Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|036410
Gene name
Locationscaffold_13:756347..761236
Strand+
Gene length (bp)4889
Transcript length (bp)4395
Coding sequence length (bp)4395
Protein length (aa) 1465

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01612 DNA_pol_A_exo1 3'-5' exonuclease 1.9E-08 603 764
PF20499 DUF6729 Domain of unknown function (DUF6729) 2.1E-07 300 441

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O09053|WRN_MOUSE Werner syndrome ATP-dependent helicase homolog OS=Mus musculus GN=Wrn PE=1 SV=3 597 763 2.0E-10
sp|Q14191|WRN_HUMAN Werner syndrome ATP-dependent helicase OS=Homo sapiens GN=WRN PE=1 SV=2 595 769 5.0E-09
sp|B4N9D3|WRNXO_DROWI Werner Syndrome-like exonuclease OS=Drosophila willistoni GN=WRNexo PE=3 SV=2 579 769 1.0E-08
sp|B4JF25|WRNXO_DROGR Werner Syndrome-like exonuclease OS=Drosophila grimshawi GN=WRNexo PE=3 SV=1 602 769 6.0E-08
sp|B4K934|WRNXO_DROMO Werner Syndrome-like exonuclease OS=Drosophila mojavensis GN=WRNexo PE=3 SV=1 602 766 7.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O09053|WRN_MOUSE Werner syndrome ATP-dependent helicase homolog OS=Mus musculus GN=Wrn PE=1 SV=3 597 763 2.0E-10
sp|Q14191|WRN_HUMAN Werner syndrome ATP-dependent helicase OS=Homo sapiens GN=WRN PE=1 SV=2 595 769 5.0E-09
sp|B4N9D3|WRNXO_DROWI Werner Syndrome-like exonuclease OS=Drosophila willistoni GN=WRNexo PE=3 SV=2 579 769 1.0E-08
sp|B4JF25|WRNXO_DROGR Werner Syndrome-like exonuclease OS=Drosophila grimshawi GN=WRNexo PE=3 SV=1 602 769 6.0E-08
sp|B4K934|WRNXO_DROMO Werner Syndrome-like exonuclease OS=Drosophila mojavensis GN=WRNexo PE=3 SV=1 602 766 7.0E-08
sp|Q9VE86|WRNXO_DROME Werner Syndrome-like exonuclease OS=Drosophila melanogaster GN=WRNexo PE=1 SV=2 602 769 1.0E-07
sp|B4PLB3|WRNXO_DROYA Werner Syndrome-like exonuclease OS=Drosophila yakuba GN=WRNexo PE=3 SV=1 602 766 1.0E-07
sp|B4I298|WRNXO_DROSE Werner Syndrome-like exonuclease OS=Drosophila sechellia GN=WRNexo PE=3 SV=2 602 769 2.0E-07
sp|B4QUF6|WRNXO_DROSI Werner Syndrome-like exonuclease OS=Drosophila simulans GN=WRNexo PE=3 SV=1 602 769 2.0E-07
sp|B4G5C9|WRNXO_DROPE Werner Syndrome-like exonuclease OS=Drosophila persimilis GN=WRNexo PE=3 SV=2 585 766 3.0E-07
sp|Q299L3|WRNXO_DROPS Werner Syndrome-like exonuclease OS=Drosophila pseudoobscura pseudoobscura GN=WRNexo PE=3 SV=2 585 766 3.0E-07
sp|B3LWP6|WRNXO_DROAN Werner Syndrome-like exonuclease OS=Drosophila ananassae GN=WRNexo PE=3 SV=2 602 766 5.0E-07
sp|B3NZ68|WRNXO_DROER Werner Syndrome-like exonuclease OS=Drosophila erecta GN=WRNexo PE=3 SV=1 602 766 1.0E-06
sp|Q5UQM4|YR431_MIMIV Putative 3'-5' exonuclease R431 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R431 PE=3 SV=1 625 763 2.0E-06
sp|B4M401|WRNXO_DROVI Werner Syndrome-like exonuclease OS=Drosophila virilis GN=WRNexo PE=3 SV=2 602 766 5.0E-06
sp|Q84LH3|WEX_ARATH Werner Syndrome-like exonuclease OS=Arabidopsis thaliana GN=WEX PE=1 SV=1 591 763 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003676 nucleic acid binding Yes
GO:0008408 3'-5' exonuclease activity Yes
GO:0006139 nucleobase-containing compound metabolic process Yes
GO:0006807 nitrogen compound metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0016787 hydrolase activity No
GO:0005488 binding No
GO:1901360 organic cyclic compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0008150 biological_process No
GO:0097159 organic cyclic compound binding No
GO:0008152 metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0004527 exonuclease activity No
GO:0003674 molecular_function No
GO:0004518 nuclease activity No
GO:0044238 primary metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0009987 cellular process No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0003824 catalytic activity No
GO:0044237 cellular metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|036410
MELRLESGPQSCSSPALFDSGSVRSSGGPSAPSHALLEDSSVTCLNNQTTPALSSLPPASDESSSQAVLRARGRP
RIKPIVYGPKRRRGRPSGSGSKQKHQAKSRQRSPTILHVGNPIIRDTHIPMPGTHQRGAFLQPVIAAQVVEPMEK
DSEVQATSPPPLQATYPIIQDEDPNSVIQDDVDASDEETNADGKGIGEDDDYDDIGPEDDSGRGEGRKRRPLPSW
LLDAFNKRVEESKQHDAQGLPPLYSIHQSFWFPQKSSFFILDEKKHLSPSNLFNPNFFLWDPQALYPSIPCPQYM
DNTFWIIGYRYQCPNCINRQSVTYRSWDSRILDALPPHLAAEFPAHLTHRSAMSKSLFEWMRLCFQNGMGSKQFS
DSLRVRHLLSYDSLHLQYLHHLASLCQGLQRWMDIKYETFLPFDDKSPRGRHGFVPGSEWLRDVYDTYIEGYQHD
FNQHMAMLTGKICAIDHSHKVTKQIARVDGEQVFTALLTVTNEKGEIRICNFVATKSHSQFETALTRMRRSLEQY
GHSQPVLFYTDNMADKLFLENSFPSLRNDVIPIEEYSHLDPLVIPPDIQIMPMDTVQSINHAISTILDDVPVDNG
EIAVGFDSEWNVELSPQGFVRCAGKTAVIQVAYQSRIYILQVSNMIAQGKLPQQLEIFLSHPRVRKVGRLVDGDL
QRLQDTLRPSQPFVGGVDLAKLAKERHLIKNISKCSLSDLSALVLQRRLAKNTPQRTSQAWENRTLTPEQLDYAA
RDAYAALRIYEELVARYSVPTPIPPTVPLLTPVLVFGSDLTNVVADGQVCHEQLESVGGVRVAKHHLVVEVLRVH
IPGAVITSHQKRSLDGFGAPPFKLVCLRSHLKLYSAPPVHQTNQTTTPSHGHLIPPLSSASHSHELLIHEHDGTS
DGDLESQTEVISLQDLLSTDISGSTTNLAGYSVDNENTGTETTASSRIIGEIDSMSSPSEWDYSIRSRVLKDPWH
FFHMLYLPATHGLRKQFTRELRDGLFIPNDEDRRRINSWGAVQKPPKTYEELRNSSPSWTRSRCRHTIPPPHILH
PLISKLFQTYGPLLDPITKQPLFSASTWKVAKNLLELIQKGFISDPSNIPLYTRIGTDKKNGGLPIYRCCRGTNA
TEGGVHTHIRSRLPKFGVSVRHVHASLLDFTLRHNLLTGVYNSTGQRYRGHFSIWVTNEIQELLISLQEMFIQPT
LISGWVNDDIREQSAMAPYVHSANSQQKHSFIALMQGTRKPVLPVHTHAEEQYFRLLMNSDPSFSPQSGEPKWNE
AVQVWNVNAEARDGVYYKLVEQLKTYYSRWKAHLNVKEALSLTSEQRRPVAQMVHNPNRSRIVPPVTPRPLQPYR
ALTGFSEHEASDLHPPSLNTIPASTDPTANYTQQIEIRVQQRVATRLQKKTPINKTRRPRTCKKCANPNCPGKRR
VQDCRNPCQDCGKVDCAGRNSHKLHLPCPYSEVASHMQG*
Coding >AgabiH97|036410
ATGGAACTTAGGCTTGAATCCGGACCTCAGTCCTGCAGTTCTCCGGCCTTGTTTGACAGCGGCTCGGTTCGAAGC
TCTGGTGGCCCATCTGCCCCGAGTCACGCCTTGTTAGAAGATTCTTCGGTCACTTGCTTGAATAATCAGACTACC
CCGGCACTCTCTTCCCTCCCTCCTGCCAGTGACGAGTCTTCGAGTCAGGCTGTACTACGAGCCCGTGGTCGTCCC
CGCATCAAACCCATTGTTTATGGCCCCAAACGTCGACGCGGACGTCCTTCAGGTTCAGGGTCTAAGCAGAAGCAT
CAGGCTAAATCACGTCAACGCTCTCCTACTATCCTTCATGTTGGCAATCCCATTATACGGGATACTCACATTCCT
ATGCCTGGGACTCATCAACGTGGTGCCTTTCTACAGCCTGTGATTGCTGCTCAAGTTGTGGAACCCATGGAAAAG
GACTCAGAGGTGCAGGCAACATCTCCACCTCCACTGCAAGCAACCTATCCAATTATTCAAGACGAAGATCCCAAC
TCTGTTATTCAAGATGATGTGGATGCTAGTGACGAGGAGACGAATGCCGATGGGAAAGGGATTGGAGAGGATGAT
GATTATGATGATATAGGACCTGAGGACGACAGTGGTAGAGGAGAGGGACGAAAGCGAAGGCCGCTTCCTTCGTGG
CTGCTAGATGCTTTCAACAAGCGGGTGGAAGAGTCCAAGCAACATGATGCGCAAGGTCTTCCACCATTGTATTCG
ATTCACCAGAGCTTCTGGTTTCCACAGAAGTCTTCATTTTTTATTTTAGACGAGAAAAAGCATCTGTCTCCCTCA
AATCTATTCAATCCGAATTTTTTTCTCTGGGATCCTCAGGCGTTGTACCCTTCAATTCCCTGTCCTCAATACATG
GACAACACGTTCTGGATCATTGGGTATCGATATCAGTGCCCAAACTGTATCAATCGACAAAGTGTTACCTACCGC
AGCTGGGACTCACGGATACTTGATGCCCTTCCTCCTCACCTTGCAGCTGAATTTCCGGCACATCTTACTCATCGA
AGCGCTATGTCCAAATCTCTGTTCGAGTGGATGCGTTTATGCTTTCAGAATGGAATGGGCTCGAAACAGTTCTCC
GATTCACTTCGAGTTCGCCATTTGCTTTCTTATGACAGCCTTCACTTGCAATACTTACATCATCTTGCGTCTCTT
TGTCAAGGGCTACAACGTTGGATGGATATCAAATATGAGACTTTTCTTCCTTTTGATGACAAGAGTCCACGAGGG
CGGCATGGATTTGTTCCTGGCTCGGAATGGCTCCGTGACGTGTATGACACCTATATCGAAGGATATCAACATGAC
TTCAACCAGCATATGGCTATGCTCACAGGCAAAATATGTGCCATTGACCATAGCCACAAGGTCACAAAGCAGATT
GCTCGTGTGGATGGAGAACAAGTATTCACGGCACTGCTCACAGTTACGAATGAGAAAGGCGAGATCCGCATTTGC
AATTTCGTTGCTACAAAGTCACATTCGCAGTTCGAAACGGCTCTCACTCGCATGCGGCGGTCGCTCGAGCAATAC
GGGCATAGCCAACCAGTCCTGTTCTATACTGACAACATGGCCGACAAGCTGTTCCTCGAGAACTCGTTCCCATCC
CTCCGAAATGATGTCATTCCTATAGAAGAATATTCACACCTGGACCCTCTCGTTATTCCACCCGACATTCAAATC
ATGCCTATGGACACTGTTCAATCAATCAACCATGCCATCTCGACAATTCTTGATGACGTACCAGTGGATAATGGA
GAAATCGCTGTCGGTTTTGACTCAGAATGGAATGTCGAGCTTTCTCCGCAAGGATTTGTTCGATGTGCTGGAAAG
ACTGCTGTGATTCAGGTTGCTTATCAGAGCAGAATCTACATCCTTCAGGTCAGCAATATGATTGCCCAGGGAAAA
TTACCGCAACAACTTGAAATCTTCCTTTCCCATCCTCGTGTTCGTAAAGTTGGTAGACTTGTGGATGGTGATTTG
CAACGACTTCAGGACACATTACGTCCATCTCAACCTTTTGTTGGGGGTGTCGATCTTGCTAAGCTTGCTAAAGAG
CGACATCTTATCAAAAATATATCAAAGTGTTCACTTTCTGATCTTTCTGCACTGGTATTACAAAGACGACTGGCC
AAGAATACTCCACAGCGGACAAGCCAAGCATGGGAAAATCGTACTCTAACTCCCGAGCAGTTAGATTATGCCGCA
CGAGACGCTTATGCTGCTTTGCGAATTTATGAAGAACTTGTGGCCCGCTACAGTGTTCCGACTCCGATTCCACCC
ACAGTACCTCTTCTCACACCAGTTCTTGTATTTGGATCAGATCTAACGAACGTGGTAGCTGACGGTCAGGTATGT
CATGAACAATTGGAAAGTGTTGGTGGTGTTCGGGTAGCAAAGCATCACCTTGTGGTTGAGGTTCTTCGAGTTCAC
ATTCCGGGAGCCGTTATCACCTCTCATCAGAAAAGAAGTCTCGATGGTTTTGGAGCCCCACCATTCAAACTAGTC
TGTCTTCGCAGTCACCTAAAACTTTATTCAGCACCACCCGTACATCAAACTAATCAAACAACCACCCCTAGTCAT
GGTCATCTCATCCCTCCGCTATCTAGCGCATCTCATAGCCATGAACTGTTGATACATGAACATGACGGGACATCA
GATGGTGATTTGGAGAGTCAAACTGAAGTTATCTCGCTTCAGGATTTATTATCCACAGATATCTCCGGCTCTACC
ACAAATTTAGCAGGCTACAGCGTTGACAACGAGAACACTGGCACTGAGACCACTGCTAGCTCGAGAATTATTGGC
GAGATTGATTCGATGTCGAGTCCATCTGAATGGGACTACTCTATCCGAAGTCGAGTGTTGAAGGACCCATGGCAT
TTTTTTCATATGTTATATCTTCCTGCTACGCACGGACTGCGAAAACAATTTACGCGAGAGCTACGAGATGGTCTT
TTCATACCTAATGATGAAGACAGGCGAAGAATTAATTCTTGGGGTGCAGTACAAAAGCCTCCAAAAACTTACGAA
GAGCTCCGAAACTCATCTCCTAGTTGGACCCGATCACGTTGTCGACATACAATACCACCACCACACATTCTTCAT
CCACTTATCTCGAAACTTTTCCAAACTTACGGACCTCTTCTCGATCCAATAACGAAACAACCTCTATTCTCAGCC
AGCACGTGGAAAGTGGCAAAAAACCTTCTGGAACTCATACAAAAAGGTTTTATATCTGATCCGTCCAACATTCCG
TTGTACACAAGAATTGGCACAGATAAGAAAAATGGTGGTTTGCCAATATACCGGTGTTGTCGGGGGACAAATGCG
ACAGAGGGTGGAGTTCACACTCACATCCGATCTCGCCTCCCTAAGTTTGGTGTATCAGTCCGCCACGTTCATGCT
TCGCTACTCGATTTCACACTTCGGCACAATCTTTTGACTGGTGTTTATAACTCAACAGGTCAACGCTATCGAGGC
CATTTCTCCATCTGGGTGACCAACGAAATCCAAGAGTTGCTTATCTCACTTCAAGAAATGTTTATTCAGCCAACG
TTGATAAGTGGCTGGGTCAATGATGATATTCGTGAACAGAGCGCAATGGCACCTTACGTCCACTCTGCAAATAGT
CAACAAAAACATTCATTTATTGCGTTGATGCAGGGAACAAGAAAGCCTGTCTTGCCTGTACATACACATGCCGAA
GAACAGTATTTCCGTTTGCTCATGAATTCCGATCCGTCGTTCTCGCCTCAGTCTGGGGAACCTAAATGGAATGAA
GCTGTTCAAGTTTGGAATGTGAATGCAGAAGCCCGAGATGGTGTTTATTACAAGCTCGTTGAGCAACTCAAGACA
TATTATTCAAGATGGAAAGCTCACTTGAATGTAAAAGAAGCTCTTTCATTGACATCGGAGCAACGACGCCCAGTT
GCACAGATGGTTCATAACCCAAATCGTTCCCGCATTGTACCCCCAGTCACTCCAAGGCCACTTCAGCCCTATCGT
GCATTGACTGGCTTCTCCGAACACGAGGCTAGTGATCTTCATCCACCGTCACTCAATACCATCCCAGCTTCGACT
GACCCCACGGCCAACTACACCCAGCAAATTGAAATACGTGTCCAGCAGCGGGTTGCTACTCGACTCCAAAAAAAA
ACACCCATCAATAAGACCAGAAGGCCCCGCACTTGCAAAAAATGTGCAAATCCAAATTGTCCCGGTAAACGAAGG
GTTCAGGACTGCCGAAACCCTTGTCAAGATTGTGGAAAAGTTGATTGTGCAGGTCGTAACTCCCATAAGCTTCAT
TTGCCGTGTCCTTATTCAGAGGTAGCTAGTCATATGCAAGGTTGA
Transcript >AgabiH97|036410
ATGGAACTTAGGCTTGAATCCGGACCTCAGTCCTGCAGTTCTCCGGCCTTGTTTGACAGCGGCTCGGTTCGAAGC
TCTGGTGGCCCATCTGCCCCGAGTCACGCCTTGTTAGAAGATTCTTCGGTCACTTGCTTGAATAATCAGACTACC
CCGGCACTCTCTTCCCTCCCTCCTGCCAGTGACGAGTCTTCGAGTCAGGCTGTACTACGAGCCCGTGGTCGTCCC
CGCATCAAACCCATTGTTTATGGCCCCAAACGTCGACGCGGACGTCCTTCAGGTTCAGGGTCTAAGCAGAAGCAT
CAGGCTAAATCACGTCAACGCTCTCCTACTATCCTTCATGTTGGCAATCCCATTATACGGGATACTCACATTCCT
ATGCCTGGGACTCATCAACGTGGTGCCTTTCTACAGCCTGTGATTGCTGCTCAAGTTGTGGAACCCATGGAAAAG
GACTCAGAGGTGCAGGCAACATCTCCACCTCCACTGCAAGCAACCTATCCAATTATTCAAGACGAAGATCCCAAC
TCTGTTATTCAAGATGATGTGGATGCTAGTGACGAGGAGACGAATGCCGATGGGAAAGGGATTGGAGAGGATGAT
GATTATGATGATATAGGACCTGAGGACGACAGTGGTAGAGGAGAGGGACGAAAGCGAAGGCCGCTTCCTTCGTGG
CTGCTAGATGCTTTCAACAAGCGGGTGGAAGAGTCCAAGCAACATGATGCGCAAGGTCTTCCACCATTGTATTCG
ATTCACCAGAGCTTCTGGTTTCCACAGAAGTCTTCATTTTTTATTTTAGACGAGAAAAAGCATCTGTCTCCCTCA
AATCTATTCAATCCGAATTTTTTTCTCTGGGATCCTCAGGCGTTGTACCCTTCAATTCCCTGTCCTCAATACATG
GACAACACGTTCTGGATCATTGGGTATCGATATCAGTGCCCAAACTGTATCAATCGACAAAGTGTTACCTACCGC
AGCTGGGACTCACGGATACTTGATGCCCTTCCTCCTCACCTTGCAGCTGAATTTCCGGCACATCTTACTCATCGA
AGCGCTATGTCCAAATCTCTGTTCGAGTGGATGCGTTTATGCTTTCAGAATGGAATGGGCTCGAAACAGTTCTCC
GATTCACTTCGAGTTCGCCATTTGCTTTCTTATGACAGCCTTCACTTGCAATACTTACATCATCTTGCGTCTCTT
TGTCAAGGGCTACAACGTTGGATGGATATCAAATATGAGACTTTTCTTCCTTTTGATGACAAGAGTCCACGAGGG
CGGCATGGATTTGTTCCTGGCTCGGAATGGCTCCGTGACGTGTATGACACCTATATCGAAGGATATCAACATGAC
TTCAACCAGCATATGGCTATGCTCACAGGCAAAATATGTGCCATTGACCATAGCCACAAGGTCACAAAGCAGATT
GCTCGTGTGGATGGAGAACAAGTATTCACGGCACTGCTCACAGTTACGAATGAGAAAGGCGAGATCCGCATTTGC
AATTTCGTTGCTACAAAGTCACATTCGCAGTTCGAAACGGCTCTCACTCGCATGCGGCGGTCGCTCGAGCAATAC
GGGCATAGCCAACCAGTCCTGTTCTATACTGACAACATGGCCGACAAGCTGTTCCTCGAGAACTCGTTCCCATCC
CTCCGAAATGATGTCATTCCTATAGAAGAATATTCACACCTGGACCCTCTCGTTATTCCACCCGACATTCAAATC
ATGCCTATGGACACTGTTCAATCAATCAACCATGCCATCTCGACAATTCTTGATGACGTACCAGTGGATAATGGA
GAAATCGCTGTCGGTTTTGACTCAGAATGGAATGTCGAGCTTTCTCCGCAAGGATTTGTTCGATGTGCTGGAAAG
ACTGCTGTGATTCAGGTTGCTTATCAGAGCAGAATCTACATCCTTCAGGTCAGCAATATGATTGCCCAGGGAAAA
TTACCGCAACAACTTGAAATCTTCCTTTCCCATCCTCGTGTTCGTAAAGTTGGTAGACTTGTGGATGGTGATTTG
CAACGACTTCAGGACACATTACGTCCATCTCAACCTTTTGTTGGGGGTGTCGATCTTGCTAAGCTTGCTAAAGAG
CGACATCTTATCAAAAATATATCAAAGTGTTCACTTTCTGATCTTTCTGCACTGGTATTACAAAGACGACTGGCC
AAGAATACTCCACAGCGGACAAGCCAAGCATGGGAAAATCGTACTCTAACTCCCGAGCAGTTAGATTATGCCGCA
CGAGACGCTTATGCTGCTTTGCGAATTTATGAAGAACTTGTGGCCCGCTACAGTGTTCCGACTCCGATTCCACCC
ACAGTACCTCTTCTCACACCAGTTCTTGTATTTGGATCAGATCTAACGAACGTGGTAGCTGACGGTCAGGTATGT
CATGAACAATTGGAAAGTGTTGGTGGTGTTCGGGTAGCAAAGCATCACCTTGTGGTTGAGGTTCTTCGAGTTCAC
ATTCCGGGAGCCGTTATCACCTCTCATCAGAAAAGAAGTCTCGATGGTTTTGGAGCCCCACCATTCAAACTAGTC
TGTCTTCGCAGTCACCTAAAACTTTATTCAGCACCACCCGTACATCAAACTAATCAAACAACCACCCCTAGTCAT
GGTCATCTCATCCCTCCGCTATCTAGCGCATCTCATAGCCATGAACTGTTGATACATGAACATGACGGGACATCA
GATGGTGATTTGGAGAGTCAAACTGAAGTTATCTCGCTTCAGGATTTATTATCCACAGATATCTCCGGCTCTACC
ACAAATTTAGCAGGCTACAGCGTTGACAACGAGAACACTGGCACTGAGACCACTGCTAGCTCGAGAATTATTGGC
GAGATTGATTCGATGTCGAGTCCATCTGAATGGGACTACTCTATCCGAAGTCGAGTGTTGAAGGACCCATGGCAT
TTTTTTCATATGTTATATCTTCCTGCTACGCACGGACTGCGAAAACAATTTACGCGAGAGCTACGAGATGGTCTT
TTCATACCTAATGATGAAGACAGGCGAAGAATTAATTCTTGGGGTGCAGTACAAAAGCCTCCAAAAACTTACGAA
GAGCTCCGAAACTCATCTCCTAGTTGGACCCGATCACGTTGTCGACATACAATACCACCACCACACATTCTTCAT
CCACTTATCTCGAAACTTTTCCAAACTTACGGACCTCTTCTCGATCCAATAACGAAACAACCTCTATTCTCAGCC
AGCACGTGGAAAGTGGCAAAAAACCTTCTGGAACTCATACAAAAAGGTTTTATATCTGATCCGTCCAACATTCCG
TTGTACACAAGAATTGGCACAGATAAGAAAAATGGTGGTTTGCCAATATACCGGTGTTGTCGGGGGACAAATGCG
ACAGAGGGTGGAGTTCACACTCACATCCGATCTCGCCTCCCTAAGTTTGGTGTATCAGTCCGCCACGTTCATGCT
TCGCTACTCGATTTCACACTTCGGCACAATCTTTTGACTGGTGTTTATAACTCAACAGGTCAACGCTATCGAGGC
CATTTCTCCATCTGGGTGACCAACGAAATCCAAGAGTTGCTTATCTCACTTCAAGAAATGTTTATTCAGCCAACG
TTGATAAGTGGCTGGGTCAATGATGATATTCGTGAACAGAGCGCAATGGCACCTTACGTCCACTCTGCAAATAGT
CAACAAAAACATTCATTTATTGCGTTGATGCAGGGAACAAGAAAGCCTGTCTTGCCTGTACATACACATGCCGAA
GAACAGTATTTCCGTTTGCTCATGAATTCCGATCCGTCGTTCTCGCCTCAGTCTGGGGAACCTAAATGGAATGAA
GCTGTTCAAGTTTGGAATGTGAATGCAGAAGCCCGAGATGGTGTTTATTACAAGCTCGTTGAGCAACTCAAGACA
TATTATTCAAGATGGAAAGCTCACTTGAATGTAAAAGAAGCTCTTTCATTGACATCGGAGCAACGACGCCCAGTT
GCACAGATGGTTCATAACCCAAATCGTTCCCGCATTGTACCCCCAGTCACTCCAAGGCCACTTCAGCCCTATCGT
GCATTGACTGGCTTCTCCGAACACGAGGCTAGTGATCTTCATCCACCGTCACTCAATACCATCCCAGCTTCGACT
GACCCCACGGCCAACTACACCCAGCAAATTGAAATACGTGTCCAGCAGCGGGTTGCTACTCGACTCCAAAAAAAA
ACACCCATCAATAAGACCAGAAGGCCCCGCACTTGCAAAAAATGTGCAAATCCAAATTGTCCCGGTAAACGAAGG
GTTCAGGACTGCCGAAACCCTTGTCAAGATTGTGGAAAAGTTGATTGTGCAGGTCGTAACTCCCATAAGCTTCAT
TTGCCGTGTCCTTATTCAGAGGTAGCTAGTCATATGCAAGGTTGA
Gene >AgabiH97|036410
ATGGAACTTAGGCTTGAATCCGGACCTCAGTCCTGCAGTTCTCCGGCCTTGTTTGACAGGTATGTCACATTGTCT
ATTGTTATAACTTGTTCGATGGTTCATCATTTTTTGTGTCAAGCGGCTCGGTTCGAAGCTCTGGTGGCCCATCTG
CCCCGAGTCACGCCTTGTTAGAAGATTCTTCGGTCACTTGCTTGAATAATCAGACTACCCCGGCACTCTCTTCCC
TCCCTCCTGCCAGTGACGAGTCTTCGAGTCAGGCTGTACTACGAGCCCGTGGTCGTCCCCGCATCAAACCCATTG
TTTATGGCCCCAAACGTCGACGCGGACGTCCTTCAGGTTCAGGGTCTAAGCAGAAGCATCAGGCTAAATCACGTC
AACGCTCTCCTACTATCCTTCATGTTGGCAATCCCATTATACGGGATACTCACATTGTGAGTAGCCTCTATGTTA
TTTTACCCGTTCTAATCAACTTGTATCAAGCCTATGCCTGGGACTCATCAACGTGGTGCCTTTCTACAGCCTGTG
ATTGCTGCTCAAGTTGTGGAACCCATGGAAAAGGACTCAGAGGTGCAGGCAACATCTCCGTGCGTAATCCGAGTC
TTTCTCTCATTATATTATCACTCAACTCTATTGATTTCGTAGACCTCCACTGCAAGCAACCTATCCAATTATTCA
AGACGAAGATCCCAACTCTGTTATTCAAGATGATGTGGATGCTAGTGACGAGGAGACGAATGCCGATGGGAAAGG
GATTGGAGAGGATGATGATTATGATGATATAGGACCTGAGGACGACAGTGGTAGAGGAGAGGGACGAAAGCGAAG
GCCGCTTCCTTCGTGGCTGCTAGATGCTTTCAACAAGCGGGTGGAAGAGTCCAAGCAACATGATGCGCAAGGTCT
TCCACCATTGTATTCGATTCACCAGAGCTTCTGGTTTCCACAGAAGTCTTCATTTTTTATTTTAGACGAGAAAAA
GCATCTGTCTCCCTCAAATCTATTCAATCCGAATTTTTTTCTCTGGGATCCTCAGGCGTTGTACCCTTCAATTCC
CTGTCCTCAATGTAAGTCTAGGCTTCGACGCAAGCAACACATCCCATGGCCTAGGCGTTGTGTAGACATGGACAA
CACGTTCTGGATCATTGGGTATCGATATCAGTGCCCAAACTGTATCAATCGACAAAGTGTTACCTACCGCAGCTG
GGACTCACGGATACTTGATGCCCTTCCTCCTCACCTTGCAGCTGAATTTCCGGCACATCTTACTCATCGAAGCGC
TATGTCCAAATCTCTGTTCGAGTGGATGCGTTTATGCTTTCAGAATGGAATGGGCTCGAAACAGTTCTCCGATTC
ACTTCGAGTTCGCCATTTGCTTTCTTATGACAGCCTTCACTTGCAATACTTACATCATCTTGCGTCTCTTTGTCA
AGGGCTACAACGTTGGATGGATATCAAATATGAGACTTTTCTTCCTTTTGATGACAAGAGTCCACGAGGGCGGCA
TGGATTTGTTCCTGGCTCGGAATGGCTCCGTGACGTGTATGACACCTATATCGAAGGATATCAACATGACTTCAA
CCAGCATATGGCTATGCTCACAGGCAAAATATGTGCCATTGACCATAGCCACAAGGTATATCTCGCTTCGAGAGT
GTTATCAAAAACATTCATTCATCTTATGCCCTAGGTCACAAAGCAGATTGCTCGTGTGGATGGAGAACAAGTATT
CACGGCACTGCTCACAGTTACGAATGAGAAAGGCGAGATCCGCATTTGCAATTTCGTTGCTACAAAGTCACATTC
GCAGTTCGAAACGGCTCTCACTCGCATGCGGCGGTCGCTCGAGCAATACGGGCATAGCCAACCAGTCCTGTTCTA
TACTGACAACATGGCCGACAAGCTGTTCCTCGAGAACTCGTTCCCATCCCTCCGAAATGATGTCATTCCTATAGA
AGAATATTCACACCTGGACCCTCTCGTTATTCCACCCGACATTCAAATCATGCCTATGGACACTGTTCAATCAAT
CAACCATGCCATCTCGACAATTCTTGATGACGTACCAGTGGATAATGGAGAAATCGCTGTCGGTTTTGACTCAGA
ATGGAATGTCGAGCTTTCTCCGCAAGGATTTGTTCGATGTGCTGGAAAGACTGCTGTGATTCAGGTTGCTTATCA
GAGCAGAATCTACATCCTTCAGGTCCATAGAAGCAACATAAGAAGCTTGATACCTTATACTTACCTCGCGACTTC
CGATATTATTAGGTCAGCAATATGATTGCCCAGGGAAAATTACCGCAACAACTTGAAATCTTCCTTTCCCATCCT
CGTGTTCGTAAAGTTGGTAGACTTGTGGATGGTGATTTGCAACGACTTCAGGACACATTACGTCCATCTCAACCT
TTTGTTGGGGGTGTCGATCTTGCTAAGCTTGCTAAAGAGCGACATCTTATCAAAAATATATCAAAGTGTTCACTT
TCTGATCTTTCTGCACTGGTATTACAAAGACGACTGGCCAAGAATACTCCACAGCGGACAAGCCAAGCATGGGAA
AATCGTACTCTAACTCCCGAGCAGTTAGATTATGCCGCACGAGACGCTTATGCTGCTTTGCGAATTTATGAAGAA
CTTGTGGCCCGCTACAGTGTTCCGACTCCGATTCCACCCACAGTACCTCTTCTCACACCAGTTCTTGTATTTGGA
TCAGATCTAACGAACGTGGTAGCTGACGGTCAGGTATGTCATGAACAATTGGAAAGTGTTGGTGGTGTTCGGGTA
GCAAAGCATCACCTTGTGGTTGAGGTTCTTCGAGTTCACATTCCGGGAGCCGTTATCACCTCTCATCAGAAAAGA
AGTCTCGATGGTTTTGGAGCCCCACCATTCAAACTAGTCTGTCTTCGCAGTCACCTAAAACTTTATTCAGCACCA
CCCGTACATCAAACTAATCAAACAACCACCCCTAGTCATGGTCATCTCATCCCTCCGCTATCTAGCGCATCTCAT
AGCCATGAACTGTTGATACATGAACATGACGGGACATCAGATGGTGATTTGGAGAGTCAAACTGAAGTTATCTCG
CTTCAGGATTTATTATCCACAGATATCTCCGGCTCTACCACAAATTTAGCAGGCTACAGCGTTGACAACGAGAAC
ACTGGCACTGAGACCACTGCTAGCTCGAGAATTATTGGCGAGATTGATTCGATGTCGAGTCCATCTGAATGGGAC
TACTCTATCCGAAGTCGAGTGTTGAAGGACCCATGGCATTTTTTTCATATGTTATATCTTCCTGCTACGCACGGA
CTGCGAAAACAATTTACGCGAGAGCTACGAGATGGTCTTTTCATACCTAATGATGAAGACAGGCGAAGAATTAAT
TCTTGGGGTGCAGTACAAAAGCCTCCAAAAACTTACGAAGAGCTCCGAAACTCATCTCCTAGTTGGACCCGATCA
CGTTGTCGACATACAATACCACCACCACACATTCTTCATCCACTTATCTCGAAACTTTTCCAAACTTACGGACCT
CTTCTCGATCCAATAACGAAACAACCTCTATTCTCAGCCAGCACGTGGAAAGTGGCAAAAAACCTTCTGGAACTC
ATACAAAAAGGTTTTATATCTGATCCGTCCAACATTCCGTTGTACACAAGAATTGGCACAGATAAGAAAAATGGT
GGTTTGCCAATATACCGGTGTTGTCGGGGGACAAATGCGACAGAGGGTGGAGTTCACACTCACATCCGATCTCGC
CTCCCTAAGTTTGGTGTATCAGTCCGCCACGTTCATGCTTCGCTACTCGATTTCACACTTCGGCACAATCTTTTG
GTATGTAATTTTCAAATTTGATCAATTTGTGCTAGTTAACGGACATCTTTTTATTAGACTGGTGTTTATAACTCA
ACAGGTCAACGCTATCGAGGCCATTTCTCCATCTGGGTGACCAACGAAATCCAAGAGTTGCTTATCTCACTTCAA
GAAATGTTTATTCAGCCAACGTTGATAAGTGGCTGGGTCAATGGTAACTTATATGTACCAACAACTGAGGTAATT
GGGATTCTTCCCATTCCAGATGATATTCGTGAACAGAGCGCAATGGCACCTTACGTCCACTCTGCAAATAGTCAA
CAAAAACATTCATTTATTGCGTTGATGCAGGGAACAAGAAAGCCTGTCTTGCCTGTACATACACATGCCGAAGAA
CAGTATTTCCGTTTGCTCATGAATTCCGATCCGTCGTTCTCGCCTCAGTCTGGGGAACCTAAATGGAATGAAGCT
GTTCAAGTTTGGAATGTGAATGCAGAAGCCCGAGATGGTGTTTATTACAAGGTATGCATAGCCTACATAGACGTA
CTTCACAACTTATAATTCAATAGCTCGTTGAGCAACTCAAGACATATTATTCAAGATGGAAAGCTCACTTGAATG
TAAAAGAAGCTCTTTCATTGACATCGGAGCAACGACGCCCAGTTGCACAGATGGTTCATAACCCAAATCGTTCCC
GCATTGTACCCCCAGTCACTCCAAGGCCACTTCAGCCCTATCGTGCATTGACTGGCTTCTCCGAACACGAGGCTA
GTGATCTTCATCCACCGTCACTCAATACCATCCCAGCTTCGACTGACCCCACGGCCAACTACACCCAGCAAATTG
AAATACGTGTCCAGCAGCGGGTTGCTACTCGACTCCAAAAAAAAACACCCATCAATAAGACCAGAAGGCCCCGCA
CTTGCAAAAAATGTGCAAATCCAAATTGTCCCGGTAAACGAAGGGTTCAGGACTGCCGAAACCCTTGTCAAGATT
GTGGAAAAGTTGATTGTGCAGGTCGTAACTCCCATAAGCTTCATTTGCCGTGTCCTTATTCAGAGGTAGCTAGTC
ATATGCAAGGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail