Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|037120
Gene name
Locationscaffold_13:941020..946689
Strand-
Gene length (bp)5669
Transcript length (bp)5421
Coding sequence length (bp)5421
Protein length (aa) 1807

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02145 Rap_GAP Rap/ran-GAP 1.0E-43 1577 1775
PF03542 Tuberin Tuberin 1.9E-38 1078 1314
PF11864 DUF3384 Domain of unknown function (DUF3384) 1.5E-09 61 238

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P49815|TSC2_HUMAN Tuberin OS=Homo sapiens GN=TSC2 PE=1 SV=2 1499 1783 3.0E-47
sp|P49816|TSC2_RAT Tuberin OS=Rattus norvegicus GN=Tsc2 PE=1 SV=1 1499 1783 7.0E-46
sp|Q9UUG9|TSC2_SCHPO Tuberous sclerosis 2 protein homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tsc2 PE=1 SV=1 1544 1776 1.0E-40
sp|Q61037|TSC2_MOUSE Tuberin OS=Mus musculus GN=Tsc2 PE=1 SV=1 1499 1688 7.0E-40
sp|Q9UUG9|TSC2_SCHPO Tuberous sclerosis 2 protein homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tsc2 PE=1 SV=1 1096 1418 5.0E-38
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P49815|TSC2_HUMAN Tuberin OS=Homo sapiens GN=TSC2 PE=1 SV=2 1499 1783 3.0E-47
sp|P49816|TSC2_RAT Tuberin OS=Rattus norvegicus GN=Tsc2 PE=1 SV=1 1499 1783 7.0E-46
sp|Q9UUG9|TSC2_SCHPO Tuberous sclerosis 2 protein homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tsc2 PE=1 SV=1 1544 1776 1.0E-40
sp|Q61037|TSC2_MOUSE Tuberin OS=Mus musculus GN=Tsc2 PE=1 SV=1 1499 1688 7.0E-40
sp|Q9UUG9|TSC2_SCHPO Tuberous sclerosis 2 protein homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tsc2 PE=1 SV=1 1096 1418 5.0E-38
sp|P49816|TSC2_RAT Tuberin OS=Rattus norvegicus GN=Tsc2 PE=1 SV=1 1086 1327 6.0E-22
sp|P49815|TSC2_HUMAN Tuberin OS=Homo sapiens GN=TSC2 PE=1 SV=2 1086 1327 8.0E-22
sp|Q9VB98|Y5521_DROME Probable Rho GTPase-activating protein CG5521 OS=Drosophila melanogaster GN=CG5521 PE=1 SV=2 1538 1744 1.0E-21
sp|Q61037|TSC2_MOUSE Tuberin OS=Mus musculus GN=Tsc2 PE=1 SV=1 1086 1327 2.0E-21
sp|Q6GYQ0|RGPA1_HUMAN Ral GTPase-activating protein subunit alpha-1 OS=Homo sapiens GN=RALGAPA1 PE=1 SV=1 1544 1744 4.0E-21
sp|P86411|RGPA2_RAT Ral GTPase-activating protein subunit alpha-2 OS=Rattus norvegicus GN=Ralgapa2 PE=1 SV=1 1533 1737 6.0E-21
sp|O55007|RGPA1_RAT Ral GTPase-activating protein subunit alpha-1 OS=Rattus norvegicus GN=Ralgapa1 PE=1 SV=2 1544 1744 6.0E-21
sp|A3KGS3|RGPA2_MOUSE Ral GTPase-activating protein subunit alpha-2 OS=Mus musculus GN=Ralgapa2 PE=1 SV=2 1533 1737 6.0E-21
sp|Q6GYP7|RGPA1_MOUSE Ral GTPase-activating protein subunit alpha-1 OS=Mus musculus GN=Ralgapa1 PE=1 SV=1 1544 1744 9.0E-21
sp|Q2PPJ7|RGPA2_HUMAN Ral GTPase-activating protein subunit alpha-2 OS=Homo sapiens GN=RALGAPA2 PE=1 SV=2 1533 1737 2.0E-20
sp|Q96FS4|SIPA1_HUMAN Signal-induced proliferation-associated protein 1 OS=Homo sapiens GN=SIPA1 PE=1 SV=1 1541 1690 4.0E-15
sp|O35412|SI1L1_RAT Signal-induced proliferation-associated 1-like protein 1 OS=Rattus norvegicus GN=Sipa1l1 PE=1 SV=1 1531 1765 7.0E-15
sp|Q8C0T5|SI1L1_MOUSE Signal-induced proliferation-associated 1-like protein 1 OS=Mus musculus GN=Sipa1l1 PE=1 SV=2 1540 1765 7.0E-15
sp|O43166|SI1L1_HUMAN Signal-induced proliferation-associated 1-like protein 1 OS=Homo sapiens GN=SIPA1L1 PE=1 SV=4 1540 1765 1.0E-14
sp|O60292|SI1L3_HUMAN Signal-induced proliferation-associated 1-like protein 3 OS=Homo sapiens GN=SIPA1L3 PE=1 SV=3 1540 1721 5.0E-14
sp|Q9P2F8|SI1L2_HUMAN Signal-induced proliferation-associated 1-like protein 2 OS=Homo sapiens GN=SIPA1L2 PE=1 SV=2 1536 1690 6.0E-14
sp|Q80TE4|SI1L2_MOUSE Signal-induced proliferation-associated 1-like protein 2 OS=Mus musculus GN=Sipa1l2 PE=1 SV=3 1536 1721 1.0E-13
sp|Q5JCS6|SI1L2_RAT Signal-induced proliferation-associated 1-like protein 2 OS=Rattus norvegicus GN=Sipa1l2 PE=1 SV=1 1536 1690 1.0E-13
sp|P46062|SIPA1_MOUSE Signal-induced proliferation-associated protein 1 OS=Mus musculus GN=Sipa1 PE=1 SV=2 1541 1766 2.0E-13
sp|P47736|RPGP1_HUMAN Rap1 GTPase-activating protein 1 OS=Homo sapiens GN=RAP1GAP PE=1 SV=2 1542 1754 1.0E-12
sp|A2ALS5|RPGP1_MOUSE Rap1 GTPase-activating protein 1 OS=Mus musculus GN=Rap1gap PE=1 SV=2 1542 1754 1.0E-12
sp|Q55AN8|Y1806_DICDI PH and Rap-GAP domain-containing protein DDB_G0271806 OS=Dictyostelium discoideum GN=DDB_G0271806 PE=3 SV=1 1544 1687 7.0E-12
sp|Q684P5|RPGP2_HUMAN Rap1 GTPase-activating protein 2 OS=Homo sapiens GN=RAP1GAP2 PE=1 SV=2 1542 1788 1.0E-11
sp|Q75J96|RGAP1_DICDI RapA guanosine triphosphatase-activating protein 1 OS=Dictyostelium discoideum GN=rapgap1 PE=2 SV=1 1545 1687 2.0E-11
sp|Q5SVL6|RPGP2_MOUSE Rap1 GTPase-activating protein 2 OS=Mus musculus GN=Rap1gap2 PE=1 SV=1 1542 1692 2.0E-11
sp|Q5ZMV8|RPGP2_CHICK Rap1 GTPase-activating protein 2 OS=Gallus gallus GN=RAP1GAP2 PE=2 SV=2 1542 1788 6.0E-11
sp|Q54EH3|Y1510_DICDI GTPase-activating protein DDB_G0291510 OS=Dictyostelium discoideum GN=DDB_G0291510 PE=3 SV=1 1540 1722 4.0E-10
sp|Q5ZJY3|GARL3_CHICK GTPase-activating Rap/Ran-GAP domain-like protein 3 OS=Gallus gallus GN=GARNL3 PE=2 SV=1 1542 1721 1.0E-09
sp|Q5VVW2|GARL3_HUMAN GTPase-activating Rap/Ran-GAP domain-like protein 3 OS=Homo sapiens GN=GARNL3 PE=2 SV=2 1542 1713 5.0E-09
sp|A5PF44|GARL3_DANRE GTPase-activating Rap/Ran-GAP domain-like protein 3 OS=Danio rerio GN=garnl3 PE=3 SV=1 1541 1713 5.0E-09
sp|Q3V0G7|GARL3_MOUSE GTPase-activating Rap/Ran-GAP domain-like protein 3 OS=Mus musculus GN=Garnl3 PE=1 SV=1 1542 1713 2.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0051056 regulation of small GTPase mediated signal transduction Yes
GO:0005096 GTPase activator activity Yes
GO:0043547 positive regulation of GTPase activity Yes
GO:0050794 regulation of cellular process No
GO:0008047 enzyme activator activity No
GO:0065007 biological regulation No
GO:0060589 nucleoside-triphosphatase regulator activity No
GO:0043085 positive regulation of catalytic activity No
GO:0098772 molecular function regulator activity No
GO:0008150 biological_process No
GO:0030695 GTPase regulator activity No
GO:0043087 regulation of GTPase activity No
GO:0010646 regulation of cell communication No
GO:0030234 enzyme regulator activity No
GO:0050790 regulation of catalytic activity No
GO:0065009 regulation of molecular function No
GO:0048583 regulation of response to stimulus No
GO:0051345 positive regulation of hydrolase activity No
GO:0003674 molecular_function No
GO:0009966 regulation of signal transduction No
GO:0023051 regulation of signaling No
GO:0051336 regulation of hydrolase activity No
GO:0050789 regulation of biological process No
GO:1902531 regulation of intracellular signal transduction No
GO:0044093 positive regulation of molecular function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|037120
MNGMNRLTLSPSISVVQKSALHKSDNVSPSPVGTPQASHQPTLSLSAIIDALRPPAVPSLAHARTLAALLSTASP
LPRCAAVQPIISSLCDFNNPPSLQAIGFDVLSSYWENPEAGYAETADRLSFFSLFLGPTTAWAVDLWEPRFKALR
ALTKYGTDIVGVEAVLINLLKHWLKGAFDGLLDLNGELYRSERVERERSVDVLFKFLSDVLNRTENIARLPENTV
HLTIEFYASLVDHSIVAQKGSEVSSDSPIVSDPSPSQQSFGLHRRNTSSLSTSSITSPSTPTVPSTHQTLNKPPA
ELAITIYLDYLSTQIKTLSPSLIENIIPLLFRALAFCASPLPRLTILSQPLRKPSLEDRVLETLVSIYTGPYSTT
CVGMHRRCLLPAFPAEGEIETEEGEPIMVKGDDITPQKISRVPLQIGLLTSLGGYRMMRMRLRQLLIIRLARAYI
SREVSYSYTGAPSHLELEQELMEKAWPRDDYLPNADIGIGSVANGWDPRRVGTAVSESVCAWIDWIGEGPHTPGI
GPTDKDAFRENWDRERNQVDKILEEAAGMLKDLLQEADSREEDNPCLNDEEAAFVGGILYNLCKYVISLRNPDGS
PYVLPLDNPISAPTPLLKSITSLLARDHTSNLNPLLSTTLISIVEHLTDTDTARLPGLMLDQHDLTPTSPEWLLN
WENLLGNSIALSSQRPLTKSAAMEALAIVYDTVKDMASYRRPLADLVLKFCKKWVGAPEIESEDGEPLWKVLGEE
VVLQAIESSDGETDDINAIIELLTTVASEPSVEEAADKADAHSALGESQVPSPSIGTSIPSASNLVSPILSRMQS
EFHIGGKDKDKESAIPSVMSLLSSFTSGNVSRSQSTQPTITEDLPEVVAEPEKSKSLPRVVSAVAALVDAFAQIS
FTSYVLEGHLHRLAIRLYHILLEILAQGQSARGRVTVLQFLMRLRADIDHNIFFIFKTYDRDGLVSRLSSLIGRS
SLPTTERHIEDPEGDYSDIRKSRPKFQEQEEKVQSGFGIGRLSRSTGSRSRSRAPLRTSSVEITRKPRMPLWNHP
EVYPFVVADSDSASEALISYNPNGPNDLVLSIDQYLKVIIGILERETSWDVLSYVLCHLPTQLANKHLFCGPLCS
QLISRLLNVLCTGILKGELGFYIEAWPPGLKPRDAQGLAYHTLSVLVSYRKCFEQKQRYVLVEVFQQGLDGQLST
IKSCLHALTLSAFELRISVTKCLPRILEKLSQIMSNPNMSVHILGFLTIVGTIPALYANFTEADYKMVFGVALQY
LQHYNRQNASPTVSWALSQYVRIMSYTTVYVWFLALKLPDRPKHIPYITRQLLLANEAKKEIDIPTEVCFDWLAR
NAFASADPRPANSAFSEIVMNPANHPSDPSPSGPVQSGKSWLVGNAVVTIRTLPRAGWVEILSRRSSGFSKLICH
IENVPMVGPGEVSPDIVSVPAGLMLGKTPTRVASATGAIEEDVEQASGDKLQEALVPQTVDDSSEPPRPDPITGY
VWSKSAPSQRRKDVTLDPSYVALQLSSYPFGNNNARKVEDSPVLQRFLSTLDRIPVIDTHKVGIMYVAPGQTDEL
EILGNTHGSPAYTHFLEGLGRLVNLRGQVDVYAGGLNPDEDGEYAYAWWDDIGQILYHTATMMPSHAHDPHFNFK
KRHIGNDYVRIVWNDSGGSYRFDTLTTQFQFVNIVIEPHSVGAIAAFSSLNDNDYFKVTIQQAPGMTEFAPVGFF
KLISAENLPLLVRQLSLLADWFASVFAETQKDTARVEVTTNWSARLQAIRRFMAQLPEHEEVEPLEGIFSQESSR
DFTNTF*
Coding >AgabiH97|037120
ATGAATGGAATGAATCGACTTACTTTGTCTCCCAGCATTTCTGTGGTTCAAAAATCTGCACTACATAAATCCGAC
AATGTTTCCCCATCCCCTGTAGGCACACCACAAGCATCACATCAGCCTACACTTTCTTTAAGTGCCATTATCGAC
GCCCTCAGACCCCCCGCTGTCCCCAGTCTTGCACACGCACGAACCCTTGCAGCTCTCTTAAGTACCGCTTCACCC
CTACCCCGTTGCGCTGCCGTTCAACCGATCATCTCTTCCTTATGCGACTTCAATAATCCTCCGTCTTTGCAGGCT
ATAGGCTTCGACGTTCTCTCATCGTACTGGGAGAACCCAGAAGCTGGTTATGCAGAGACAGCGGATCGTCTATCT
TTCTTCTCTCTATTCTTGGGGCCTACGACTGCATGGGCAGTGGATCTTTGGGAGCCCAGGTTCAAAGCACTCAGA
GCACTCACAAAATATGGTACCGATATCGTTGGTGTCGAGGCAGTCCTGATCAATCTCTTAAAACACTGGCTAAAA
GGTGCTTTCGACGGGTTATTGGATTTGAATGGAGAGTTGTATCGGTCAGAGCGAGTCGAGAGGGAGAGGAGTGTA
GATGTTCTATTCAAGTTTTTGTCCGATGTCCTCAACAGAACCGAAAATATTGCTAGGCTCCCAGAAAACACAGTT
CATCTCACGATAGAGTTCTACGCGAGCCTCGTCGATCACTCAATTGTCGCTCAAAAAGGATCGGAAGTATCGAGT
GACTCGCCAATAGTATCCGATCCTTCGCCATCGCAGCAAAGTTTTGGACTCCATCGACGAAACACTTCTTCACTC
TCGACGTCGTCTATCACATCTCCAAGCACACCAACAGTTCCCTCTACACATCAGACCCTAAATAAGCCTCCTGCA
GAACTTGCCATTACGATATATCTTGATTATCTTTCGACCCAAATCAAAACATTATCCCCATCCCTTATCGAGAAT
ATCATACCTTTGTTGTTTCGCGCTCTTGCCTTCTGCGCTTCCCCGCTTCCCCGTCTCACTATACTCTCTCAGCCA
CTTAGGAAGCCATCTTTGGAGGACAGAGTGTTGGAAACTTTGGTTTCTATATACACAGGGCCGTACTCGACTACG
TGTGTGGGAATGCATAGGCGGTGCTTGTTACCTGCATTTCCTGCCGAAGGGGAAATTGAAACAGAGGAAGGAGAA
CCAATAATGGTGAAGGGAGATGATATCACACCACAGAAAATTTCGAGAGTACCTCTACAAATTGGTTTACTCACT
TCTCTTGGCGGTTATCGAATGATGCGTATGCGACTCCGTCAACTTCTTATCATAAGACTTGCCCGGGCTTATATA
TCTCGAGAGGTCTCTTACTCTTATACGGGCGCGCCTTCGCATCTCGAGTTGGAGCAGGAGTTGATGGAGAAAGCA
TGGCCAAGAGACGACTATCTTCCGAATGCAGATATCGGCATTGGGAGTGTAGCGAACGGCTGGGATCCTCGTAGG
GTTGGGACAGCTGTATCAGAGAGCGTGTGCGCATGGATTGATTGGATTGGGGAAGGGCCTCACACACCCGGTATT
GGCCCTACAGACAAGGATGCTTTCAGAGAAAACTGGGATCGTGAACGCAATCAGGTGGACAAAATCCTAGAGGAA
GCTGCGGGGATGCTTAAGGATCTTCTTCAAGAGGCGGATTCTCGTGAAGAGGACAATCCGTGTTTGAACGACGAG
GAGGCCGCCTTTGTTGGAGGAATCTTATATAACCTCTGTAAATATGTCATTTCTTTGAGAAATCCGGATGGTTCT
CCATATGTGCTTCCGCTGGACAACCCCATCAGTGCGCCAACGCCTTTGTTGAAGTCTATTACGTCTCTCCTTGCA
AGAGATCATACAAGCAACTTAAATCCTCTTCTCTCCACTACTTTGATTTCGATTGTCGAACATCTCACGGACACA
GACACTGCACGACTTCCCGGACTCATGCTAGATCAACATGATCTCACTCCCACCTCTCCTGAGTGGTTGCTAAAC
TGGGAGAATTTGCTTGGAAACTCGATTGCACTCAGCTCCCAACGTCCTTTAACAAAGAGTGCTGCTATGGAGGCG
CTTGCTATTGTTTATGATACTGTGAAGGACATGGCATCATATCGCCGTCCACTAGCGGACCTAGTTTTAAAGTTC
TGTAAAAAATGGGTTGGAGCCCCAGAAATAGAGAGTGAAGATGGCGAACCTCTTTGGAAGGTGCTTGGCGAGGAG
GTCGTACTCCAAGCAATCGAATCATCTGACGGCGAGACTGACGATATCAATGCTATCATTGAACTGCTTACAACA
GTAGCCTCCGAACCGTCTGTGGAAGAAGCAGCGGACAAGGCGGACGCCCACTCAGCGCTGGGTGAATCGCAGGTA
CCTTCCCCTTCCATTGGCACGAGCATCCCATCTGCCTCGAATCTCGTTTCTCCAATCCTTTCTCGGATGCAATCT
GAATTTCATATCGGTGGAAAAGACAAAGATAAAGAATCTGCGATCCCTTCTGTCATGTCTTTACTCTCATCTTTC
ACCTCCGGCAATGTTTCCCGATCTCAATCCACTCAACCAACAATTACGGAGGACCTCCCAGAAGTAGTAGCCGAA
CCTGAGAAGTCCAAATCTTTGCCCCGTGTGGTATCCGCGGTCGCAGCGCTCGTGGACGCTTTTGCTCAAATATCG
TTCACCTCTTATGTGCTTGAGGGTCATCTACATCGCCTTGCTATTCGACTCTATCACATTCTCCTCGAAATTCTG
GCCCAAGGACAATCTGCAAGAGGTAGAGTGACCGTTCTTCAGTTTCTCATGCGACTCCGCGCCGACATCGACCAT
AATATCTTTTTCATTTTCAAAACCTATGACAGAGATGGCTTGGTATCGCGGCTGTCAAGTCTGATCGGTCGGTCG
TCTCTTCCAACAACAGAAAGACACATCGAGGATCCGGAAGGTGACTATTCAGATATCAGAAAATCGCGTCCGAAG
TTCCAGGAACAGGAAGAGAAGGTACAGAGTGGATTTGGCATAGGCAGGTTGTCCAGATCAACAGGAAGTCGTAGT
CGTTCACGGGCTCCTTTGAGAACGTCATCGGTTGAGATTACCAGAAAGCCACGCATGCCTCTTTGGAATCATCCA
GAAGTGTATCCGTTCGTGGTTGCGGACAGTGATTCCGCTAGCGAAGCCCTCATATCATACAATCCCAATGGTCCG
AACGACCTTGTGCTGTCAATCGATCAGTATCTTAAGGTCATTATAGGCATTTTGGAGAGGGAGACTAGTTGGGAT
GTCCTGTCCTACGTTCTCTGTCATTTACCCACTCAGCTCGCCAACAAACATCTATTCTGTGGGCCACTATGCAGT
CAACTCATCTCGCGCCTCCTAAACGTCTTGTGTACTGGGATTTTGAAAGGGGAATTGGGTTTTTACATCGAAGCA
TGGCCACCTGGGTTAAAGCCCAGAGATGCACAAGGGCTGGCATACCACACATTATCTGTGCTGGTAAGTTACAGA
AAATGCTTCGAACAGAAGCAACGATATGTTCTGGTCGAGGTTTTCCAGCAAGGACTCGACGGTCAACTTTCGACT
ATCAAATCCTGTTTGCATGCTCTCACTCTATCCGCATTTGAACTTCGAATATCCGTTACAAAGTGCTTGCCTCGG
ATTCTAGAGAAGTTATCGCAGATCATGTCAAACCCCAACATGTCCGTCCACATCCTAGGCTTCCTCACAATCGTC
GGAACTATCCCTGCGTTGTATGCAAACTTTACGGAAGCAGACTACAAGATGGTATTTGGTGTCGCTCTGCAATAT
CTGCAGCACTACAATCGCCAGAACGCATCTCCTACGGTATCATGGGCTCTGTCGCAATACGTTCGCATTATGTCA
TACACAACCGTGTACGTCTGGTTTCTGGCACTCAAACTACCCGATCGTCCGAAACATATACCATACATAACCCGA
CAATTGCTGCTCGCGAACGAAGCCAAGAAAGAGATTGATATTCCGACTGAAGTGTGCTTTGATTGGCTTGCCAGA
AATGCGTTTGCATCCGCCGATCCACGTCCTGCGAATTCAGCATTTAGCGAGATTGTCATGAACCCTGCCAACCAC
CCCTCTGATCCTAGTCCTTCGGGGCCTGTTCAATCAGGAAAATCGTGGTTGGTAGGTAACGCAGTCGTTACTATT
CGGACCTTGCCACGCGCGGGTTGGGTTGAAATTCTTTCGCGACGTTCATCTGGATTCTCAAAATTAATTTGTCAT
ATTGAGAACGTTCCGATGGTGGGTCCTGGAGAAGTGTCACCAGATATCGTGTCAGTACCTGCGGGTCTCATGTTA
GGTAAAACTCCTACGCGGGTTGCGTCCGCCACGGGGGCAATTGAAGAAGATGTTGAACAGGCTTCAGGAGATAAG
CTACAGGAAGCACTAGTCCCCCAAACTGTTGACGACTCGTCCGAGCCACCTCGACCTGATCCAATCACCGGATAT
GTCTGGAGTAAATCGGCTCCATCCCAAAGACGAAAGGATGTGACATTAGATCCATCATACGTTGCATTACAACTC
TCTAGTTATCCCTTTGGAAATAACAACGCGCGAAAGGTGGAGGATTCCCCTGTGTTGCAACGGTTTCTCTCTACT
CTTGATCGAATTCCCGTGATAGATACTCACAAAGTCGGCATCATGTACGTTGCGCCAGGCCAGACTGATGAGCTC
GAAATCCTCGGAAACACCCATGGCTCTCCCGCCTATACGCACTTCCTTGAAGGCCTTGGTCGACTTGTCAATCTA
AGAGGGCAAGTCGATGTCTACGCTGGGGGTCTCAATCCAGACGAAGATGGAGAGTACGCGTACGCTTGGTGGGAC
GATATAGGACAAATTCTGTACCATACTGCGACTATGATGCCTTCTCATGCTCATGATCCGCATTTCAACTTCAAA
AAGCGCCACATTGGAAACGACTATGTTAGGATTGTCTGGAATGATTCTGGGGGTTCTTACCGTTTCGATACTTTG
ACAACCCAGTTTCAGTTCGTCAACATTGTAATCGAACCTCATTCTGTCGGCGCTATCGCGGCTTTCTCCAGCCTT
AACGATAATGATTACTTCAAAGTGACTATCCAGCAAGCTCCCGGCATGACAGAATTTGCGCCAGTAGGGTTTTTC
AAGTTGATATCTGCCGAAAACCTTCCTCTTCTAGTTCGCCAGCTTAGTTTGTTGGCGGACTGGTTTGCCTCAGTA
TTCGCCGAAACCCAAAAAGACACGGCCCGTGTCGAAGTGACGACTAACTGGTCCGCACGCTTGCAAGCTATTCGC
CGCTTCATGGCACAACTTCCTGAACATGAGGAAGTCGAACCTCTCGAGGGTATTTTTAGTCAAGAATCATCTCGG
GATTTCACAAACACCTTTTAG
Transcript >AgabiH97|037120
ATGAATGGAATGAATCGACTTACTTTGTCTCCCAGCATTTCTGTGGTTCAAAAATCTGCACTACATAAATCCGAC
AATGTTTCCCCATCCCCTGTAGGCACACCACAAGCATCACATCAGCCTACACTTTCTTTAAGTGCCATTATCGAC
GCCCTCAGACCCCCCGCTGTCCCCAGTCTTGCACACGCACGAACCCTTGCAGCTCTCTTAAGTACCGCTTCACCC
CTACCCCGTTGCGCTGCCGTTCAACCGATCATCTCTTCCTTATGCGACTTCAATAATCCTCCGTCTTTGCAGGCT
ATAGGCTTCGACGTTCTCTCATCGTACTGGGAGAACCCAGAAGCTGGTTATGCAGAGACAGCGGATCGTCTATCT
TTCTTCTCTCTATTCTTGGGGCCTACGACTGCATGGGCAGTGGATCTTTGGGAGCCCAGGTTCAAAGCACTCAGA
GCACTCACAAAATATGGTACCGATATCGTTGGTGTCGAGGCAGTCCTGATCAATCTCTTAAAACACTGGCTAAAA
GGTGCTTTCGACGGGTTATTGGATTTGAATGGAGAGTTGTATCGGTCAGAGCGAGTCGAGAGGGAGAGGAGTGTA
GATGTTCTATTCAAGTTTTTGTCCGATGTCCTCAACAGAACCGAAAATATTGCTAGGCTCCCAGAAAACACAGTT
CATCTCACGATAGAGTTCTACGCGAGCCTCGTCGATCACTCAATTGTCGCTCAAAAAGGATCGGAAGTATCGAGT
GACTCGCCAATAGTATCCGATCCTTCGCCATCGCAGCAAAGTTTTGGACTCCATCGACGAAACACTTCTTCACTC
TCGACGTCGTCTATCACATCTCCAAGCACACCAACAGTTCCCTCTACACATCAGACCCTAAATAAGCCTCCTGCA
GAACTTGCCATTACGATATATCTTGATTATCTTTCGACCCAAATCAAAACATTATCCCCATCCCTTATCGAGAAT
ATCATACCTTTGTTGTTTCGCGCTCTTGCCTTCTGCGCTTCCCCGCTTCCCCGTCTCACTATACTCTCTCAGCCA
CTTAGGAAGCCATCTTTGGAGGACAGAGTGTTGGAAACTTTGGTTTCTATATACACAGGGCCGTACTCGACTACG
TGTGTGGGAATGCATAGGCGGTGCTTGTTACCTGCATTTCCTGCCGAAGGGGAAATTGAAACAGAGGAAGGAGAA
CCAATAATGGTGAAGGGAGATGATATCACACCACAGAAAATTTCGAGAGTACCTCTACAAATTGGTTTACTCACT
TCTCTTGGCGGTTATCGAATGATGCGTATGCGACTCCGTCAACTTCTTATCATAAGACTTGCCCGGGCTTATATA
TCTCGAGAGGTCTCTTACTCTTATACGGGCGCGCCTTCGCATCTCGAGTTGGAGCAGGAGTTGATGGAGAAAGCA
TGGCCAAGAGACGACTATCTTCCGAATGCAGATATCGGCATTGGGAGTGTAGCGAACGGCTGGGATCCTCGTAGG
GTTGGGACAGCTGTATCAGAGAGCGTGTGCGCATGGATTGATTGGATTGGGGAAGGGCCTCACACACCCGGTATT
GGCCCTACAGACAAGGATGCTTTCAGAGAAAACTGGGATCGTGAACGCAATCAGGTGGACAAAATCCTAGAGGAA
GCTGCGGGGATGCTTAAGGATCTTCTTCAAGAGGCGGATTCTCGTGAAGAGGACAATCCGTGTTTGAACGACGAG
GAGGCCGCCTTTGTTGGAGGAATCTTATATAACCTCTGTAAATATGTCATTTCTTTGAGAAATCCGGATGGTTCT
CCATATGTGCTTCCGCTGGACAACCCCATCAGTGCGCCAACGCCTTTGTTGAAGTCTATTACGTCTCTCCTTGCA
AGAGATCATACAAGCAACTTAAATCCTCTTCTCTCCACTACTTTGATTTCGATTGTCGAACATCTCACGGACACA
GACACTGCACGACTTCCCGGACTCATGCTAGATCAACATGATCTCACTCCCACCTCTCCTGAGTGGTTGCTAAAC
TGGGAGAATTTGCTTGGAAACTCGATTGCACTCAGCTCCCAACGTCCTTTAACAAAGAGTGCTGCTATGGAGGCG
CTTGCTATTGTTTATGATACTGTGAAGGACATGGCATCATATCGCCGTCCACTAGCGGACCTAGTTTTAAAGTTC
TGTAAAAAATGGGTTGGAGCCCCAGAAATAGAGAGTGAAGATGGCGAACCTCTTTGGAAGGTGCTTGGCGAGGAG
GTCGTACTCCAAGCAATCGAATCATCTGACGGCGAGACTGACGATATCAATGCTATCATTGAACTGCTTACAACA
GTAGCCTCCGAACCGTCTGTGGAAGAAGCAGCGGACAAGGCGGACGCCCACTCAGCGCTGGGTGAATCGCAGGTA
CCTTCCCCTTCCATTGGCACGAGCATCCCATCTGCCTCGAATCTCGTTTCTCCAATCCTTTCTCGGATGCAATCT
GAATTTCATATCGGTGGAAAAGACAAAGATAAAGAATCTGCGATCCCTTCTGTCATGTCTTTACTCTCATCTTTC
ACCTCCGGCAATGTTTCCCGATCTCAATCCACTCAACCAACAATTACGGAGGACCTCCCAGAAGTAGTAGCCGAA
CCTGAGAAGTCCAAATCTTTGCCCCGTGTGGTATCCGCGGTCGCAGCGCTCGTGGACGCTTTTGCTCAAATATCG
TTCACCTCTTATGTGCTTGAGGGTCATCTACATCGCCTTGCTATTCGACTCTATCACATTCTCCTCGAAATTCTG
GCCCAAGGACAATCTGCAAGAGGTAGAGTGACCGTTCTTCAGTTTCTCATGCGACTCCGCGCCGACATCGACCAT
AATATCTTTTTCATTTTCAAAACCTATGACAGAGATGGCTTGGTATCGCGGCTGTCAAGTCTGATCGGTCGGTCG
TCTCTTCCAACAACAGAAAGACACATCGAGGATCCGGAAGGTGACTATTCAGATATCAGAAAATCGCGTCCGAAG
TTCCAGGAACAGGAAGAGAAGGTACAGAGTGGATTTGGCATAGGCAGGTTGTCCAGATCAACAGGAAGTCGTAGT
CGTTCACGGGCTCCTTTGAGAACGTCATCGGTTGAGATTACCAGAAAGCCACGCATGCCTCTTTGGAATCATCCA
GAAGTGTATCCGTTCGTGGTTGCGGACAGTGATTCCGCTAGCGAAGCCCTCATATCATACAATCCCAATGGTCCG
AACGACCTTGTGCTGTCAATCGATCAGTATCTTAAGGTCATTATAGGCATTTTGGAGAGGGAGACTAGTTGGGAT
GTCCTGTCCTACGTTCTCTGTCATTTACCCACTCAGCTCGCCAACAAACATCTATTCTGTGGGCCACTATGCAGT
CAACTCATCTCGCGCCTCCTAAACGTCTTGTGTACTGGGATTTTGAAAGGGGAATTGGGTTTTTACATCGAAGCA
TGGCCACCTGGGTTAAAGCCCAGAGATGCACAAGGGCTGGCATACCACACATTATCTGTGCTGGTAAGTTACAGA
AAATGCTTCGAACAGAAGCAACGATATGTTCTGGTCGAGGTTTTCCAGCAAGGACTCGACGGTCAACTTTCGACT
ATCAAATCCTGTTTGCATGCTCTCACTCTATCCGCATTTGAACTTCGAATATCCGTTACAAAGTGCTTGCCTCGG
ATTCTAGAGAAGTTATCGCAGATCATGTCAAACCCCAACATGTCCGTCCACATCCTAGGCTTCCTCACAATCGTC
GGAACTATCCCTGCGTTGTATGCAAACTTTACGGAAGCAGACTACAAGATGGTATTTGGTGTCGCTCTGCAATAT
CTGCAGCACTACAATCGCCAGAACGCATCTCCTACGGTATCATGGGCTCTGTCGCAATACGTTCGCATTATGTCA
TACACAACCGTGTACGTCTGGTTTCTGGCACTCAAACTACCCGATCGTCCGAAACATATACCATACATAACCCGA
CAATTGCTGCTCGCGAACGAAGCCAAGAAAGAGATTGATATTCCGACTGAAGTGTGCTTTGATTGGCTTGCCAGA
AATGCGTTTGCATCCGCCGATCCACGTCCTGCGAATTCAGCATTTAGCGAGATTGTCATGAACCCTGCCAACCAC
CCCTCTGATCCTAGTCCTTCGGGGCCTGTTCAATCAGGAAAATCGTGGTTGGTAGGTAACGCAGTCGTTACTATT
CGGACCTTGCCACGCGCGGGTTGGGTTGAAATTCTTTCGCGACGTTCATCTGGATTCTCAAAATTAATTTGTCAT
ATTGAGAACGTTCCGATGGTGGGTCCTGGAGAAGTGTCACCAGATATCGTGTCAGTACCTGCGGGTCTCATGTTA
GGTAAAACTCCTACGCGGGTTGCGTCCGCCACGGGGGCAATTGAAGAAGATGTTGAACAGGCTTCAGGAGATAAG
CTACAGGAAGCACTAGTCCCCCAAACTGTTGACGACTCGTCCGAGCCACCTCGACCTGATCCAATCACCGGATAT
GTCTGGAGTAAATCGGCTCCATCCCAAAGACGAAAGGATGTGACATTAGATCCATCATACGTTGCATTACAACTC
TCTAGTTATCCCTTTGGAAATAACAACGCGCGAAAGGTGGAGGATTCCCCTGTGTTGCAACGGTTTCTCTCTACT
CTTGATCGAATTCCCGTGATAGATACTCACAAAGTCGGCATCATGTACGTTGCGCCAGGCCAGACTGATGAGCTC
GAAATCCTCGGAAACACCCATGGCTCTCCCGCCTATACGCACTTCCTTGAAGGCCTTGGTCGACTTGTCAATCTA
AGAGGGCAAGTCGATGTCTACGCTGGGGGTCTCAATCCAGACGAAGATGGAGAGTACGCGTACGCTTGGTGGGAC
GATATAGGACAAATTCTGTACCATACTGCGACTATGATGCCTTCTCATGCTCATGATCCGCATTTCAACTTCAAA
AAGCGCCACATTGGAAACGACTATGTTAGGATTGTCTGGAATGATTCTGGGGGTTCTTACCGTTTCGATACTTTG
ACAACCCAGTTTCAGTTCGTCAACATTGTAATCGAACCTCATTCTGTCGGCGCTATCGCGGCTTTCTCCAGCCTT
AACGATAATGATTACTTCAAAGTGACTATCCAGCAAGCTCCCGGCATGACAGAATTTGCGCCAGTAGGGTTTTTC
AAGTTGATATCTGCCGAAAACCTTCCTCTTCTAGTTCGCCAGCTTAGTTTGTTGGCGGACTGGTTTGCCTCAGTA
TTCGCCGAAACCCAAAAAGACACGGCCCGTGTCGAAGTGACGACTAACTGGTCCGCACGCTTGCAAGCTATTCGC
CGCTTCATGGCACAACTTCCTGAACATGAGGAAGTCGAACCTCTCGAGGGTATTTTTAGTCAAGAATCATCTCGG
GATTTCACAAACACCTTTTAG
Gene >AgabiH97|037120
ATGAATGGAATGAATCGACTTACTTTGTCTCCCAGCATTTCTGTGGTTCAAAAATGTTTGTAGTTCCTCTTATGG
GTCCATTTCTCTTTTGCTAACCATAATCTCTACGTCAGCTGCACTGTGAATGTCCCCGCAGCAACAGGATGCCAG
TGGCTTCGGACGTCCTCGGCAACGTGCAAATACTACTTCATTCGCGTCGTCATTCGGTTGGCGCAGACATAAATC
CGACAATGTTTCCCCATCCCCTGTAGGCACACCACAAGCATCACATCAGCCTACACTTTCTTTAAGTGCCATTAT
CGACGCCCTCAGACCCCCCGCTGTCCCCAGTCTTGCACACGCACGAACCCTTGCAGCTCTCTTAAGTACCGCTTC
ACCCCTACCCCGTTGCGCTGCCGTTCAACCGATCATCTCTTCCTTATGCGACTTCAATAATCCTCCGTCTTTGCA
GGCTATAGGCTTCGACGTTCTCTCATCGTACTGGGAGAACCCAGAAGCTGGTTATGCAGAGACAGCGGATCGTCT
ATCTTTCTTCTCTCTATTCTTGGGGCCTACGACTGCATGGGCAGTGGATCTTTGGGAGCCCAGGTTCAAAGCACT
CAGAGCACTCACAAAATATGGTACCGATATCGTTGGTGTCGAGGCAGTCCTGATCAATCTCTTAAAACACTGGCT
AAAAGGTGCTTTCGACGGGTTATTGGATTTGAATGGAGAGTTGTATCGGTCAGAGCGAGTCGAGAGGGAGAGGAG
TGTAGATGTTCTATTCAAGTTTTTGTCCGATGTCCTCAACAGAACCGAAAATATTGCTAGGCTCCCAGAAAACAC
AGTTCATCTCACGATAGAGTTCTACGCGAGCCTCGTCGATCACTCAATTGTCGCTCAAAAAGGATCGGAAGTATC
GAGTGACTCGCCAATAGTATCCGATCCTTCGCCATCGCAGCAAAGTTTTGGACTCCATCGACGAAACACTTCTTC
ACTCTCGACGTCGTCTATCACATCTCCAAGCACACCAACAGTTCCCTCTACACATCAGACCCTAAATAAGCCTCC
TGCAGAACTTGCCATTACGATATATCTTGATTATCTTTCGACCCAAATCAAAACATTATCCCCATCCCTTATCGA
GAATATCATACCTTTGTTGTTTCGCGCTCTTGCCTTCTGCGCTTCCCCGCTTCCCCGTCTCACTATACTCTCTCA
GCCACTTAGGAAGCCATCTTTGGAGGACAGAGTGTTGGAAACTTTGGTTTCTATATACACAGGGCCGTACTCGAC
TACGTGTGTGGGAATGCATAGGCGGTGCTTGTTACCTGCATTTCCTGCCGAAGGGGAAATTGAAACAGAGGAAGG
AGAACCAATAATGGTGAAGGGAGATGATATCACACCACAGAAAATTTCGAGAGTACCTCTACAAATTGGTTTACT
CACTTCTCTTGGCGGTTATCGAATGATGCGTATGCGACTCCGTCAACTTCTTATCATAAGACTTGCCCGGGCTTA
TATATCTCGAGAGGTCTCTTACTCTTATACGGGCGCGCCTTCGCATCTCGAGTTGGAGCAGGAGTTGATGGAGAA
AGCATGGCCAAGAGACGACTATCTTCCGAATGCAGATATCGGCATTGGGAGTGTAGCGAACGGCTGGGATCCTCG
TAGGGTTGGGACAGCTGTATCAGAGAGCGTGTGCGCATGGATTGATTGGATTGGGGAAGGGCCTCACACACCCGG
TATTGGCCCTACAGACAAGGATGCTTTCAGAGAAAACTGGGATCGTGAACGCAATCAGGTGGACAAAATCCTAGA
GGAAGCTGCGGGGATGCTTAAGGATCTTCTTCAAGAGGCGGATTCTCGTGAAGAGGACAATCCGTGTTTGAACGA
CGAGGAGGCCGCCTTTGTTGGAGGAATCTTATATAACCTCTGTAAATATGTCATTTCTTTGAGGCAAGTCAATTT
CCCGGTTGTCGACGCGCGTCTAACCCATGATCCTAGAAATCCGGATGGTTCTCCATATGTGCTTCCGCTGGACAA
CCCCATCAGTGCGCCAACGCCTTTGTTGAAGTCTATTACGTCTCTCCTTGCAAGAGATCATACAAGCAACTTAAA
TCCTCTTCTCTCCACTACTTTGATTTCGATTGTCGAACATCTCACGGACACAGACACTGCACGACTTCCCGGACT
CATGCTAGATCAACATGATCTCACTCCCACCTCTCCTGAGTGGTTGCTAAACTGGGAGAATTTGCTTGGAAACTC
GATTGCACTCAGCTCCCAACGTCCTTTAACAAAGAGTGCTGCTATGGAGGCGCTTGCTATTGTTTATGATACTGT
GAAGGACATGGCATCATATCGCCGTCCACTAGCGGACCTAGTTTTAAAGTTCTGTAAAAAATGGGTTGGAGCCCC
AGAAATAGAGAGTGAAGATGGCGAACCTCTTTGGAAGGTGCTTGGCGAGGAGGTCGTACTCCAAGCAATCGAATC
ATCTGACGGCGAGACTGACGATATCAATGCTATCATTGAACTGCTTACAACAGTAGCCTCCGAACCGTCTGTGGA
AGAAGCAGCGGACAAGGCGGACGCCCACTCAGCGCTGGGTGAATCGCAGGTACCTTCCCCTTCCATTGGCACGAG
CATCCCATCTGCCTCGAATCTCGTTTCTCCAATCCTTTCTCGGATGCAATCTGAATTTCATATCGGTGGAAAAGA
CAAAGATAAAGAATCTGCGATCCCTTCTGTCATGTCTTTACTCTCATCTTTCACCTCCGGCAATGTTTCCCGATC
TCAATCCACTCAACCAACAATTACGGAGGACCTCCCAGAAGTAGTAGCCGAACCTGAGAAGTCCAAATCTTTGCC
CCGTGTGGTATCCGCGGTCGCAGCGCTCGTGGACGCTTTTGCTCAAATATCGTTCACCTCTTATGTGCTTGAGGG
TCATCTACATCGCCTTGCTATTCGACTCTATCACATTCTCCTCGAAATTCTGGCCCAAGGACAATCTGCAAGAGG
TAGAGTGACCGTTCTTCAGTTTCTCATGCGACTCCGCGCCGACATCGACCATAATATCTTTTTCATTTTCAAAAC
CTATGACAGAGATGGCTTGGTATCGCGGCTGTCAAGTCTGATCGGTCGGTCGTCTCTTCCAACAACAGAAAGACA
CATCGAGGATCCGGAAGGTGACTATTCAGATATCAGAAAATCGCGTCCGAAGTTCCAGGAACAGGAAGAGAAGGT
ACAGAGTGGATTTGGCATAGGCAGGTTGTCCAGATCAACAGGAAGTCGTAGTCGTTCACGGGCTCCTTTGAGAAC
GTCATCGGTTGAGATTACCAGAAAGCCACGCATGCCTCTTTGGAATCATCCAGAAGTGTATCCGTTCGTGGTTGC
GGACAGTGATTCCGCTAGCGAAGCCCTCATATCATACAATCCCAATGGTCCGAACGACCTTGTGCTGTCAATCGA
TCAGTATCTTAAGGTCATTATAGGCATTTTGGAGAGGGAGACTAGTTGGGATGTCCTGTCCTACGTTCTCTGTCA
TTTACCCACTCAGCTCGCCAACAAACATCTATTCTGTGGGCCACTATGCAGTCAACTCATCTCGCGCCTCCTAAA
CGTCTTGTGTACTGGGATTTTGAAAGGGGAATTGGGTTTTTACATCGAAGCATGGCCACCTGGGTTAAAGCCCAG
AGATGCACAAGGGCTGGCATACCACACATTATCTGTGCTGGTAAGTTACAGAAAATGCTTCGAACAGAAGCAACG
ATATGTTCTGGTCGAGGTTTTCCAGCAAGGACTCGACGGTCAACTTTCGACTATCAAATCCTGTTTGCATGCTCT
CACTCTATCCGCATTTGAACTTCGAATATCCGTTACAAAGTGCTTGCCTCGGATTCTAGAGAAGTTATCGCAGAT
CATGTCAAACCCCAACATGTCCGTCCACATCCTAGGCTTCCTCACAATCGTCGGAACTATCCCTGCGTTGTATGC
AAACTTTACGGAAGCAGACTACAAGATGGTATTTGGTGTCGCTCTGCAATATCTGCAGCACTACAATCGCCAGAA
CGCATCTCCTACGGTATCATGGGCTCTGTCGCAATACGTTCGCATTATGTCATACACAACCGTGTACGTCTGGTT
TCTGGCACTCAAACTACCCGATCGTCCGAAACATATACCATACATAACCCGACAATTGCTGCTCGCGAACGAAGC
CAAGAAAGAGATTGATATTCCGACTGAAGTGTGCTTTGATTGGCTTGCCAGAAATGCGTTTGCATCCGCCGATCC
ACGTCCTGCGAATTCAGCATTTAGCGAGATTGTCATGAACCCTGCCAACCACCCCTCTGATCCTAGTCCTTCGGG
GCCTGTTCAATCAGGAAAATCGTGGTTGGTAGGTAACGCAGTCGTTACTATTCGGACCTTGCCACGCGCGGGTTG
GGTTGAAATTCTTTCGCGACGTTCATCTGGATTCTCAAAATTAATTTGTCATATTGAGAACGTTCCGATGGTGGG
TCCTGGAGAAGTGTCACCAGATATCGTGTCAGTACCTGCGGGTCTCATGTTAGGTAAAACTCCTACGCGGGTTGC
GTCCGCCACGGGGGCAATTGAAGAAGATGTTGAACAGGCTTCAGGAGTGCGTATCCTTTATTGTGTCCTTTCACA
TGCTCACACTACACCAGGATAAGCTACAGGAAGCACTAGTCCCCCAAACTGTTGACGACTCGTCCGAGCCACCTC
GACCTGATCCAATCACCGGATATGTCTGGAGTAAATCGGCTCCATCCCAAAGACGAAAGGATGTGACATTAGATC
CATCATACGTTGCATTACAACTCTCTAGTTATCCCTTTGGAAATAACAACGCGCGAAAGGTGGAGGATTCCCCTG
TGTTGCAACGGTTTCTCTCTACTCTTGATCGAATTCCCGTGATAGATACTCACAAAGTCGGCATCATGTACGTTG
CGCCAGGCCAGACTGATGAGCTCGAAATCCTCGGAAACACCCATGGCTCTCCCGCCTATACGCACTTCCTTGAAG
GCCTTGGTCGACTTGTCAATCTAAGAGGGCAAGTCGATGTCTACGCTGGGGGTCTCAATCCAGACGAAGATGGAG
AGTACGCGTACGCTTGGTGGGACGATATAGGACAAATTCTGTACCATACTGCGACTATGATGCCTTCTCATGCTC
ATGATCCGCATTTCAACTTCAAAAAGCGCCACATTGGAAACGACTATGTTAGGATTGTCTGGAATGATTCTGGGG
GTTCTTACCGTTTCGATACTTTGACAACCCAGTTTCAGTTCGTCAACATTGTAATCGAACCTCATTCTGTCGGCG
CTATCGCGGCTTTCTCCAGCCTTAACGATAATGATTACTTCAAAGTGACTATCCAGCAAGCTCCCGGCATGACAG
AATTTGCGCCAGTAGGGTTTTTCAAGTTGATATCTGCCGAAAACCTTCCTCTTCTAGTTCGCCAGCTTAGTTTGT
TGGCGGACTGGTTTGCCTCAGTATTCGCCGAAACCCAAAAAGACACGGCCCGTGTCGAAGTGACGACTAACTGGT
CCGCACGCTTGCAAGCTATTCGCCGCTTCATGGCACAACTTCCTGAACATGAGGAAGTCGAACCTCTCGAGGGTA
TTTTTAGTCAAGAATCATCTCGGGATTTCACAAACACCTTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail