN=dnaK PE=3 SV=2 48 654 0.0E+00
sp|A3ND68|DNAK_BURP6 Chaperone protein DnaK OS=Burkholderia pseudomallei (strain 668) GN=dnaK PE=3 SV=1 48 654 0.0E+00
sp|A3NYX7|DNAK_BURP0 Chaperone protein DnaK OS=Burkholderia pseudomallei (strain 1106a) GN=dnaK PE=3 SV=1 48 654 0.0E+00
sp|A1V0U6|DNAK_BURMS Chaperone protein DnaK OS=Burkholderia mallei (strain SAVP1) GN=dnaK PE=3 SV=1 48 654 0.0E+00
sp|Q62HD5|DNAK_BURMA Chaperone protein DnaK OS=Burkholderia mallei (strain ATCC 23344) GN=dnaK PE=3 SV=1 48 654 0.0E+00
sp|A2S565|DNAK_BURM9 Chaperone protein DnaK OS=Burkholderia mallei (strain NCTC 10229) GN=dnaK PE=3 SV=1 48 654 0.0E+00
sp|A3MN99|DNAK_BURM7 Chaperone protein DnaK OS=Burkholderia mallei (strain NCTC 10247) GN=dnaK PE=3 SV=1 48 654 0.0E+00
sp|A9IGC3|DNAK_BORPD Chaperone protein DnaK OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=dnaK PE=3 SV=1 50 640 0.0E+00
sp|A5GDC8|DNAK_GEOUR Chaperone protein DnaK OS=Geobacter uraniireducens (strain Rf4) GN=dnaK PE=3 SV=1 50 669 0.0E+00
sp|A3DF25|DNAK_CLOTH Chaperone protein DnaK OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=dnaK PE=3 SV=1 48 661 0.0E+00
sp|Q3JP10|DNAK_BURP1 Chaperone protein DnaK OS=Burkholderia pseudomallei (strain 1710b) GN=dnaK PE=3 SV=1 48 654 0.0E+00
sp|A9AGB8|DNAK_BURM1 Chaperone protein DnaK OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=dnaK PE=3 SV=1 48 654 0.0E+00
sp|P55994|DNAK_HELPY Chaperone protein DnaK OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=dnaK PE=3 SV=2 47 641 0.0E+00
sp|B6JPL0|DNAK_HELP2 Chaperone protein DnaK OS=Helicobacter pylori (strain P12) GN=dnaK PE=3 SV=1 47 641 0.0E+00
sp|B8FGS3|DNAK_DESAA Chaperone protein DnaK OS=Desulfatibacillum alkenivorans (strain AK-01) GN=dnaK PE=3 SV=1 48 660 0.0E+00
sp|B2URT8|DNAK_HELPS Chaperone protein DnaK OS=Helicobacter pylori (strain Shi470) GN=dnaK PE=3 SV=1 47 641 0.0E+00
sp|A4J7F3|DNAK_DESRM Chaperone protein DnaK OS=Desulfotomaculum reducens (strain MI-1) GN=dnaK PE=3 SV=1 47 654 0.0E+00
sp|B3QZ38|DNAK_CHLT3 Chaperone protein DnaK OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=dnaK PE=3 SV=1 47 633 0.0E+00
sp|Q2Y6U0|DNAK_NITMU Chaperone protein DnaK OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=dnaK PE=3 SV=1 47 666 0.0E+00
sp|P30721|DNAK_CLOAB Chaperone protein DnaK OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=dnaK PE=2 SV=3 50 666 0.0E+00
sp|Q39JC8|DNAK_BURL3 Chaperone protein DnaK OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=dnaK PE=3 SV=1 48 654 0.0E+00
sp|Q0BI18|DNAK_BURCM Chaperone protein DnaK OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=dnaK PE=3 SV=1 48 654 0.0E+00
sp|B2S0M0|DNAK_BORHD Chaperone protein DnaK OS=Borrelia hermsii (strain HS1 / DAH) GN=dnaK PE=3 SV=1 48 666 0.0E+00
sp|Q8RB68|DNAK_CALS4 Chaperone protein DnaK OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=dnaK PE=3 SV=1 48 664 0.0E+00
sp|B1YTK0|DNAK_BURA4 Chaperone protein DnaK OS=Burkholderia ambifaria (strain MC40-6) GN=dnaK PE=3 SV=1 48 654 0.0E+00
sp|C4L8Y5|DNAK_TOLAT Chaperone protein DnaK OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=dnaK PE=3 SV=1 47 639 0.0E+00
sp|A6QBG0|DNAK_SULNB Chaperone protein DnaK OS=Sulfurovum sp. (strain NBC37-1) GN=dnaK PE=3 SV=1 48 639 0.0E+00
sp|A4G8D2|DNAK_HERAR Chaperone protein DnaK OS=Herminiimonas arsenicoxydans GN=dnaK PE=3 SV=1 48 654 0.0E+00
sp|Q5P1H5|DNAK_AROAE Chaperone protein DnaK OS=Aromatoleum aromaticum (strain EbN1) GN=dnaK PE=3 SV=1 47 666 0.0E+00
sp|C4XQ63|DNAK_DESMR Chaperone protein DnaK OS=Desulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1) GN=dnaK PE=3 SV=1 48 641 0.0E+00
sp|B2UKV6|DNAK_AKKM8 Chaperone protein DnaK OS=Akkermansia muciniphila (strain ATCC BAA-835 / Muc) GN=dnaK PE=3 SV=1 50 639 0.0E+00
sp|Q9LDZ0|HSP7J_ARATH Heat shock 70 kDa protein 10, mitochondrial OS=Arabidopsis thaliana GN=HSP70-10 PE=2 SV=1 34 655 0.0E+00
sp|B5Z9P0|DNAK_HELPG Chaperone protein DnaK OS=Helicobacter pylori (strain G27) GN=dnaK PE=3 SV=1 47 641 0.0E+00
sp|Q17VY4|DNAK_HELAH Chaperone protein DnaK OS=Helicobacter acinonychis (strain Sheeba) GN=dnaK PE=3 SV=1 47 641 0.0E+00
sp|A1WX31|DNAK_HALHL Chaperone protein DnaK OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=dnaK PE=3 SV=1 47 658 0.0E+00
sp|Q2SYZ4|DNAK_BURTA Chaperone protein DnaK OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=dnaK PE=3 SV=1 48 654 0.0E+00
sp|B7GKC8|DNAK_ANOFW Chaperone protein DnaK OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=dnaK PE=3 SV=1 50 655 0.0E+00
sp|A5FZ19|DNAK_ACICJ Chaperone protein DnaK OS=Acidiphilium cryptum (strain JF-5) GN=dnaK PE=3 SV=1 50 665 0.0E+00
sp|B3CNB5|DNAK_WOLPP Chaperone protein DnaK OS=Wolbachia pipientis subsp. Culex pipiens (strain wPip) GN=dnaK PE=3 SV=1 48 621 0.0E+00
sp|P0C937|DNAK_PORGI Chaperone protein DnaK OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=dnaK PE=3 SV=1 47 659 0.0E+00
sp|B4EDZ2|DNAK_BURCJ Chaperone protein DnaK OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=dnaK PE=3 SV=1 48 654 0.0E+00
sp|A7HZ39|DNAK_PARL1 Chaperone protein DnaK OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=dnaK PE=3 SV=1 50 675 0.0E+00
sp|A1U614|DNAK_MARHV Chaperone protein DnaK OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=dnaK PE=3 SV=1 50 654 0.0E+00
sp|B8CXL1|DNAK_HALOH Chaperone protein DnaK OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=dnaK PE=3 SV=1 47 654 0.0E+00
sp|A5FPU4|DNAK_DEHMB Chaperone protein DnaK OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=dnaK PE=3 SV=1 47 667 0.0E+00
sp|Q6F6N3|DNAK_ACIAD Chaperone protein DnaK OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=dnaK PE=3 SV=1 50 655 0.0E+00
sp|P37900|HSP7M_PEA Heat shock 70 kDa protein, mitochondrial OS=Pisum sativum GN=HSP1 PE=2 SV=1 43 596 0.0E+00
sp|Q9LTX9|HSP7G_ARATH Heat shock 70 kDa protein 7, chloroplastic OS=Arabidopsis thaliana GN=HSP70-7 PE=2 SV=1 50 664 0.0E+00
sp|Q2RNE6|DNAK_RHORT Chaperone protein DnaK OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=dnaK PE=3 SV=1 50 612 0.0E+00
sp|O33528|DNAK_RHILE Chaperone protein DnaK OS=Rhizobium leguminosarum GN=dnaK PE=3 SV=1 50 675 0.0E+00
sp|Q9ZMW4|DNAK_HELPJ Chaperone protein DnaK OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=dnaK PE=3 SV=3 47 641 0.0E+00
sp|Q2KWA2|DNAK_BORA1 Chaperone protein DnaK OS=Bordetella avium (strain 197N) GN=dnaK PE=3 SV=1 50 624 0.0E+00
sp|Q3Z6P1|DNAK_DEHM1 Chaperone protein DnaK OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=dnaK PE=3 SV=1 50 598 0.0E+00
sp|A0K4S8|DNAK_BURCH Chaperone protein DnaK OS=Burkholderia cenocepacia (strain HI2424) GN=dnaK PE=3 SV=1 47 654 0.0E+00
sp|B1JW19|DNAK_BURCC Chaperone protein DnaK OS=Burkholderia cenocepacia (strain MC0-3) GN=dnaK PE=3 SV=1 47 654 0.0E+00
sp|Q1BYX3|DNAK_BURCA Chaperone protein DnaK OS=Burkholderia cenocepacia (strain AU 1054) GN=dnaK PE=3 SV=1 47 654 0.0E+00
sp|B5ENA3|DNAK_ACIF5 Chaperone protein DnaK OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=dnaK PE=3 SV=1 50 594 0.0E+00
sp|B7J7X9|DNAK_ACIF2 Chaperone protein DnaK OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=dnaK PE=3 SV=1 50 594 0.0E+00
sp|C6BSF2|DNAK_DESAD Chaperone protein DnaK OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=dnaK PE=3 SV=1 50 664 0.0E+00
sp|B2JGE2|DNAK_BURP8 Chaperone protein DnaK OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=dnaK PE=3 SV=1 48 654 0.0E+00
sp|C0R3W7|DNAK_WOLWR Chaperone protein DnaK OS=Wolbachia sp. subsp. Drosophila simulans (strain wRi) GN=dnaK PE=3 SV=1 48 657 0.0E+00
sp|Q7MA35|DNAK_WOLSU Chaperone protein DnaK OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=dnaK PE=3 SV=1 47 655 0.0E+00
sp|Q730M1|DNAK_BACC1 Chaperone protein DnaK OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=dnaK PE=3 SV=1 50 654 0.0E+00
sp|Q5KWZ7|DNAK_GEOKA Chaperone protein DnaK OS=Geobacillus kaustophilus (strain HTA426) GN=dnaK PE=1 SV=1 50 664 0.0E+00
sp|A7Z6W1|DNAK_BACMF Chaperone protein DnaK OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=dnaK PE=3 SV=1 50 668 0.0E+00
sp|B9IY81|DNAK_BACCQ Chaperone protein DnaK OS=Bacillus cereus (strain Q1) GN=dnaK PE=3 SV=1 50 654 0.0E+00
sp|B7HPL3|DNAK_BACC7 Chaperone protein DnaK OS=Bacillus cereus (strain AH187) GN=dnaK PE=3 SV=1 50 654 0.0E+00
sp|A1K4C5|DNAK_AZOSB Chaperone protein DnaK OS=Azoarcus sp. (strain BH72) GN=dnaK PE=3 SV=1 47 640 0.0E+00
sp|B0KA81|DNAK_THEP3 Chaperone protein DnaK OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=dnaK PE=3 SV=1 48 658 0.0E+00
sp|B2RJ90|DNAK_PORG3 Chaperone protein DnaK OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=dnaK PE=3 SV=1 47 659 0.0E+00
sp|A1ANV0|DNAK_PELPD Chaperone protein DnaK OS=Pelobacter propionicus (strain DSM 2379) GN=dnaK PE=3 SV=1 50 618 0.0E+00
sp|B9L8Z0|DNAK_NAUPA Chaperone protein DnaK OS=Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH) GN=dnaK PE=3 SV=1 48 653 0.0E+00
sp|Q3ZYV1|DNAK_DEHMC Chaperone protein DnaK OS=Dehalococcoides mccartyi (strain CBDB1) GN=dnaK PE=3 SV=1 47 667 0.0E+00
sp|Q46XI7|DNAK_CUPPJ Chaperone protein DnaK OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=dnaK PE=3 SV=1 48 654 0.0E+00
sp|Q145F1|DNAK_BURXL Chaperone protein DnaK OS=Burkholderia xenovorans (strain LB400) GN=dnaK PE=3 SV=1 48 654 0.0E+00
sp|Q73GL7|DNAK_WOLPM Chaperone protein DnaK OS=Wolbachia pipientis wMel GN=dnaK PE=3 SV=1 48 621 0.0E+00
sp|B5EC42|DNAK_GEOBB Chaperone protein DnaK OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=dnaK PE=3 SV=1 50 661 0.0E+00
sp|B3R6G7|DNAK_CUPTR Chaperone protein DnaK OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=dnaK PE=3 SV=1 48 618 0.0E+00
sp|A4SQ25|DNAK_AERS4 Chaperone protein DnaK OS=Aeromonas salmonicida (strain A449) GN=dnaK PE=3 SV=1 47 618 0.0E+00
sp|A1WAR6|DNAK_ACISJ Chaperone protein DnaK OS=Acidovorax sp. (strain JS42) GN=dnaK PE=3 SV=1 47 654 0.0E+00
sp|A1WGJ9|DNAK_VEREI Chaperone protein DnaK OS=Verminephrobacter eiseniae (strain EF01-2) GN=dnaK PE=3 SV=1 47 624 0.0E+00
sp|Q9KD72|DNAK_BACHD Chaperone protein DnaK OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=dnaK PE=3 SV=3 50 655 0.0E+00
sp|P71331|DNAK_AGGAC Chaperone protein DnaK OS=Aggregatibacter actinomycetemcomitans GN=dnaK PE=3 SV=3 47 618 0.0E+00
sp|A0KMI6|DNAK_AERHH Chaperone protein DnaK OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=dnaK PE=3 SV=1 47 641 0.0E+00
sp|Q88DU2|DNAK_PSEPK Chaperone protein DnaK OS=Pseudomonas putida (strain KT2440) GN=dnaK PE=3 SV=1 47 664 0.0E+00
sp|C6E643|DNAK_GEOSM Chaperone protein DnaK OS=Geobacter sp. (strain M21) GN=dnaK PE=3 SV=1 50 661 0.0E+00
sp|Q0K757|DNAK_CUPNH Chaperone protein DnaK OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=dnaK PE=3 SV=1 47 618 0.0E+00
sp|B0K3Y0|DNAK_THEPX Chaperone protein DnaK OS=Thermoanaerobacter sp. (strain X514) GN=dnaK PE=3 SV=1 48 658 0.0E+00
sp|A8Z5V5|DNAK_SULMW Chaperone protein DnaK OS=Sulcia muelleri (strain GWSS) GN=dnaK PE=3 SV=1 50 655 0.0E+00
sp|A6LDG8|DNAK_PARD8 Chaperone protein DnaK OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=dnaK PE=3 SV=1 47 654 0.0E+00
sp|C0QGP6|DNAK_DESAH Chaperone protein DnaK OS=Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2) GN=dnaK PE=3 SV=1 47 641 0.0E+00
sp|B2V2I5|DNAK_CLOBA Chaperone protein DnaK OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=dnaK PE=3 SV=1 48 663 0.0E+00
sp|Q5B0C0|HSP7M_EMENI Heat shock 70 kDa protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN6010 PE=1 SV=1 48 643 0.0E+00
sp|P57870|DNAK_PASMU Chaperone protein DnaK OS=Pasteurella multocida (strain Pm70) GN=dnaK PE=3 SV=1 47 616 0.0E+00
sp|Q0AKB1|DNAK_MARMM Chaperone protein DnaK OS=Maricaulis maris (strain MCS10) GN=dnaK PE=3 SV=1 50 621 0.0E+00
sp|B2SXC6|DNAK_BURPP Chaperone protein DnaK OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=dnaK PE=3 SV=1 48 654 0.0E+00
sp|O87712|DNAK_COXBU Chaperone protein DnaK OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=dnaK PE=1 SV=1 50 641 0.0E+00
sp|A9N8H2|DNAK_COXBR Chaperone protein DnaK OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=dnaK PE=3 SV=1 50 641 0.0E+00
sp|A9KG88|DNAK_COXBN Chaperone protein DnaK OS=Coxiella burnetii (strain Dugway 5J108-111) GN=dnaK PE=3 SV=1 50 641 0.0E+00
sp|B6J7U7|DNAK_COXB1 Chaperone protein DnaK OS=Coxiella burnetii (strain CbuK_Q154) GN=dnaK PE=3 SV=1 50 641 0.0E+00
sp|A1TLH9|DNAK_ACIAC Chaperone protein DnaK OS=Acidovorax citrulli (strain AAC00-1) GN=dnaK PE=3 SV=1 47 654 0.0E+00
sp|A5W9A3|DNAK_PSEP1 Chaperone protein DnaK OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=dnaK PE=3 SV=1 47 662 0.0E+00
sp|Q3IC08|DNAK_PSEHT Chaperone protein DnaK OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=dnaK PE=3 SV=1 47 616 0.0E+00
sp|Q11QH3|DNAK_CYTH3 Chaperone protein DnaK OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=dnaK PE=3 SV=1 47 672 0.0E+00
sp|P17820|DNAK_BACSU Chaperone protein DnaK OS=Bacillus subtilis (strain 168) GN=dnaK PE=1 SV=3 50 675 0.0E+00
sp|Q5WHG1|DNAK_BACSK Chaperone protein DnaK OS=Bacillus clausii (strain KSM-K16) GN=dnaK PE=3 SV=1 50 655 0.0E+00
sp|Q02028|HSP7S_PEA Stromal 70 kDa heat shock-related protein, chloroplastic OS=Pisum sativum GN=HSP70 PE=2 SV=1 50 664 0.0E+00
sp|Q0HY11|DNAK_SHESR Chaperone protein DnaK OS=Shewanella sp. (strain MR-7) GN=dnaK PE=3 SV=1 47 641 0.0E+00
sp|B3PF33|DNAK_CELJU Chaperone protein DnaK OS=Cellvibrio japonicus (strain Ueda107) GN=dnaK PE=3 SV=1 47 654 0.0E+00
sp|O52960|DNAK_APHHA Chaperone protein DnaK OS=Aphanothece halophytica GN=dnaK PE=2 SV=1 48 600 0.0E+00
sp|Q0HLN0|DNAK_SHESM Chaperone protein DnaK OS=Shewanella sp. (strain MR-4) GN=dnaK PE=3 SV=1 47 641 0.0E+00
sp|Q6MB26|DNAK_PARUW Chaperone protein DnaK OS=Protochlamydia amoebophila (strain UWE25) GN=dnaK PE=3 SV=1 42 647 0.0E+00
sp|Q607A5|DNAK_METCA Chaperone protein DnaK OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=dnaK PE=3 SV=1 50 671 0.0E+00
sp|B1Y786|DNAK_LEPCP Chaperone protein DnaK OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=dnaK PE=3 SV=1 48 654 0.0E+00
sp|A6T226|DNAK_JANMA Chaperone protein DnaK OS=Janthinobacterium sp. (strain Marseille) GN=dnaK PE=3 SV=1 48 610 0.0E+00
sp|B2TLZ7|DNAK_CLOBB Chaperone protein DnaK OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=dnaK PE=3 SV=1 48 663 0.0E+00
sp|B0T138|DNAK_CAUSK Chaperone protein DnaK OS=Caulobacter sp. (strain K31) GN=dnaK PE=3 SV=1 50 588 0.0E+00
sp|Q9LCQ5|DNAK_BRECH Chaperone protein DnaK OS=Brevibacillus choshinensis GN=dnaK PE=3 SV=1 50 655 0.0E+00
sp|B4S0U1|DNAK_ALTMD Chaperone protein DnaK OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=dnaK PE=3 SV=1 47 616 0.0E+00
sp|B4SSQ6|DNAK_STRM5 Chaperone protein DnaK OS=Stenotrophomonas maltophilia (strain R551-3) GN=dnaK PE=3 SV=1 47 596 0.0E+00
sp|B3DZP7|DNAK_METI4 Chaperone protein DnaK OS=Methylacidiphilum infernorum (isolate V4) GN=dnaK PE=3 SV=1 50 654 0.0E+00
sp|Q2SMM8|DNAK_HAHCH Chaperone protein DnaK OS=Hahella chejuensis (strain KCTC 2396) GN=dnaK PE=3 SV=1 47 654 0.0E+00
sp|Q9STW6|HSP7F_ARATH Heat shock 70 kDa protein 6, chloroplastic OS=Arabidopsis thaliana GN=HSP70-6 PE=1 SV=1 50 654 0.0E+00
sp|A0KTS5|DNAK_SHESA Chaperone protein DnaK OS=Shewanella sp. (strain ANA-3) GN=dnaK PE=3 SV=1 47 641 0.0E+00
sp|Q1AXX6|DNAK_RUBXD Chaperone protein DnaK OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=dnaK PE=3 SV=1 48 654 0.0E+00
sp|C5B7L7|DNAK_EDWI9 Chaperone protein DnaK OS=Edwardsiella ictaluri (strain 93-146) GN=dnaK PE=3 SV=1 47 647 0.0E+00
sp|B6IZJ0|DNAK_COXB2 Chaperone protein DnaK OS=Coxiella burnetii (strain CbuG_Q212) GN=dnaK PE=3 SV=1 50 630 0.0E+00
sp|A5WI20|DNAK_PSYWF Chaperone protein DnaK OS=Psychrobacter sp. (strain PRwf-1) GN=dnaK PE=3 SV=1 51 654 0.0E+00
sp|A4IR31|DNAK_GEOTN Chaperone protein DnaK OS=Geobacillus thermodenitrificans (strain NG80-2) GN=dnaK PE=3 SV=1 50 655 0.0E+00
sp|C5D4U1|DNAK_GEOSW Chaperone protein DnaK OS=Geobacillus sp. (strain WCH70) GN=dnaK PE=3 SV=1 50 655 0.0E+00
sp|A9BNG5|DNAK_DELAS Chaperone protein DnaK OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=dnaK PE=3 SV=1 47 624 0.0E+00
sp|A3M8W9|DNAK_ACIBT Chaperone protein DnaK OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=dnaK PE=3 SV=2 50 661 0.0E+00
sp|B2HZZ7|DNAK_ACIBC Chaperone protein DnaK OS=Acinetobacter baumannii (strain ACICU) GN=dnaK PE=3 SV=1 50 661 0.0E+00
sp|Q5GSE1|DNAK_WOLTR Chaperone protein DnaK OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=dnaK PE=3 SV=1 48 621 0.0E+00
sp|Q12Q08|DNAK_SHEDO Chaperone protein DnaK OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=dnaK PE=3 SV=1 47 621 0.0E+00
sp|A1STE4|DNAK_PSYIN Chaperone protein DnaK OS=Psychromonas ingrahamii (strain 37) GN=dnaK PE=3 SV=1 47 642 0.0E+00
sp|Q5F6W5|DNAK_NEIG1 Chaperone protein DnaK OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=dnaK PE=3 SV=1 50 612 0.0E+00
sp|A7ZVV7|DNAK_ECOHS Chaperone protein DnaK OS=Escherichia coli O9:H4 (strain HS) GN=dnaK PE=3 SV=1 47 642 0.0E+00
sp|A1JJD5|DNAK_YERE8 Chaperone protein DnaK OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=dnaK PE=3 SV=1 47 666 0.0E+00
sp|Q3AF08|DNAK_CARHZ Chaperone protein DnaK OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=dnaK PE=3 SV=1 48 674 0.0E+00
sp|B9KCH0|DNAK_CAMLR Chaperone protein DnaK OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=dnaK PE=3 SV=1 50 654 0.0E+00
sp|A9VHU1|DNAK_BACWK Chaperone protein DnaK OS=Bacillus weihenstephanensis (strain KBAB4) GN=dnaK PE=3 SV=1 50 654 0.0E+00
sp|A7GT08|DNAK_BACCN Chaperone protein DnaK OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=dnaK PE=3 SV=1 50 654 0.0E+00
sp|B0V5U4|DNAK_ACIBY Chaperone protein DnaK OS=Acinetobacter baumannii (strain AYE) GN=dnaK PE=3 SV=1 50 661 0.0E+00
sp|B7IBK5|DNAK_ACIB5 Chaperone protein DnaK OS=Acinetobacter baumannii (strain AB0057) GN=dnaK PE=3 SV=1 50 661 0.0E+00
sp|B7H317|DNAK_ACIB3 Chaperone protein DnaK OS=Acinetobacter baumannii (strain AB307-0294) GN=dnaK PE=3 SV=1 50 661 0.0E+00
sp|B2S2G4|DNAK_TREPS Chaperone protein DnaK OS=Treponema pallidum subsp. pallidum (strain SS14) GN=dnaK PE=3 SV=1 48 618 0.0E+00
sp|O83246|DNAK_TREPA Chaperone protein DnaK OS=Treponema pallidum (strain Nichols) GN=dnaK PE=3 SV=1 48 618 0.0E+00
sp|B2FMY5|DNAK_STRMK Chaperone protein DnaK OS=Stenotrophomonas maltophilia (strain K279a) GN=dnaK PE=3 SV=1 47 596 0.0E+00
sp|P69377|DNAK_PORUM Chaperone protein dnaK OS=Porphyra umbilicalis GN=dnaK PE=3 SV=1 47 642 0.0E+00
sp|P69376|DNAK_PORPU Chaperone protein dnaK OS=Porphyra purpurea GN=dnaK PE=3 SV=1 47 642 0.0E+00
sp|A9M296|DNAK_NEIM0 Chaperone protein DnaK OS=Neisseria meningitidis serogroup C (strain 053442) GN=dnaK PE=3 SV=1 50 612 0.0E+00
sp|Q1H3B8|DNAK_METFK Chaperone protein DnaK OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=dnaK PE=3 SV=1 47 624 0.0E+00
sp|B0TAD7|DNAK_HELMI Chaperone protein DnaK OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=dnaK PE=3 SV=1 48 664 0.0E+00
sp|A5FGL1|DNAK_FLAJ1 Chaperone protein DnaK OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=dnaK PE=3 SV=1 47 618 0.0E+00
sp|A6LRN4|DNAK_CLOB8 Chaperone protein DnaK OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=dnaK PE=3 SV=1 48 658 0.0E+00
sp|A8FFD2|DNAK_BACP2 Chaperone protein DnaK OS=Bacillus pumilus (strain SAFR-032) GN=dnaK PE=3 SV=1 50 654 0.0E+00
sp|B7IYG7|DNAK_BACC2 Chaperone protein DnaK OS=Bacillus cereus (strain G9842) GN=dnaK PE=3 SV=1 50 654 0.0E+00
sp|B9MDJ7|DNAK_ACIET Chaperone protein DnaK OS=Acidovorax ebreus (strain TPSY) GN=dnaK PE=3 SV=1 47 654 0.0E+00
sp|Q3Z601|DNAK_SHISS Chaperone protein DnaK OS=Shigella sonnei (strain Ss046) GN=dnaK PE=3 SV=1 47 642 0.0E+00
sp|Q83MH5|DNAK_SHIFL Chaperone protein DnaK OS=Shigella flexneri GN=dnaK PE=3 SV=1 47 642 0.0E+00
sp|Q0T8H6|DNAK_SHIF8 Chaperone protein DnaK OS=Shigella flexneri serotype 5b (strain 8401) GN=dnaK PE=3 SV=1 47 642 0.0E+00
sp|Q32KA5|DNAK_SHIDS Chaperone protein DnaK OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=dnaK PE=3 SV=1 47 642 0.0E+00
sp|Q326K7|DNAK_SHIBS Chaperone protein DnaK OS=Shigella boydii serotype 4 (strain Sb227) GN=dnaK PE=3 SV=1 47 642 0.0E+00
sp|A1RGN1|DNAK_SHESW Chaperone protein DnaK OS=Shewanella sp. (strain W3-18-1) GN=dnaK PE=3 SV=1 47 621 0.0E+00
sp|A4Y9Q3|DNAK_SHEPC Chaperone protein DnaK OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=dnaK PE=3 SV=1 47 621 0.0E+00
sp|Q8EHT7|DNAK_SHEON Chaperone protein DnaK OS=Shewanella oneidensis (strain MR-1) GN=dnaK PE=3 SV=1 47 641 0.0E+00
sp|Q9ZFC6|DNAK_METSS Chaperone protein DnaK OS=Methylovorus sp. (strain SS1 / DSM 11726) GN=dnaK PE=3 SV=1 50 624 0.0E+00
sp|A6W2D2|DNAK_MARMS Chaperone protein DnaK OS=Marinomonas sp. (strain MWYL1) GN=dnaK PE=3 SV=1 47 659 0.0E+00
sp|O69268|DNAK_LYSSH Chaperone protein DnaK OS=Lysinibacillus sphaericus GN=dnaK PE=3 SV=3 50 655 0.0E+00
sp|Q1RGI8|DNAK_ECOUT Chaperone protein DnaK OS=Escherichia coli (strain UTI89 / UPEC) GN=dnaK PE=3 SV=1 47 642 0.0E+00
sp|P0A6Y8|DNAK_ECOLI Chaperone protein DnaK OS=Escherichia coli (strain K12) GN=dnaK PE=1 SV=2 47 642 0.0E+00
sp|B1IRG0|DNAK_ECOLC Chaperone protein DnaK OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=dnaK PE=3 SV=1 47 642 0.0E+00
sp|P0A6Y9|DNAK_ECOL6 Chaperone protein DnaK OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=dnaK PE=3 SV=2 47 642 0.0E+00
sp|Q0TLX5|DNAK_ECOL5 Chaperone protein DnaK OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=dnaK PE=3 SV=1 47 642 0.0E+00
sp|A1A766|DNAK_ECOK1 Chaperone protein DnaK OS=Escherichia coli O1:K1 / APEC GN=dnaK PE=3 SV=1 47 642 0.0E+00
sp|P0A6Z0|DNAK_ECO57 Chaperone protein DnaK OS=Escherichia coli O157:H7 GN=dnaK PE=3 SV=2 47 642 0.0E+00
sp|A7ZHA4|DNAK_ECO24 Chaperone protein DnaK OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=dnaK PE=3 SV=1 47 642 0.0E+00
sp|Q6HDK7|DNAK_BACHK Chaperone protein DnaK OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=dnaK PE=3 SV=1 50 654 0.0E+00
[Show less]

GO

GO Term Description Terminal node
GO:0140662 ATP-dependent protein folding chaperone Yes
GO:0005524 ATP binding Yes
GO:0097367 carbohydrate derivative binding No
GO:0036094 small molecule binding No
GO:0030554 adenyl nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0140657 ATP-dependent activity No
GO:0032559 adenyl ribonucleotide binding No
GO:0043168 anion binding No
GO:0097159 organic cyclic compound binding No
GO:0017076 purine nucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0003674 molecular_function No
GO:1901265 nucleoside phosphate binding No
GO:0044183 protein folding chaperone No
GO:0032553 ribonucleotide binding No
GO:0032555 purine ribonucleotide binding No
GO:0000166 nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 41 0.45

Transmembrane Domains

Domain # Start End Length
1 16 38 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|037140
MSPSVRHPTRTQSRTLLSSLSILFLAALAVLCFFPVAAHAEETHPEYGSVIGIDLGTTYSCVGVQRGGRVEIIAN
DQGHRITPSWVSFTDDERLVGDSAKNAYHSNPQNTVFDAKRLIGRKMNEPEVKRDMKHWPFKVTEKNGKPSISVE
HKGEERQFSAEEISAMVLGKMKETAEAYLGHKVTHAVITVPAYFNDAQRQATKDAGTIAGLHVLRIINEPTAAAI
AYGLNKGSGESQIIVYDLGGGTFDVSLLSIDDGVFEVLATAGDTHLGGEDFDNRVIDYFVKSYKKKTGTDVSKNL
RALGKLKREVEKAKRTLSSQQSTRIEIESFEDGNDFSETLTRAKFDELNMDLFRKTMKPVEQVLKDANVKKDEID
EVVLVGGSTRIPKVQQLLKEFFNGKEPSKGINPDEAVAYGAAVQGGILSGAEGTDGVVLVDVNPLTLGIETTGGV
FTKLIPRNTVIPTKKSQIFSTAADNQPTVLIQVFEGERSLTKDNNLLGKFELNGIPPAPRGVPQIEVTFEMDANG
IMKVSAADKGTGKSEGITIKNEKGRLSQEEIDRMVADAEKFAAEDEANRKKIEALNSLSSFVYGLKNQVTDSEGL
GGKLDSDDKQTILDAVKEATEWIEENGSTASVEDLEEKLAEVQGVVNPITTKLYEGAGADGPSGDDDFEFDHDEL
*
Coding >AgabiH97|037140
ATGTCTCCCTCTGTCCGTCATCCGACGCGCACACAGAGCAGGACTCTCCTCTCTTCCCTCTCCATTCTCTTCCTC
GCCGCCCTCGCTGTCCTTTGCTTCTTCCCCGTCGCTGCACATGCAGAAGAGACACATCCGGAGTACGGCAGTGTT
ATCGGTATTGATCTTGGTACAACTTATTCGTGTGTTGGTGTACAACGTGGCGGTCGTGTGGAAATCATTGCCAAC
GATCAAGGTCATCGAATTACTCCATCATGGGTCAGCTTCACGGACGATGAACGACTTGTCGGTGACTCCGCGAAA
AATGCCTACCACTCCAATCCCCAAAACACCGTATTTGATGCGAAGCGTCTCATTGGTCGCAAGATGAATGAACCG
GAAGTCAAACGCGACATGAAGCACTGGCCATTCAAGGTTACCGAGAAGAACGGCAAGCCCTCGATTTCCGTCGAA
CACAAGGGCGAAGAGCGTCAGTTCTCCGCTGAGGAAATCTCCGCTATGGTTTTGGGCAAGATGAAGGAGACCGCT
GAGGCTTATCTCGGCCACAAGGTCACCCACGCAGTCATTACTGTCCCTGCTTACTTCAACGACGCTCAGCGTCAA
GCTACTAAGGACGCCGGAACTATTGCTGGCCTCCACGTCCTCCGTATCATTAACGAGCCCACCGCTGCCGCTATC
GCCTACGGTCTCAACAAGGGGAGTGGAGAATCTCAAATCATTGTCTACGATCTCGGTGGTGGTACTTTCGATGTG
TCACTCCTATCTATCGATGATGGTGTCTTCGAGGTTTTGGCTACCGCTGGTGACACTCACCTTGGTGGTGAAGAT
TTCGACAACCGCGTCATTGACTACTTTGTCAAGTCGTACAAGAAGAAGACCGGTACCGATGTCAGCAAGAACCTT
CGTGCTCTCGGCAAACTGAAGCGTGAGGTTGAGAAGGCCAAGAGGACTCTCTCCAGTCAACAATCCACCCGTATT
GAAATCGAGTCGTTTGAGGATGGTAACGACTTCTCCGAGACCCTCACTCGTGCCAAATTCGACGAACTCAACATG
GATCTCTTCCGTAAGACCATGAAGCCCGTCGAGCAGGTGCTCAAGGACGCTAACGTTAAGAAGGATGAAATTGAC
GAGGTTGTTCTAGTTGGTGGCTCTACTCGTATCCCCAAGGTTCAGCAACTCCTCAAGGAGTTCTTCAACGGCAAG
GAGCCCTCCAAGGGAATCAACCCCGATGAGGCTGTTGCTTATGGTGCTGCCGTTCAAGGTGGTATTCTTTCCGGC
GCTGAGGGAACAGACGGTGTCGTTCTTGTCGATGTCAACCCGCTCACTCTCGGTATCGAGACCACTGGTGGTGTC
TTCACGAAGCTCATTCCCCGTAACACCGTCATCCCCACGAAGAAGAGTCAAATCTTCTCTACCGCCGCCGACAAC
CAGCCTACCGTTCTTATTCAAGTCTTTGAGGGTGAACGTTCTCTTACCAAAGACAACAACCTCCTCGGCAAGTTC
GAACTCAATGGTATTCCTCCTGCTCCCCGCGGCGTTCCTCAAATCGAAGTTACTTTCGAGATGGATGCCAATGGT
ATCATGAAGGTTTCTGCCGCTGACAAGGGAACTGGCAAGTCTGAGGGTATCACCATCAAGAACGAGAAGGGCCGT
CTTTCTCAGGAGGAAATTGATCGCATGGTTGCCGACGCTGAGAAATTCGCCGCTGAGGATGAGGCCAATCGCAAG
AAGATCGAGGCTCTTAACTCCCTCTCGTCCTTTGTGTACGGTCTCAAGAACCAGGTCACTGACTCTGAGGGACTT
GGTGGCAAACTCGATAGCGATGACAAGCAGACTATTTTGGATGCCGTCAAGGAAGCTACTGAGTGGATTGAGGAG
AACGGTTCCACCGCCAGTGTTGAGGATCTTGAAGAGAAGTTGGCCGAGGTCCAAGGCGTTGTCAACCCCATCACG
ACGAAACTCTATGAAGGCGCTGGTGCCGATGGTCCCTCTGGCGACGACGATTTTGAGTTTGATCACGATGAACTG
TAA
Transcript >AgabiH97|037140
ATGTCTCCCTCTGTCCGTCATCCGACGCGCACACAGAGCAGGACTCTCCTCTCTTCCCTCTCCATTCTCTTCCTC
GCCGCCCTCGCTGTCCTTTGCTTCTTCCCCGTCGCTGCACATGCAGAAGAGACACATCCGGAGTACGGCAGTGTT
ATCGGTATTGATCTTGGTACAACTTATTCGTGTGTTGGTGTACAACGTGGCGGTCGTGTGGAAATCATTGCCAAC
GATCAAGGTCATCGAATTACTCCATCATGGGTCAGCTTCACGGACGATGAACGACTTGTCGGTGACTCCGCGAAA
AATGCCTACCACTCCAATCCCCAAAACACCGTATTTGATGCGAAGCGTCTCATTGGTCGCAAGATGAATGAACCG
GAAGTCAAACGCGACATGAAGCACTGGCCATTCAAGGTTACCGAGAAGAACGGCAAGCCCTCGATTTCCGTCGAA
CACAAGGGCGAAGAGCGTCAGTTCTCCGCTGAGGAAATCTCCGCTATGGTTTTGGGCAAGATGAAGGAGACCGCT
GAGGCTTATCTCGGCCACAAGGTCACCCACGCAGTCATTACTGTCCCTGCTTACTTCAACGACGCTCAGCGTCAA
GCTACTAAGGACGCCGGAACTATTGCTGGCCTCCACGTCCTCCGTATCATTAACGAGCCCACCGCTGCCGCTATC
GCCTACGGTCTCAACAAGGGGAGTGGAGAATCTCAAATCATTGTCTACGATCTCGGTGGTGGTACTTTCGATGTG
TCACTCCTATCTATCGATGATGGTGTCTTCGAGGTTTTGGCTACCGCTGGTGACACTCACCTTGGTGGTGAAGAT
TTCGACAACCGCGTCATTGACTACTTTGTCAAGTCGTACAAGAAGAAGACCGGTACCGATGTCAGCAAGAACCTT
CGTGCTCTCGGCAAACTGAAGCGTGAGGTTGAGAAGGCCAAGAGGACTCTCTCCAGTCAACAATCCACCCGTATT
GAAATCGAGTCGTTTGAGGATGGTAACGACTTCTCCGAGACCCTCACTCGTGCCAAATTCGACGAACTCAACATG
GATCTCTTCCGTAAGACCATGAAGCCCGTCGAGCAGGTGCTCAAGGACGCTAACGTTAAGAAGGATGAAATTGAC
GAGGTTGTTCTAGTTGGTGGCTCTACTCGTATCCCCAAGGTTCAGCAACTCCTCAAGGAGTTCTTCAACGGCAAG
GAGCCCTCCAAGGGAATCAACCCCGATGAGGCTGTTGCTTATGGTGCTGCCGTTCAAGGTGGTATTCTTTCCGGC
GCTGAGGGAACAGACGGTGTCGTTCTTGTCGATGTCAACCCGCTCACTCTCGGTATCGAGACCACTGGTGGTGTC
TTCACGAAGCTCATTCCCCGTAACACCGTCATCCCCACGAAGAAGAGTCAAATCTTCTCTACCGCCGCCGACAAC
CAGCCTACCGTTCTTATTCAAGTCTTTGAGGGTGAACGTTCTCTTACCAAAGACAACAACCTCCTCGGCAAGTTC
GAACTCAATGGTATTCCTCCTGCTCCCCGCGGCGTTCCTCAAATCGAAGTTACTTTCGAGATGGATGCCAATGGT
ATCATGAAGGTTTCTGCCGCTGACAAGGGAACTGGCAAGTCTGAGGGTATCACCATCAAGAACGAGAAGGGCCGT
CTTTCTCAGGAGGAAATTGATCGCATGGTTGCCGACGCTGAGAAATTCGCCGCTGAGGATGAGGCCAATCGCAAG
AAGATCGAGGCTCTTAACTCCCTCTCGTCCTTTGTGTACGGTCTCAAGAACCAGGTCACTGACTCTGAGGGACTT
GGTGGCAAACTCGATAGCGATGACAAGCAGACTATTTTGGATGCCGTCAAGGAAGCTACTGAGTGGATTGAGGAG
AACGGTTCCACCGCCAGTGTTGAGGATCTTGAAGAGAAGTTGGCCGAGGTCCAAGGCGTTGTCAACCCCATCACG
ACGAAACTCTATGAAGGCGCTGGTGCCGATGGTCCCTCTGGCGACGACGATTTTGAGTTTGATCACGATGAACTG
TAA
Gene >AgabiH97|037140
ATGTCTCCCTCTGTCCGTCATCCGACGCGCACACAGAGCAGGACTCTCCTCTCTTCCCTCTCCATTCTCTTCCTC
GCCGCCCTCGCTGTCCTTTGCTTCTTCCCCGTCGCTGCACATGCAGAAGAGACACATCCGGAGTACGGCAGTGTT
ATCGGTATTGGTACGTGTCCCCCCGCTTTAGAAAGTGTGTAACACATCCTGACATGGTTCCCCTAGATCTTGGTA
CAACGTATGTGACTGGACTCGCCCCGCCTTGTAAAATTTGACTGACTTGAAATGGTATCCAGTTATTCGTGTGTT
GGGTACGTGGCATTTTCACCTCGGCTATCCTAGGCATTGACATTTCCCAAAGTGTACAACGTGGCGGTCGTGTGG
AAATCATTGCCAACGATCAAGGTCATCGAATTACTCCATCATGGGTCAGCTTCACGGACGATGAACGACTGTGAG
TGCGCTTGGGCCCGGCGGTCTTTTCATTTACTAAGAATTTACAGTGTCGGTGACTCCGCGAAAAATGCCTACCAC
TCCAATCCCCAAAACACCGTATTTGATGCGAAGCGTCTCATTGGTCGCAAGATGAATGAACCGGAAGTCAAACGC
GACATGAAGCACTGGCCATTCAAGGTTACCGAGAAGAACGGCAAGCCCTCGATTTCCGTCGAACACAAGGGCGAA
GAGCGTCAGTTCTCCGCTGAGGAAATCTCCGCTATGGTTTTGGGCAAGATGAAGGAGACCGCTGAGGCTTATCTC
GGCCACAAGGTCACCCACGCAGTCATTACTGTCCCTGCTTGTAAGCTCTCAGTGTTCTTCTCGTATATTTCAACT
TTCCTTAATGCTTATGATCAGACTTCAACGACGCTCAGCGTCAAGCTACTAAGGACGCCGGAACTATTGCTGGCC
TCCACGTCCTCCGTATCATTAACGAGCCCACCGCTGCCGCTATCGCCTACGGTCTCAACAAGGGGAGTGGAGAAT
CTCAAATCATTGTCTACGATCTCGGTGGTGGTACTTTCGATGTGTCACTCCTATCTATCGATGATGGTGTCTTCG
AGGTTTTGGCTACCGCTGGTGACACTCACCTTGGTGGTGAAGATTTCGACAACCGCGTCATTGACTACTTTGTCA
AGTCGTACAAGAAGAAGACCGGTACCGATGTCAGCAAGAACCTTCGTGCTCTCGGCAAACTGAAGCGTGAGGTTG
AGAAGGCCAAGAGGACTCTCTCCAGTCAACAATCCACCCGTATTGAAATCGAGTCGTTTGAGGATGGTAACGACT
TCTCCGAGACCCTCACTCGTGCCAAATTCGACGAACTCAACATGGATCTCTTCCGTAAGACCATGAAGCCCGTCG
AGCAGGTGCTCAAGGACGCTAACGTTAAGAAGGATGAAATTGACGAGGTTCGTATTGTTTTAATTATCCTGAGGA
GCACCTTGCTCATTATCTTCAAAGGTTGTTCTAGTTGGTGGCTCTACTCGTATCCCCAAGGTTCAGCAACTCCTC
AAGGAGTTCTTCAACGGCAAGGAGCCCTCCAAGGGAATCAACCCCGATGAGGCTGTTGCTTATGGTGCTGCCGTT
CAAGGTGGTATTCTTTCCGGCGCTGAGGGAACAGACGGTGTCGTTCTTGTCGATGTCAACCCGCTCACTCTCGGT
ATCGAGACCACTGGTGGTGTCTTCACGAAGCTCATTCCCCGTAACACCGTCATCCCCACGAAGAAGAGTCAAATC
TTCTCTACCGCCGCCGACAACCAGCCTACCGTTCTTATTCAAGTCTTTGAGGGTGAACGTTCTCTTACCAAAGAC
AACAACCTCCTCGGCAAGTTCGAACTCAATGGTATTCCTCCTGCTCCCCGCGGCGTTCCTCAAATCGAAGTTACT
TTCGAGATGGATGCCAATGGTATCATGAAGGTTTCTGCCGCTGACAAGGGAACGTAAGTACAATTCATATCTATT
CCTGAGGTCTCATTCTGATTGTCTCGATAGTGGCAAGTCTGAGGGTATCACCATCAAGAACGAGAAGGGCCGTCT
TTCTCAGGAGGAAATTGATCGCATGGTTGCCGACGCTGAGAAATTCGCCGCTGAGGATGAGGCCAATCGCAAGAA
GATCGAGGCTCTTAACTCCCTCTCGTCCTTTGTGTACGGTCTCAAGAACCAGGTCACTGACTCTGAGGGACTTGG
TGGCAAACTCGATAGCGATGACAAGCAGACTATTTTGGATGCCGTCAAGGAAGCTACTGAGTGGATTGAGGAGAA
CGGTTCCACCGCCAGTGTTGAGGATCTTGAAGAGAAGTTGGCCGGTACGAAACGCTCTTTCCTTATGTTTTCGTT
TCATTTGCTGACTTCCTATCCAGAGGTCCAAGGCGTTGTCAACCCCATCACGACGAAACTCTATGAAGGCGCTGG
TGCCGATGGTCCCTCTGGCGACGACGATTTTGAGTTTGATCACGATGAACTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail