Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|036790
Gene name
Locationscaffold_13:843973..844953
Strand-
Gene length (bp)980
Transcript length (bp)927
Coding sequence length (bp)927
Protein length (aa) 309

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14223 Retrotran_gag_2 gag-polypeptide of LTR copia-type 8.5E-10 75 188

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 23 0.45

Transmembrane Domains

Domain # Start End Length
1 12 34 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|036790
MFLVAHATRISFLALNLIPVSSTQLNSILLISLIENLFPLLETLPPSLGNISPLELEVNPTVEQEQRIHFQGIQD
GPVKMWEALEAVHRQKRAGMRFNAYDDLFSIRKLEEESLQSLINRVESSKRKIKELRPSSFTLEQLDDELASMAL
IRALPDEFSGFTSSLLLMDKLDKTTVHQAFVTEDLQRRKRAQDASGTSQALAARSGSQFATKTCDFCGREGHKFS
ECKTFERAKSRAQEDAQKPRTPYKRANKAQEESGSSSSTQALEKAQRVTEFAGNASTPHPSPSPSPSTPLQLDAD
FYWLADTC*
Coding >AgabiH97|036790
ATGTTTTTGGTGGCTCATGCCACTCGCATCTCATTTCTTGCTCTCAATCTCATTCCTGTATCCTCAACTCAGCTT
AATTCAATCTTATTAATTTCTCTCATCGAAAACTTATTTCCGTTACTCGAAACTCTCCCTCCATCTCTCGGCAAC
ATATCCCCTCTCGAACTCGAAGTCAACCCCACAGTGGAGCAGGAGCAGAGAATTCACTTCCAGGGCATCCAGGAC
GGTCCTGTGAAGATGTGGGAGGCTCTAGAGGCTGTACATCGACAGAAAAGGGCTGGAATGCGTTTCAATGCCTAT
GATGACCTCTTTTCCATCCGAAAACTCGAGGAGGAATCCCTCCAATCCCTTATCAACAGAGTAGAGAGCTCTAAA
CGAAAAATCAAGGAACTCCGCCCCTCTTCCTTCACTCTAGAGCAGCTAGATGATGAGCTAGCCTCTATGGCTCTC
ATTAGAGCGCTCCCGGACGAGTTTTCCGGCTTCACGTCGTCTCTATTGCTTATGGATAAGCTGGACAAGACTACA
GTCCACCAGGCCTTTGTCACTGAGGACCTACAACGTCGAAAACGCGCTCAGGACGCCTCTGGGACCTCCCAGGCT
CTTGCAGCTCGCTCTGGCTCCCAATTTGCGACGAAAACCTGCGATTTCTGCGGGAGAGAGGGCCACAAGTTCTCT
GAATGCAAAACCTTCGAGAGAGCAAAGTCACGGGCTCAGGAGGACGCACAAAAGCCTAGAACTCCGTACAAGAGG
GCTAACAAGGCTCAGGAAGAGTCTGGGAGCTCTAGCTCGACTCAGGCTCTCGAAAAAGCGCAGAGAGTCACCGAG
TTTGCTGGTAATGCAAGTACCCCTCATCCCTCACCTTCTCCCTCACCTTCTACACCTCTCCAGCTCGATGCTGAC
TTCTACTGGCTTGCAGATACATGTTAA
Transcript >AgabiH97|036790
ATGTTTTTGGTGGCTCATGCCACTCGCATCTCATTTCTTGCTCTCAATCTCATTCCTGTATCCTCAACTCAGCTT
AATTCAATCTTATTAATTTCTCTCATCGAAAACTTATTTCCGTTACTCGAAACTCTCCCTCCATCTCTCGGCAAC
ATATCCCCTCTCGAACTCGAAGTCAACCCCACAGTGGAGCAGGAGCAGAGAATTCACTTCCAGGGCATCCAGGAC
GGTCCTGTGAAGATGTGGGAGGCTCTAGAGGCTGTACATCGACAGAAAAGGGCTGGAATGCGTTTCAATGCCTAT
GATGACCTCTTTTCCATCCGAAAACTCGAGGAGGAATCCCTCCAATCCCTTATCAACAGAGTAGAGAGCTCTAAA
CGAAAAATCAAGGAACTCCGCCCCTCTTCCTTCACTCTAGAGCAGCTAGATGATGAGCTAGCCTCTATGGCTCTC
ATTAGAGCGCTCCCGGACGAGTTTTCCGGCTTCACGTCGTCTCTATTGCTTATGGATAAGCTGGACAAGACTACA
GTCCACCAGGCCTTTGTCACTGAGGACCTACAACGTCGAAAACGCGCTCAGGACGCCTCTGGGACCTCCCAGGCT
CTTGCAGCTCGCTCTGGCTCCCAATTTGCGACGAAAACCTGCGATTTCTGCGGGAGAGAGGGCCACAAGTTCTCT
GAATGCAAAACCTTCGAGAGAGCAAAGTCACGGGCTCAGGAGGACGCACAAAAGCCTAGAACTCCGTACAAGAGG
GCTAACAAGGCTCAGGAAGAGTCTGGGAGCTCTAGCTCGACTCAGGCTCTCGAAAAAGCGCAGAGAGTCACCGAG
TTTGCTGGTAATGCAAGTACCCCTCATCCCTCACCTTCTCCCTCACCTTCTACACCTCTCCAGCTCGATGCTGAC
TTCTACTGGCTTGCAGATACATGTTAA
Gene >AgabiH97|036790
ATGTTTTTGGTGGCTCATGCCACTCGTGCTTGGACCTAGAGTAAAACCTATATAAACTGCCTCATAATTCGTAGT
TAGGCATCTCATTTCTTGCTCTCAATCTCATTCCTGTATCCTCAACTCAGCTTAATTCAATCTTATTAATTTCTC
TCATCGAAAACTTATTTCCGTTACTCGAAACTCTCCCTCCATCTCTCGGCAACATATCCCCTCTCGAACTCGAAG
TCAACCCCACAGTGGAGCAGGAGCAGAGAATTCACTTCCAGGGCATCCAGGACGGTCCTGTGAAGATGTGGGAGG
CTCTAGAGGCTGTACATCGACAGAAAAGGGCTGGAATGCGTTTCAATGCCTATGATGACCTCTTTTCCATCCGAA
AACTCGAGGAGGAATCCCTCCAATCCCTTATCAACAGAGTAGAGAGCTCTAAACGAAAAATCAAGGAACTCCGCC
CCTCTTCCTTCACTCTAGAGCAGCTAGATGATGAGCTAGCCTCTATGGCTCTCATTAGAGCGCTCCCGGACGAGT
TTTCCGGCTTCACGTCGTCTCTATTGCTTATGGATAAGCTGGACAAGACTACAGTCCACCAGGCCTTTGTCACTG
AGGACCTACAACGTCGAAAACGCGCTCAGGACGCCTCTGGGACCTCCCAGGCTCTTGCAGCTCGCTCTGGCTCCC
AATTTGCGACGAAAACCTGCGATTTCTGCGGGAGAGAGGGCCACAAGTTCTCTGAATGCAAAACCTTCGAGAGAG
CAAAGTCACGGGCTCAGGAGGACGCACAAAAGCCTAGAACTCCGTACAAGAGGGCTAACAAGGCTCAGGAAGAGT
CTGGGAGCTCTAGCTCGACTCAGGCTCTCGAAAAAGCGCAGAGAGTCACCGAGTTTGCTGGTAATGCAAGTACCC
CTCATCCCTCACCTTCTCCCTCACCTTCTACACCTCTCCAGCTCGATGCTGACTTCTACTGGCTTGCAGATACAT
GTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail