Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|036980
Gene name
Locationscaffold_13:897140..901548
Strand-
Gene length (bp)4408
Transcript length (bp)4293
Coding sequence length (bp)4293
Protein length (aa) 1431

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07727 RVT_2 Reverse transcriptase (RNA-dependent DNA polymerase) 8.2E-52 934 1173
PF14223 Retrotran_gag_2 gag-polypeptide of LTR copia-type 8.8E-12 77 193
PF13976 gag_pre-integrs GAG-pre-integrase domain 1.1E-11 460 534
PF00665 rve Integrase core domain 1.1E-09 549 648

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P10978|POLX_TOBAC Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum PE=2 SV=1 105 1409 6.0E-173
sp|P04146|COPIA_DROME Copia protein OS=Drosophila melanogaster GN=GIP PE=1 SV=3 902 1401 2.0E-89
sp|P04146|COPIA_DROME Copia protein OS=Drosophila melanogaster GN=GIP PE=1 SV=3 349 777 3.0E-41
sp|P25600|YCH4_YEAST Putative transposon Ty5-1 protein YCL074W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY5A PE=5 SV=2 1013 1314 2.0E-35
sp|P92519|M810_ARATH Uncharacterized mitochondrial protein AtMg00810 OS=Arabidopsis thaliana GN=AtMg00810 PE=4 SV=1 1097 1325 6.0E-34
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P10978|POLX_TOBAC Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum PE=2 SV=1 105 1409 6.0E-173
sp|P04146|COPIA_DROME Copia protein OS=Drosophila melanogaster GN=GIP PE=1 SV=3 902 1401 2.0E-89
sp|P04146|COPIA_DROME Copia protein OS=Drosophila melanogaster GN=GIP PE=1 SV=3 349 777 3.0E-41
sp|P25600|YCH4_YEAST Putative transposon Ty5-1 protein YCL074W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY5A PE=5 SV=2 1013 1314 2.0E-35
sp|P92519|M810_ARATH Uncharacterized mitochondrial protein AtMg00810 OS=Arabidopsis thaliana GN=AtMg00810 PE=4 SV=1 1097 1325 6.0E-34
sp|Q12501|YO22B_YEAST Transposon Ty2-OR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-OR2 PE=1 SV=1 412 695 9.0E-26
sp|P0C2J5|YL22B_YEAST Transposon Ty2-LR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-LR2 PE=5 SV=1 412 695 3.0E-25
sp|Q12472|YD21B_YEAST Transposon Ty2-DR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR1 PE=1 SV=3 412 695 3.0E-25
sp|P25384|YC21B_YEAST Transposon Ty2-C Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-C PE=3 SV=2 412 695 3.0E-25
sp|P0CX64|YG22B_YEAST Transposon Ty2-GR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-GR2 PE=3 SV=1 412 695 3.0E-25
sp|P0CX63|YF21B_YEAST Transposon Ty2-F Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-F PE=3 SV=1 412 695 3.0E-25
sp|Q12491|YB21B_YEAST Transposon Ty2-B Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-B PE=3 SV=1 412 695 3.0E-25
sp|P0C2J3|YL21B_YEAST Transposon Ty2-LR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-LR1 PE=3 SV=1 412 695 3.0E-25
sp|Q12337|YG21B_YEAST Transposon Ty2-GR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-GR1 PE=5 SV=2 412 695 4.0E-25
sp|Q03494|YD22B_YEAST Transposon Ty2-DR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR2 PE=3 SV=2 412 695 4.0E-25
sp|Q12113|YO21B_YEAST Transposon Ty2-OR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-OR1 PE=3 SV=1 412 695 4.0E-25
sp|Q07791|YD23B_YEAST Transposon Ty2-DR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR3 PE=3 SV=1 412 695 4.0E-25
sp|Q03434|YM12B_YEAST Transposon Ty1-ML2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ML2 PE=3 SV=2 412 744 1.0E-23
sp|Q12193|YB12B_YEAST Transposon Ty1-BR Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-BR PE=3 SV=1 412 777 1.0E-23
sp|Q04711|YM11B_YEAST Transposon Ty1-ML1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ML1 PE=3 SV=2 412 744 1.0E-23
sp|Q99231|YD12B_YEAST Transposon Ty1-DR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR3 PE=1 SV=2 412 777 1.0E-23
sp|Q04670|YM14B_YEAST Transposon Ty1-MR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-MR2 PE=3 SV=2 412 744 1.0E-23
sp|P0C2I9|YP12B_YEAST Transposon Ty1-PR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR1 PE=3 SV=1 412 744 1.0E-23
sp|Q92393|YO12B_YEAST Transposon Ty1-OR Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-OR PE=3 SV=1 412 744 1.0E-23
sp|Q03612|YE11B_YEAST Transposon Ty1-ER1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ER1 PE=3 SV=1 412 744 1.0E-23
sp|Q07793|YD13B_YEAST Transposon Ty1-DR4 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR4 PE=3 SV=2 412 744 1.0E-23
sp|Q99337|YN12B_YEAST Transposon Ty1-NL2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-NL2 PE=3 SV=1 412 744 1.0E-23
sp|O13535|YH11B_YEAST Transposon Ty1-H Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-H PE=3 SV=1 412 744 1.0E-23
sp|Q07163|TY1AB_YEASX Transposon TyH3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae GN=TY1B PE=1 SV=2 412 744 1.0E-23
sp|P0C2I2|YD14B_YEAST Transposon Ty1-DR5 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR5 PE=3 SV=1 412 744 1.0E-23
sp|Q12273|YO11B_YEAST Transposon Ty1-OL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-OL PE=3 SV=1 412 744 1.0E-23
sp|Q03855|YD11B_YEAST Transposon Ty1-DR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR1 PE=3 SV=2 412 744 1.0E-23
sp|P47100|YJ12B_YEAST Transposon Ty1-JR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-JR2 PE=3 SV=3 412 744 1.0E-23
sp|Q12316|YG13B_YEAST Transposon Ty1-GR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR3 PE=3 SV=3 412 744 1.0E-23
sp|Q12490|YB11B_YEAST Transposon Ty1-BL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-BL PE=1 SV=1 412 744 2.0E-23
sp|Q12414|YP11B_YEAST Transposon Ty1-PL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PL PE=3 SV=1 412 744 2.0E-23
sp|P0C2I7|YL14B_YEAST Transposon Ty1-LR4 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR4 PE=5 SV=1 412 744 2.0E-23
sp|Q03619|YE12B_YEAST Transposon Ty1-ER2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ER2 PE=3 SV=1 412 744 2.0E-23
sp|Q12088|YL11B_YEAST Transposon Ty1-LR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR1 PE=3 SV=1 412 744 2.0E-23
sp|Q12269|YG12B_YEAST Transposon Ty1-GR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR2 PE=3 SV=3 412 744 2.0E-23
sp|P0C2I5|YL12B_YEAST Transposon Ty1-LR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR2 PE=3 SV=1 412 744 2.0E-23
sp|Q12112|YN11B_YEAST Transposon Ty1-NL1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-NL1 PE=3 SV=1 412 744 2.0E-23
sp|P0C2I6|YL13B_YEAST Transposon Ty1-LR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR3 PE=3 SV=1 412 744 2.0E-23
sp|Q04214|YM13B_YEAST Transposon Ty1-MR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-MR1 PE=1 SV=2 412 744 2.0E-23
sp|P0C2J1|YP14B_YEAST Transposon Ty1-PR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR3 PE=1 SV=1 412 744 2.0E-23
sp|P47098|YJ11B_YEAST Transposon Ty1-JR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-JR1 PE=3 SV=3 412 744 2.0E-23
sp|Q12141|YG11B_YEAST Transposon Ty1-GR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR1 PE=3 SV=1 412 744 2.0E-23
sp|P0C2I3|YD15B_YEAST Transposon Ty1-DR6 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR6 PE=3 SV=1 412 744 4.0E-23
sp|P0C2J0|YP13B_YEAST Transposon Ty1-PR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR2 PE=3 SV=1 412 744 8.0E-23
sp|A0A0B7P3V8|YP41B_YEAST Transposon Ty4-P Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY4B-P PE=5 SV=2 382 705 3.0E-19
sp|P0C2J7|YH41B_YEAST Transposon Ty4-H Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY4B-H PE=3 SV=1 382 705 5.0E-19
sp|P47024|YJ41B_YEAST Transposon Ty4-J Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY4B-J PE=3 SV=3 382 705 1.0E-18
sp|Q12491|YB21B_YEAST Transposon Ty2-B Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-B PE=3 SV=1 944 1401 2.0E-18
sp|Q99337|YN12B_YEAST Transposon Ty1-NL2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-NL2 PE=3 SV=1 944 1401 5.0E-18
sp|Q12337|YG21B_YEAST Transposon Ty2-GR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-GR1 PE=5 SV=2 944 1401 8.0E-18
sp|P25384|YC21B_YEAST Transposon Ty2-C Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-C PE=3 SV=2 944 1401 9.0E-18
sp|P0CX64|YG22B_YEAST Transposon Ty2-GR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-GR2 PE=3 SV=1 944 1401 9.0E-18
sp|P0CX63|YF21B_YEAST Transposon Ty2-F Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-F PE=3 SV=1 944 1401 9.0E-18
sp|P0C2I3|YD15B_YEAST Transposon Ty1-DR6 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR6 PE=3 SV=1 879 1401 9.0E-18
sp|Q12501|YO22B_YEAST Transposon Ty2-OR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-OR2 PE=1 SV=1 944 1401 1.0E-17
sp|Q12472|YD21B_YEAST Transposon Ty2-DR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR1 PE=1 SV=3 944 1401 1.0E-17
sp|P0C2J3|YL21B_YEAST Transposon Ty2-LR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-LR1 PE=3 SV=1 944 1401 1.0E-17
sp|Q03494|YD22B_YEAST Transposon Ty2-DR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR2 PE=3 SV=2 944 1401 1.0E-17
sp|Q07791|YD23B_YEAST Transposon Ty2-DR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR3 PE=3 SV=1 944 1401 1.0E-17
sp|P0C2I7|YL14B_YEAST Transposon Ty1-LR4 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR4 PE=5 SV=1 879 1401 1.0E-17
sp|Q12113|YO21B_YEAST Transposon Ty2-OR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-OR1 PE=3 SV=1 944 1401 2.0E-17
sp|Q04214|YM13B_YEAST Transposon Ty1-MR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-MR1 PE=1 SV=2 944 1401 2.0E-17
sp|Q99231|YD12B_YEAST Transposon Ty1-DR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR3 PE=1 SV=2 944 1401 3.0E-17
sp|Q03855|YD11B_YEAST Transposon Ty1-DR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR1 PE=3 SV=2 944 1401 3.0E-17
sp|Q12141|YG11B_YEAST Transposon Ty1-GR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR1 PE=3 SV=1 879 1401 3.0E-17
sp|Q12490|YB11B_YEAST Transposon Ty1-BL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-BL PE=1 SV=1 944 1401 5.0E-17
sp|Q12269|YG12B_YEAST Transposon Ty1-GR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR2 PE=3 SV=3 944 1401 7.0E-17
sp|Q07163|TY1AB_YEASX Transposon TyH3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae GN=TY1B PE=1 SV=2 879 1401 1.0E-16
sp|P47100|YJ12B_YEAST Transposon Ty1-JR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-JR2 PE=3 SV=3 879 1401 1.0E-16
sp|P0C2J7|YH41B_YEAST Transposon Ty4-H Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY4B-H PE=3 SV=1 924 1402 1.0E-16
sp|Q03434|YM12B_YEAST Transposon Ty1-ML2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ML2 PE=3 SV=2 879 1401 2.0E-16
sp|Q04670|YM14B_YEAST Transposon Ty1-MR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-MR2 PE=3 SV=2 944 1401 2.0E-16
sp|Q03612|YE11B_YEAST Transposon Ty1-ER1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ER1 PE=3 SV=1 879 1401 2.0E-16
sp|Q12273|YO11B_YEAST Transposon Ty1-OL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-OL PE=3 SV=1 879 1401 2.0E-16
sp|Q12414|YP11B_YEAST Transposon Ty1-PL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PL PE=3 SV=1 879 1401 2.0E-16
sp|P0C2I5|YL12B_YEAST Transposon Ty1-LR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR2 PE=3 SV=1 879 1401 2.0E-16
sp|Q12112|YN11B_YEAST Transposon Ty1-NL1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-NL1 PE=3 SV=1 944 1401 2.0E-16
sp|P47024|YJ41B_YEAST Transposon Ty4-J Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY4B-J PE=3 SV=3 924 1402 2.0E-16
sp|Q03619|YE12B_YEAST Transposon Ty1-ER2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ER2 PE=3 SV=1 944 1401 3.0E-16
sp|O13527|YA11B_YEAST Truncated transposon Ty1-A Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-A PE=3 SV=3 944 1401 4.0E-16
sp|Q12193|YB12B_YEAST Transposon Ty1-BR Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-BR PE=3 SV=1 944 1401 5.0E-16
sp|P0C2I6|YL13B_YEAST Transposon Ty1-LR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR3 PE=3 SV=1 944 1401 7.0E-16
sp|P0C2I9|YP12B_YEAST Transposon Ty1-PR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR1 PE=3 SV=1 944 1401 8.0E-16
sp|Q04711|YM11B_YEAST Transposon Ty1-ML1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ML1 PE=3 SV=2 944 1401 1.0E-15
sp|O13535|YH11B_YEAST Transposon Ty1-H Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-H PE=3 SV=1 879 1401 1.0E-15
sp|P0C2I2|YD14B_YEAST Transposon Ty1-DR5 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR5 PE=3 SV=1 944 1401 1.0E-15
sp|P47098|YJ11B_YEAST Transposon Ty1-JR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-JR1 PE=3 SV=3 879 1401 1.0E-15
sp|P0C2J0|YP13B_YEAST Transposon Ty1-PR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR2 PE=3 SV=1 944 1401 1.0E-15
sp|O13527|YA11B_YEAST Truncated transposon Ty1-A Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-A PE=3 SV=3 508 744 1.0E-15
sp|Q92393|YO12B_YEAST Transposon Ty1-OR Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-OR PE=3 SV=1 944 1401 2.0E-15
sp|Q12316|YG13B_YEAST Transposon Ty1-GR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR3 PE=3 SV=3 944 1401 2.0E-15
sp|Q12088|YL11B_YEAST Transposon Ty1-LR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR1 PE=3 SV=1 944 1401 2.0E-15
sp|P0C2J1|YP14B_YEAST Transposon Ty1-PR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR3 PE=1 SV=1 944 1401 2.0E-14
sp|P92520|M820_ARATH Uncharacterized mitochondrial protein AtMg00820 OS=Arabidopsis thaliana GN=AtMg00820 PE=4 SV=1 918 1003 1.0E-09
sp|P92512|M710_ARATH Uncharacterized mitochondrial protein AtMg00710 OS=Arabidopsis thaliana GN=AtMg00710 PE=4 SV=1 661 745 1.0E-08
sp|P10394|POL4_DROME Retrovirus-related Pol polyprotein from transposon 412 OS=Drosophila melanogaster GN=POL PE=3 SV=1 550 703 3.0E-08
sp|P93290|M240_ARATH Uncharacterized mitochondrial protein AtMg00240 OS=Arabidopsis thaliana GN=AtMg00240 PE=4 SV=1 1207 1284 6.0E-08
sp|Q87040|POL_SFVCP Pro-Pol polyprotein OS=Simian foamy virus (isolate chimpanzee) GN=pol PE=3 SV=1 524 681 1.0E-06
sp|Q07793|YD13B_YEAST Transposon Ty1-DR4 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR4 PE=3 SV=2 879 1258 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0015074 DNA integration Yes
GO:0008150 biological_process No
GO:0006259 DNA metabolic process No
GO:0044238 primary metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0009987 cellular process No
GO:0071704 organic substance metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0008152 metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0044237 cellular metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|036980
MSQNTPPIFPDTDKFDGTNWVAWSGLINIAADLRGVSDYLEGTIPQPSSSRTTAAKDEPAPSTDTSWESHTPTPA
EWKIRNAWAKGLLIYNTKDPIGLGIALSGTAAEAWKSYKDQYAKVSEIAILNAERDLRDITYLDNHDFLEHISRL
RTKWATATALGAQINDKTFRTIVLSSLPRSWDPIVSTLYSTTTSREAIAILATHWARISKNRVVNPQNATTALQE
EERRDSSLPGLERKEGEKEEIMEHPTRPLTRHRYPPHNTQDDPQVYVLSSITSNIDQVPRTNLITAAVIPDHHSS
PRSSKPSVNADDLGGAKRDEFGDTVDTISAMSSSSSTHEMNTKADLLTLLDSGATDHCFASCESFALFKPLSAPR
NGHSANKSAVFDITGHGTVEIYTPKDGAVAKIFISDALYSPELRHNLISISKLTAKGMNVTFNGDTAMVCDQKGT
TVLVAVKMNGLYVVNTIQRGSQISSHLMQAKRKAVPFDTWHRRLGHAGETAIKEMLRLNLVNGLDIDGRHELGGM
CEDCIYGKHTTHPYSDKRDVEAEVLERVHVDIWGPAPIQSAGGSRYLMVLVDGASSYRHVIPIHDKSAETTLTHL
KEFQTQSELQTGKKLKRIRMDMGREWHNHVWETYAKEKGIVLEFTTPYAHQQNGVAERSMQTLVELGRSMLAESG
LPQRYWADAFTTAGYIKNLLPTSRVPGKIPATIWTGKRQDISHLRAYGSTAYAHIPLDLGTSKLAPRSVKLTLIG
YFGTTGYKLLDRTTGGIFRSRDVIFDEGKTHFTSRPTPTADDFITPINSQPPPTTLPSAIAPRPHQITTLHDDDN
EHASLPDPDRVDSDAEERLIEEALTADEDHTTDATRVVPSVPVRRLSRVSRPSKRMQETLEYQQHTKANMIDTSS
ENWIPKNYREAMTRSELWLPPMVKEFGMMKEKGVFEVVDRPVGRNVVDSRWVFTLKFDEDGNITARKARIVAKGF
TQVLGEDYDETYASVARMESVRMVCAIAASRGMRLWQVDFVSAFLNSDSQYDVYMEPPKGFEEGEGKVWRLLKTL
YGTMQGAHDWAKNLDKTYQGHGYYKSKADSQVRSKVEDGEFTITSTWTDDVLGASTTHIGELKAKDELARSYEVK
DLGEAHFILGMRIDRNNKGDIRLSQKAFCERLLSRFNMTDAKPRSTPLPAGISLSSNDAPQNDYESNEMKKVPYR
EALGSLMWLQVATRPELSFAVNLLSHFANNPGRAHWEALKHTLAYVKATMDYGITYRKGGSLKPVGYVDADYAGD
GDTMRSTEGHVFFVAGGAVSWVSKRQETVAVSTVEAEYMGFTRAAQQAIWLEKFLDEVGLRQDGPTTIHTDNNGA
IANTKNDKNHRRTKHINVKYHFVKEKVDNGDITFIYTPSATNLADILTKPLARDAVTRCCIGIDIRGGVKSENAE
VGGVL*
Coding >AgabiH97|036980
ATGTCTCAGAACACACCTCCTATTTTCCCAGACACCGACAAGTTCGATGGCACGAACTGGGTAGCTTGGAGCGGC
TTGATCAATATAGCCGCTGACCTCAGAGGCGTATCGGATTACCTTGAAGGAACTATACCCCAACCTTCTAGCAGC
AGGACAACAGCTGCCAAGGATGAGCCCGCACCGTCAACTGACACTTCCTGGGAATCACATACCCCTACTCCCGCC
GAATGGAAAATACGTAACGCATGGGCTAAAGGACTGCTCATATACAACACCAAAGACCCGATAGGACTCGGTATC
GCTCTCTCAGGAACAGCAGCCGAAGCATGGAAGTCCTATAAGGACCAATATGCGAAAGTATCAGAGATTGCCATA
TTGAATGCAGAACGAGACCTGCGAGACATCACCTACCTGGATAACCATGACTTCCTCGAACACATATCCAGACTA
CGCACAAAATGGGCTACCGCCACAGCCCTCGGAGCCCAGATAAACGACAAAACCTTCAGAACCATCGTCTTATCT
TCCCTACCCCGATCATGGGATCCTATAGTATCCACACTTTATAGTACGACAACTTCGAGGGAAGCCATTGCGATA
CTCGCCACGCATTGGGCTCGCATCAGCAAAAATCGGGTCGTGAACCCTCAAAATGCTACTACGGCTCTCCAGGAG
GAGGAAAGGCGGGACAGTTCCCTGCCTGGTTTGGAAAGAAAGGAGGGGGAAAAGGAGGAAATAATGGAGCATCCA
ACACGTCCTTTAACACGGCATCGATACCCACCTCATAATACCCAAGACGACCCACAAGTCTATGTCCTATCATCA
ATCACGTCGAACATAGACCAGGTACCACGCACCAATCTTATCACCGCTGCTGTCATCCCTGACCATCACTCTTCA
CCTAGATCATCTAAGCCATCCGTCAACGCTGATGATCTAGGAGGTGCTAAAAGAGATGAGTTTGGGGATACGGTA
GATACTATATCGGCAATGTCATCATCATCGTCTACCCATGAAATGAATACGAAGGCAGATTTGCTCACCCTCCTC
GATTCCGGTGCCACCGATCATTGTTTTGCTAGCTGTGAATCATTCGCATTGTTTAAACCATTGTCAGCGCCTAGG
AACGGTCACTCAGCCAATAAATCAGCTGTCTTCGACATAACAGGACACGGTACAGTCGAGATATACACACCGAAG
GATGGGGCTGTCGCAAAGATCTTCATTTCGGATGCACTTTATTCCCCAGAACTACGCCATAACCTCATCTCAATC
TCGAAGCTGACAGCGAAAGGGATGAACGTCACTTTCAACGGTGATACTGCGATGGTTTGCGACCAGAAGGGGACT
ACAGTCCTTGTAGCAGTTAAAATGAACGGTCTATATGTCGTCAACACCATCCAACGTGGATCACAAATATCATCT
CACCTGATGCAAGCCAAACGGAAGGCAGTTCCATTTGATACTTGGCACCGCCGCCTCGGACACGCTGGTGAAACT
GCGATAAAGGAGATGTTGCGTTTAAACTTGGTCAATGGGCTGGACATCGATGGCAGACACGAATTAGGTGGCATG
TGTGAAGATTGTATCTATGGGAAACACACAACTCACCCGTACTCCGATAAACGAGACGTAGAAGCTGAGGTTTTG
GAGAGAGTTCATGTAGACATCTGGGGACCGGCCCCTATCCAATCAGCTGGGGGCTCAAGATATCTCATGGTGCTT
GTTGATGGCGCCTCCTCGTACCGACACGTTATCCCTATCCATGATAAATCGGCTGAGACAACGCTTACTCACCTC
AAAGAGTTCCAAACGCAATCTGAACTACAGACTGGAAAGAAGTTGAAGCGGATAAGGATGGACATGGGACGGGAA
TGGCATAACCATGTCTGGGAGACGTATGCGAAAGAGAAGGGAATAGTCTTGGAGTTTACCACCCCCTATGCCCAT
CAACAAAATGGGGTCGCCGAACGGTCCATGCAAACATTGGTTGAGTTGGGGAGATCAATGCTCGCCGAATCCGGT
CTTCCACAACGTTATTGGGCAGACGCCTTTACTACGGCAGGCTATATTAAGAACCTATTACCTACATCACGCGTT
CCCGGGAAAATTCCCGCTACAATCTGGACTGGTAAACGACAAGACATCTCTCATCTCCGTGCCTATGGATCAACA
GCATATGCTCACATACCTCTCGATCTGGGAACCTCAAAACTTGCACCACGTTCAGTTAAACTGACACTCATTGGA
TACTTCGGTACCACTGGCTACAAATTACTCGATAGGACGACGGGAGGAATCTTCCGCTCCCGAGACGTAATATTT
GATGAAGGCAAAACCCATTTTACCTCACGGCCGACTCCAACCGCAGACGATTTTATCACTCCTATAAACAGCCAA
CCACCTCCTACCACACTCCCTAGCGCAATTGCTCCACGACCTCACCAGATAACAACGCTCCACGATGATGACAAT
GAACATGCTAGTCTACCAGACCCTGACAGGGTTGACAGTGATGCCGAGGAAAGATTGATCGAGGAAGCTTTGACA
GCTGATGAGGATCATACCACCGACGCCACAAGGGTCGTACCATCCGTCCCTGTCAGGAGATTGAGTAGAGTCTCT
CGTCCGTCTAAACGAATGCAAGAAACACTGGAATACCAGCAACATACCAAAGCGAACATGATAGACACCTCTAGT
GAAAATTGGATACCAAAGAACTATCGTGAGGCGATGACGCGTTCCGAGTTGTGGTTACCACCGATGGTGAAGGAG
TTTGGGATGATGAAGGAGAAAGGCGTGTTTGAGGTGGTGGATCGACCAGTTGGTAGGAATGTGGTAGATTCTAGA
TGGGTATTCACGTTGAAATTTGATGAAGACGGCAATATTACGGCGAGGAAGGCTAGAATTGTTGCGAAAGGATTT
ACACAGGTGTTGGGGGAAGATTATGATGAAACATACGCGTCAGTGGCTCGGATGGAATCTGTTAGGATGGTTTGT
GCTATCGCGGCTTCTAGAGGAATGCGGTTATGGCAAGTGGACTTCGTTTCGGCTTTCCTGAACAGTGATAGCCAG
TACGATGTTTACATGGAACCTCCGAAAGGGTTTGAAGAGGGGGAGGGAAAAGTATGGCGTTTGCTTAAAACCCTC
TACGGCACCATGCAAGGTGCTCACGACTGGGCCAAAAACCTCGACAAAACTTACCAAGGCCACGGCTACTACAAG
TCCAAAGCTGACTCCCAAGTCCGCTCAAAAGTCGAGGACGGTGAATTCACAATCACTTCGACCTGGACCGATGAT
GTTCTAGGCGCCTCAACCACTCATATTGGTGAACTCAAGGCAAAAGATGAACTCGCTCGTAGCTACGAGGTCAAA
GATCTCGGTGAAGCCCACTTTATTCTAGGTATGCGCATCGATCGTAACAACAAGGGAGACATTCGCCTCTCTCAG
AAAGCCTTTTGTGAACGACTTCTTTCGCGTTTCAATATGACCGATGCCAAGCCCAGATCTACCCCCCTTCCAGCA
GGTATATCACTATCTTCCAACGACGCACCACAAAACGACTACGAGTCAAACGAGATGAAGAAAGTTCCGTATCGT
GAAGCGCTTGGTTCTTTAATGTGGCTCCAAGTCGCAACCAGACCTGAATTATCCTTTGCCGTCAATCTCCTCTCC
CATTTTGCCAACAACCCTGGTCGAGCGCATTGGGAAGCGCTGAAGCATACCCTTGCGTACGTTAAGGCGACGATG
GATTATGGTATCACTTACAGGAAGGGAGGAAGCCTTAAACCCGTAGGTTATGTGGACGCTGATTATGCTGGTGAT
GGAGATACTATGAGATCCACCGAGGGACATGTCTTCTTTGTAGCAGGGGGAGCGGTATCCTGGGTGAGTAAACGG
CAAGAGACTGTAGCAGTCTCAACGGTCGAAGCTGAATATATGGGCTTTACGAGGGCGGCTCAACAAGCTATATGG
CTCGAGAAGTTCCTCGACGAGGTTGGCTTACGACAGGACGGACCCACTACAATCCACACAGACAATAACGGAGCG
ATTGCCAACACTAAGAACGACAAAAATCACCGCAGGACAAAACACATCAACGTCAAATATCATTTTGTCAAAGAA
AAGGTCGACAATGGTGACATCACGTTTATCTATACTCCGTCGGCCACAAACCTTGCGGACATCTTAACAAAGCCT
CTAGCTCGGGATGCAGTCACTCGCTGTTGCATAGGGATTGATATTCGAGGGGGAGTCAAGAGCGAGAATGCCGAA
GTAGGGGGAGTGTTGTGA
Transcript >AgabiH97|036980
ATGTCTCAGAACACACCTCCTATTTTCCCAGACACCGACAAGTTCGATGGCACGAACTGGGTAGCTTGGAGCGGC
TTGATCAATATAGCCGCTGACCTCAGAGGCGTATCGGATTACCTTGAAGGAACTATACCCCAACCTTCTAGCAGC
AGGACAACAGCTGCCAAGGATGAGCCCGCACCGTCAACTGACACTTCCTGGGAATCACATACCCCTACTCCCGCC
GAATGGAAAATACGTAACGCATGGGCTAAAGGACTGCTCATATACAACACCAAAGACCCGATAGGACTCGGTATC
GCTCTCTCAGGAACAGCAGCCGAAGCATGGAAGTCCTATAAGGACCAATATGCGAAAGTATCAGAGATTGCCATA
TTGAATGCAGAACGAGACCTGCGAGACATCACCTACCTGGATAACCATGACTTCCTCGAACACATATCCAGACTA
CGCACAAAATGGGCTACCGCCACAGCCCTCGGAGCCCAGATAAACGACAAAACCTTCAGAACCATCGTCTTATCT
TCCCTACCCCGATCATGGGATCCTATAGTATCCACACTTTATAGTACGACAACTTCGAGGGAAGCCATTGCGATA
CTCGCCACGCATTGGGCTCGCATCAGCAAAAATCGGGTCGTGAACCCTCAAAATGCTACTACGGCTCTCCAGGAG
GAGGAAAGGCGGGACAGTTCCCTGCCTGGTTTGGAAAGAAAGGAGGGGGAAAAGGAGGAAATAATGGAGCATCCA
ACACGTCCTTTAACACGGCATCGATACCCACCTCATAATACCCAAGACGACCCACAAGTCTATGTCCTATCATCA
ATCACGTCGAACATAGACCAGGTACCACGCACCAATCTTATCACCGCTGCTGTCATCCCTGACCATCACTCTTCA
CCTAGATCATCTAAGCCATCCGTCAACGCTGATGATCTAGGAGGTGCTAAAAGAGATGAGTTTGGGGATACGGTA
GATACTATATCGGCAATGTCATCATCATCGTCTACCCATGAAATGAATACGAAGGCAGATTTGCTCACCCTCCTC
GATTCCGGTGCCACCGATCATTGTTTTGCTAGCTGTGAATCATTCGCATTGTTTAAACCATTGTCAGCGCCTAGG
AACGGTCACTCAGCCAATAAATCAGCTGTCTTCGACATAACAGGACACGGTACAGTCGAGATATACACACCGAAG
GATGGGGCTGTCGCAAAGATCTTCATTTCGGATGCACTTTATTCCCCAGAACTACGCCATAACCTCATCTCAATC
TCGAAGCTGACAGCGAAAGGGATGAACGTCACTTTCAACGGTGATACTGCGATGGTTTGCGACCAGAAGGGGACT
ACAGTCCTTGTAGCAGTTAAAATGAACGGTCTATATGTCGTCAACACCATCCAACGTGGATCACAAATATCATCT
CACCTGATGCAAGCCAAACGGAAGGCAGTTCCATTTGATACTTGGCACCGCCGCCTCGGACACGCTGGTGAAACT
GCGATAAAGGAGATGTTGCGTTTAAACTTGGTCAATGGGCTGGACATCGATGGCAGACACGAATTAGGTGGCATG
TGTGAAGATTGTATCTATGGGAAACACACAACTCACCCGTACTCCGATAAACGAGACGTAGAAGCTGAGGTTTTG
GAGAGAGTTCATGTAGACATCTGGGGACCGGCCCCTATCCAATCAGCTGGGGGCTCAAGATATCTCATGGTGCTT
GTTGATGGCGCCTCCTCGTACCGACACGTTATCCCTATCCATGATAAATCGGCTGAGACAACGCTTACTCACCTC
AAAGAGTTCCAAACGCAATCTGAACTACAGACTGGAAAGAAGTTGAAGCGGATAAGGATGGACATGGGACGGGAA
TGGCATAACCATGTCTGGGAGACGTATGCGAAAGAGAAGGGAATAGTCTTGGAGTTTACCACCCCCTATGCCCAT
CAACAAAATGGGGTCGCCGAACGGTCCATGCAAACATTGGTTGAGTTGGGGAGATCAATGCTCGCCGAATCCGGT
CTTCCACAACGTTATTGGGCAGACGCCTTTACTACGGCAGGCTATATTAAGAACCTATTACCTACATCACGCGTT
CCCGGGAAAATTCCCGCTACAATCTGGACTGGTAAACGACAAGACATCTCTCATCTCCGTGCCTATGGATCAACA
GCATATGCTCACATACCTCTCGATCTGGGAACCTCAAAACTTGCACCACGTTCAGTTAAACTGACACTCATTGGA
TACTTCGGTACCACTGGCTACAAATTACTCGATAGGACGACGGGAGGAATCTTCCGCTCCCGAGACGTAATATTT
GATGAAGGCAAAACCCATTTTACCTCACGGCCGACTCCAACCGCAGACGATTTTATCACTCCTATAAACAGCCAA
CCACCTCCTACCACACTCCCTAGCGCAATTGCTCCACGACCTCACCAGATAACAACGCTCCACGATGATGACAAT
GAACATGCTAGTCTACCAGACCCTGACAGGGTTGACAGTGATGCCGAGGAAAGATTGATCGAGGAAGCTTTGACA
GCTGATGAGGATCATACCACCGACGCCACAAGGGTCGTACCATCCGTCCCTGTCAGGAGATTGAGTAGAGTCTCT
CGTCCGTCTAAACGAATGCAAGAAACACTGGAATACCAGCAACATACCAAAGCGAACATGATAGACACCTCTAGT
GAAAATTGGATACCAAAGAACTATCGTGAGGCGATGACGCGTTCCGAGTTGTGGTTACCACCGATGGTGAAGGAG
TTTGGGATGATGAAGGAGAAAGGCGTGTTTGAGGTGGTGGATCGACCAGTTGGTAGGAATGTGGTAGATTCTAGA
TGGGTATTCACGTTGAAATTTGATGAAGACGGCAATATTACGGCGAGGAAGGCTAGAATTGTTGCGAAAGGATTT
ACACAGGTGTTGGGGGAAGATTATGATGAAACATACGCGTCAGTGGCTCGGATGGAATCTGTTAGGATGGTTTGT
GCTATCGCGGCTTCTAGAGGAATGCGGTTATGGCAAGTGGACTTCGTTTCGGCTTTCCTGAACAGTGATAGCCAG
TACGATGTTTACATGGAACCTCCGAAAGGGTTTGAAGAGGGGGAGGGAAAAGTATGGCGTTTGCTTAAAACCCTC
TACGGCACCATGCAAGGTGCTCACGACTGGGCCAAAAACCTCGACAAAACTTACCAAGGCCACGGCTACTACAAG
TCCAAAGCTGACTCCCAAGTCCGCTCAAAAGTCGAGGACGGTGAATTCACAATCACTTCGACCTGGACCGATGAT
GTTCTAGGCGCCTCAACCACTCATATTGGTGAACTCAAGGCAAAAGATGAACTCGCTCGTAGCTACGAGGTCAAA
GATCTCGGTGAAGCCCACTTTATTCTAGGTATGCGCATCGATCGTAACAACAAGGGAGACATTCGCCTCTCTCAG
AAAGCCTTTTGTGAACGACTTCTTTCGCGTTTCAATATGACCGATGCCAAGCCCAGATCTACCCCCCTTCCAGCA
GGTATATCACTATCTTCCAACGACGCACCACAAAACGACTACGAGTCAAACGAGATGAAGAAAGTTCCGTATCGT
GAAGCGCTTGGTTCTTTAATGTGGCTCCAAGTCGCAACCAGACCTGAATTATCCTTTGCCGTCAATCTCCTCTCC
CATTTTGCCAACAACCCTGGTCGAGCGCATTGGGAAGCGCTGAAGCATACCCTTGCGTACGTTAAGGCGACGATG
GATTATGGTATCACTTACAGGAAGGGAGGAAGCCTTAAACCCGTAGGTTATGTGGACGCTGATTATGCTGGTGAT
GGAGATACTATGAGATCCACCGAGGGACATGTCTTCTTTGTAGCAGGGGGAGCGGTATCCTGGGTGAGTAAACGG
CAAGAGACTGTAGCAGTCTCAACGGTCGAAGCTGAATATATGGGCTTTACGAGGGCGGCTCAACAAGCTATATGG
CTCGAGAAGTTCCTCGACGAGGTTGGCTTACGACAGGACGGACCCACTACAATCCACACAGACAATAACGGAGCG
ATTGCCAACACTAAGAACGACAAAAATCACCGCAGGACAAAACACATCAACGTCAAATATCATTTTGTCAAAGAA
AAGGTCGACAATGGTGACATCACGTTTATCTATACTCCGTCGGCCACAAACCTTGCGGACATCTTAACAAAGCCT
CTAGCTCGGGATGCAGTCACTCGCTGTTGCATAGGGATTGATATTCGAGGGGGAGTCAAGAGCGAGAATGCCGAA
GTAGGGGGAGTGTTGTGA
Gene >AgabiH97|036980
ATGTCTCAGAACACACCTCCTATTTTCCCAGACACCGACAAGTTCGATGGCACGAACTGGGTAGCTTGGAGCGGC
TTGATCAATATAGCCGCTGACCTCAGAGGCGTATCGGATTACCTTGAAGGAACTATACCCCAACCTTCTAGCAGC
AGGACAACAGCTGCCAAGGATGAGCCCGCACCGTCAACTGACACTTCCTGGGAATCACATACCCCTACTCCCGCC
GAATGGAAAATACGTAACGCATGGGCTAAAGGACTGCTCATATACAACACCAAAGACCCGATAGGACTCGGTATC
GCTCTCTCAGGAACAGCAGCCGAAGCATGGAAGTCCTATAAGGACCAATATGCGAAAGTATCAGAGATTGCCATA
TTGAATGCAGAACGAGACCTGCGAGACATCACCTACCTGGATAACCATGACTTCCTCGAACACATATCCAGACTA
CGCACAAAATGGGCTACCGCCACAGCCCTCGGAGCCCAGATAAACGACAAAACCTTCAGAACCATCGTCTTATCT
TCCCTACCCCGATCATGGGATCCTATAGTATCCACACTTTATAGTACGACAACTTCGAGGGAAGCCATTGCGATA
CTCGCCACGCATTGGGCTCGCATCAGCAAAAATCGGGTCGTGAACCCTCAAAATGCTACTACGGCTCTCCAGGTA
ACAGCCAATAACAATGGGCGTAATCGCTACCCACCTAAAAACCAACACCTCCTGTGTACGAACCCGAACTGTGGT
TGTAGAGGACACTTGATCACTGACTGCTATTGGGAAGGAGGAGGAAAGGCGGGACAGTTCCCTGCCTGGTTTGGA
AAGAAAGGAGGGGGAAAAGGAGGAAATAATGGAGCATCCAACACGTCCTTTAACACGGCATCGATACCCACCTCA
TAATACCCAAGACGACCCACAAGTCTATGTCCTATCATCAATCACGTCGAACATAGACCAGGTACCACGCACCAA
TCTTATCACCGCTGCTGTCATCCCTGACCATCACTCTTCACCTAGATCATCTAAGCCATCCGTCAACGCTGATGA
TCTAGGAGGTGCTAAAAGAGATGAGTTTGGGGATACGGTAGATACTATATCGGCAATGTCATCATCATCGTCTAC
CCATGAAATGAATACGAAGGCAGATTTGCTCACCCTCCTCGATTCCGGTGCCACCGATCATTGTTTTGCTAGCTG
TGAATCATTCGCATTGTTTAAACCATTGTCAGCGCCTAGGAACGGTCACTCAGCCAATAAATCAGCTGTCTTCGA
CATAACAGGACACGGTACAGTCGAGATATACACACCGAAGGATGGGGCTGTCGCAAAGATCTTCATTTCGGATGC
ACTTTATTCCCCAGAACTACGCCATAACCTCATCTCAATCTCGAAGCTGACAGCGAAAGGGATGAACGTCACTTT
CAACGGTGATACTGCGATGGTTTGCGACCAGAAGGGGACTACAGTCCTTGTAGCAGTTAAAATGAACGGTCTATA
TGTCGTCAACACCATCCAACGTGGATCACAAATATCATCTCACCTGATGCAAGCCAAACGGAAGGCAGTTCCATT
TGATACTTGGCACCGCCGCCTCGGACACGCTGGTGAAACTGCGATAAAGGAGATGTTGCGTTTAAACTTGGTCAA
TGGGCTGGACATCGATGGCAGACACGAATTAGGTGGCATGTGTGAAGATTGTATCTATGGGAAACACACAACTCA
CCCGTACTCCGATAAACGAGACGTAGAAGCTGAGGTTTTGGAGAGAGTTCATGTAGACATCTGGGGACCGGCCCC
TATCCAATCAGCTGGGGGCTCAAGATATCTCATGGTGCTTGTTGATGGCGCCTCCTCGTACCGACACGTTATCCC
TATCCATGATAAATCGGCTGAGACAACGCTTACTCACCTCAAAGAGTTCCAAACGCAATCTGAACTACAGACTGG
AAAGAAGTTGAAGCGGATAAGGATGGACATGGGACGGGAATGGCATAACCATGTCTGGGAGACGTATGCGAAAGA
GAAGGGAATAGTCTTGGAGTTTACCACCCCCTATGCCCATCAACAAAATGGGGTCGCCGAACGGTCCATGCAAAC
ATTGGTTGAGTTGGGGAGATCAATGCTCGCCGAATCCGGTCTTCCACAACGTTATTGGGCAGACGCCTTTACTAC
GGCAGGCTATATTAAGAACCTATTACCTACATCACGCGTTCCCGGGAAAATTCCCGCTACAATCTGGACTGGTAA
ACGACAAGACATCTCTCATCTCCGTGCCTATGGATCAACAGCATATGCTCACATACCTCTCGATCTGGGAACCTC
AAAACTTGCACCACGTTCAGTTAAACTGACACTCATTGGATACTTCGGTACCACTGGCTACAAATTACTCGATAG
GACGACGGGAGGAATCTTCCGCTCCCGAGACGTAATATTTGATGAAGGCAAAACCCATTTTACCTCACGGCCGAC
TCCAACCGCAGACGATTTTATCACTCCTATAAACAGCCAACCACCTCCTACCACACTCCCTAGCGCAATTGCTCC
ACGACCTCACCAGATAACAACGCTCCACGATGATGACAATGAACATGCTAGTCTACCAGACCCTGACAGGGTTGA
CAGTGATGCCGAGGAAAGATTGATCGAGGAAGCTTTGACAGCTGATGAGGATCATACCACCGACGCCACAAGGGT
CGTACCATCCGTCCCTGTCAGGAGATTGAGTAGAGTCTCTCGTCCGTCTAAACGAATGCAAGAAACACTGGAATA
CCAGCAACATACCAAAGCGAACATGATAGACACCTCTAGTGAAAATTGGATACCAAAGAACTATCGTGAGGCGAT
GACGCGTTCCGAGTTGTGGTTACCACCGATGGTGAAGGAGTTTGGGATGATGAAGGAGAAAGGCGTGTTTGAGGT
GGTGGATCGACCAGTTGGTAGGAATGTGGTAGATTCTAGATGGGTATTCACGTTGAAATTTGATGAAGACGGCAA
TATTACGGCGAGGAAGGCTAGAATTGTTGCGAAAGGATTTACACAGGTGTTGGGGGAAGATTATGATGAAACATA
CGCGTCAGTGGCTCGGATGGAATCTGTTAGGATGGTTTGTGCTATCGCGGCTTCTAGAGGAATGCGGTTATGGCA
AGTGGACTTCGTTTCGGCTTTCCTGAACAGTGATAGCCAGTACGATGTTTACATGGAACCTCCGAAAGGGTTTGA
AGAGGGGGAGGGAAAAGTATGGCGTTTGCTTAAAACCCTCTACGGCACCATGCAAGGTGCTCACGACTGGGCCAA
AAACCTCGACAAAACTTACCAAGGCCACGGCTACTACAAGTCCAAAGCTGACTCCCAAGTCCGCTCAAAAGTCGA
GGACGGTGAATTCACAATCACTTCGACCTGGACCGATGATGTTCTAGGCGCCTCAACCACTCATATTGGTGAACT
CAAGGCAAAAGATGAACTCGCTCGTAGCTACGAGGTCAAAGATCTCGGTGAAGCCCACTTTATTCTAGGTATGCG
CATCGATCGTAACAACAAGGGAGACATTCGCCTCTCTCAGAAAGCCTTTTGTGAACGACTTCTTTCGCGTTTCAA
TATGACCGATGCCAAGCCCAGATCTACCCCCCTTCCAGCAGGTATATCACTATCTTCCAACGACGCACCACAAAA
CGACTACGAGTCAAACGAGATGAAGAAAGTTCCGTATCGTGAAGCGCTTGGTTCTTTAATGTGGCTCCAAGTCGC
AACCAGACCTGAATTATCCTTTGCCGTCAATCTCCTCTCCCATTTTGCCAACAACCCTGGTCGAGCGCATTGGGA
AGCGCTGAAGCATACCCTTGCGTACGTTAAGGCGACGATGGATTATGGTATCACTTACAGGAAGGGAGGAAGCCT
TAAACCCGTAGGTTATGTGGACGCTGATTATGCTGGTGATGGAGATACTATGAGATCCACCGAGGGACATGTCTT
CTTTGTAGCAGGGGGAGCGGTATCCTGGGTGAGTAAACGGCAAGAGACTGTAGCAGTCTCAACGGTCGAAGCTGA
ATATATGGGCTTTACGAGGGCGGCTCAACAAGCTATATGGCTCGAGAAGTTCCTCGACGAGGTTGGCTTACGACA
GGACGGACCCACTACAATCCACACAGACAATAACGGAGCGATTGCCAACACTAAGAACGACAAAAATCACCGCAG
GACAAAACACATCAACGTCAAATATCATTTTGTCAAAGAAAAGGTCGACAATGGTGACATCACGTTTATCTATAC
TCCGTCGGCCACAAACCTTGCGGACATCTTAACAAAGCCTCTAGCTCGGGATGCAGTCACTCGCTGTTGCATAGG
GATTGATATTCGAGGGGGAGTCAAGAGCGAGAATGCCGAAGTAGGGGGAGTGTTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail