Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|036400
Gene name
Locationscaffold_13:751270..755673
Strand+
Gene length (bp)4403
Transcript length (bp)4344
Coding sequence length (bp)4344
Protein length (aa) 1448

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07727 RVT_2 Reverse transcriptase (RNA-dependent DNA polymerase) 1.0E-48 962 1203
PF14223 Retrotran_gag_2 gag-polypeptide of LTR copia-type 1.4E-09 90 214

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P10978|POLX_TOBAC Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum PE=2 SV=1 115 1445 0.0E+00
sp|P04146|COPIA_DROME Copia protein OS=Drosophila melanogaster GN=GIP PE=1 SV=3 933 1445 6.0E-88
sp|P04146|COPIA_DROME Copia protein OS=Drosophila melanogaster GN=GIP PE=1 SV=3 378 803 2.0E-44
sp|P25600|YCH4_YEAST Putative transposon Ty5-1 protein YCL074W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY5A PE=5 SV=2 1042 1344 2.0E-33
sp|P92519|M810_ARATH Uncharacterized mitochondrial protein AtMg00810 OS=Arabidopsis thaliana GN=AtMg00810 PE=4 SV=1 1126 1355 5.0E-33
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P10978|POLX_TOBAC Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum PE=2 SV=1 115 1445 0.0E+00
sp|P04146|COPIA_DROME Copia protein OS=Drosophila melanogaster GN=GIP PE=1 SV=3 933 1445 6.0E-88
sp|P04146|COPIA_DROME Copia protein OS=Drosophila melanogaster GN=GIP PE=1 SV=3 378 803 2.0E-44
sp|P25600|YCH4_YEAST Putative transposon Ty5-1 protein YCL074W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY5A PE=5 SV=2 1042 1344 2.0E-33
sp|P92519|M810_ARATH Uncharacterized mitochondrial protein AtMg00810 OS=Arabidopsis thaliana GN=AtMg00810 PE=4 SV=1 1126 1355 5.0E-33
sp|P0C2I5|YL12B_YEAST Transposon Ty1-LR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR2 PE=3 SV=1 394 749 7.0E-21
sp|Q03434|YM12B_YEAST Transposon Ty1-ML2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ML2 PE=3 SV=2 394 749 8.0E-21
sp|Q12273|YO11B_YEAST Transposon Ty1-OL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-OL PE=3 SV=1 394 749 1.0E-20
sp|Q92393|YO12B_YEAST Transposon Ty1-OR Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-OR PE=3 SV=1 394 749 1.0E-20
sp|O13535|YH11B_YEAST Transposon Ty1-H Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-H PE=3 SV=1 394 749 1.0E-20
sp|Q04711|YM11B_YEAST Transposon Ty1-ML1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ML1 PE=3 SV=2 394 749 1.0E-20
sp|Q03612|YE11B_YEAST Transposon Ty1-ER1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ER1 PE=3 SV=1 394 749 1.0E-20
sp|Q12490|YB11B_YEAST Transposon Ty1-BL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-BL PE=1 SV=1 394 749 1.0E-20
sp|P0C2I9|YP12B_YEAST Transposon Ty1-PR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR1 PE=3 SV=1 394 749 1.0E-20
sp|Q04670|YM14B_YEAST Transposon Ty1-MR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-MR2 PE=3 SV=2 394 749 1.0E-20
sp|P0C2I2|YD14B_YEAST Transposon Ty1-DR5 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR5 PE=3 SV=1 394 749 1.0E-20
sp|P47100|YJ12B_YEAST Transposon Ty1-JR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-JR2 PE=3 SV=3 394 749 1.0E-20
sp|Q12316|YG13B_YEAST Transposon Ty1-GR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR3 PE=3 SV=3 394 749 1.0E-20
sp|Q12088|YL11B_YEAST Transposon Ty1-LR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR1 PE=3 SV=1 394 749 1.0E-20
sp|Q04214|YM13B_YEAST Transposon Ty1-MR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-MR1 PE=1 SV=2 394 749 1.0E-20
sp|Q12414|YP11B_YEAST Transposon Ty1-PL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PL PE=3 SV=1 394 749 1.0E-20
sp|P0C2I7|YL14B_YEAST Transposon Ty1-LR4 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR4 PE=5 SV=1 394 749 1.0E-20
sp|Q07793|YD13B_YEAST Transposon Ty1-DR4 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR4 PE=3 SV=2 394 749 1.0E-20
sp|Q99231|YD12B_YEAST Transposon Ty1-DR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR3 PE=1 SV=2 394 749 1.0E-20
sp|Q03619|YE12B_YEAST Transposon Ty1-ER2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ER2 PE=3 SV=1 394 749 1.0E-20
sp|Q07163|TY1AB_YEASX Transposon TyH3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae GN=TY1B PE=1 SV=2 394 749 1.0E-20
sp|Q99337|YN12B_YEAST Transposon Ty1-NL2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-NL2 PE=3 SV=1 394 749 1.0E-20
sp|Q03855|YD11B_YEAST Transposon Ty1-DR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR1 PE=3 SV=2 394 749 2.0E-20
sp|P0C2J1|YP14B_YEAST Transposon Ty1-PR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR3 PE=1 SV=1 394 749 2.0E-20
sp|Q12269|YG12B_YEAST Transposon Ty1-GR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR2 PE=3 SV=3 394 749 2.0E-20
sp|Q12112|YN11B_YEAST Transposon Ty1-NL1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-NL1 PE=3 SV=1 394 749 2.0E-20
sp|P0C2I6|YL13B_YEAST Transposon Ty1-LR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR3 PE=3 SV=1 394 749 2.0E-20
sp|Q12193|YB12B_YEAST Transposon Ty1-BR Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-BR PE=3 SV=1 457 749 2.0E-20
sp|P47098|YJ11B_YEAST Transposon Ty1-JR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-JR1 PE=3 SV=3 394 749 3.0E-20
sp|Q12141|YG11B_YEAST Transposon Ty1-GR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR1 PE=3 SV=1 394 749 3.0E-20
sp|P0C2I3|YD15B_YEAST Transposon Ty1-DR6 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR6 PE=3 SV=1 394 749 5.0E-20
sp|P0C2J0|YP13B_YEAST Transposon Ty1-PR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR2 PE=3 SV=1 394 749 8.0E-20
sp|P0C2J5|YL22B_YEAST Transposon Ty2-LR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-LR2 PE=5 SV=1 458 719 9.0E-20
sp|Q12501|YO22B_YEAST Transposon Ty2-OR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-OR2 PE=1 SV=1 458 719 9.0E-20
sp|Q12113|YO21B_YEAST Transposon Ty2-OR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-OR1 PE=3 SV=1 458 719 9.0E-20
sp|P25384|YC21B_YEAST Transposon Ty2-C Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-C PE=3 SV=2 458 719 9.0E-20
sp|Q03494|YD22B_YEAST Transposon Ty2-DR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR2 PE=3 SV=2 458 719 9.0E-20
sp|P0C2J3|YL21B_YEAST Transposon Ty2-LR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-LR1 PE=3 SV=1 458 719 1.0E-19
sp|Q12491|YB21B_YEAST Transposon Ty2-B Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-B PE=3 SV=1 458 719 1.0E-19
sp|P0CX64|YG22B_YEAST Transposon Ty2-GR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-GR2 PE=3 SV=1 458 719 1.0E-19
sp|P0CX63|YF21B_YEAST Transposon Ty2-F Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-F PE=3 SV=1 458 719 1.0E-19
sp|Q07791|YD23B_YEAST Transposon Ty2-DR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR3 PE=3 SV=1 458 719 1.0E-19
sp|Q12472|YD21B_YEAST Transposon Ty2-DR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR1 PE=1 SV=3 458 719 1.0E-19
sp|Q12337|YG21B_YEAST Transposon Ty2-GR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-GR1 PE=5 SV=2 458 719 1.0E-19
sp|P0C2J7|YH41B_YEAST Transposon Ty4-H Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY4B-H PE=3 SV=1 944 1364 1.0E-18
sp|P47024|YJ41B_YEAST Transposon Ty4-J Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY4B-J PE=3 SV=3 944 1364 2.0E-18
sp|P47024|YJ41B_YEAST Transposon Ty4-J Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY4B-J PE=3 SV=3 394 786 3.0E-18
sp|A0A0B7P3V8|YP41B_YEAST Transposon Ty4-P Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY4B-P PE=5 SV=2 394 786 5.0E-18
sp|P0C2J7|YH41B_YEAST Transposon Ty4-H Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY4B-H PE=3 SV=1 394 786 8.0E-18
sp|Q99337|YN12B_YEAST Transposon Ty1-NL2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-NL2 PE=3 SV=1 973 1432 1.0E-15
sp|O13527|YA11B_YEAST Truncated transposon Ty1-A Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-A PE=3 SV=3 552 749 1.0E-15
sp|P0C2I7|YL14B_YEAST Transposon Ty1-LR4 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR4 PE=5 SV=1 973 1432 2.0E-15
sp|P0C2I3|YD15B_YEAST Transposon Ty1-DR6 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR6 PE=3 SV=1 973 1432 2.0E-15
sp|P47100|YJ12B_YEAST Transposon Ty1-JR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-JR2 PE=3 SV=3 973 1432 3.0E-15
sp|Q12193|YB12B_YEAST Transposon Ty1-BR Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-BR PE=3 SV=1 973 1432 4.0E-15
sp|Q92393|YO12B_YEAST Transposon Ty1-OR Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-OR PE=3 SV=1 973 1432 5.0E-15
sp|Q12112|YN11B_YEAST Transposon Ty1-NL1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-NL1 PE=3 SV=1 973 1432 6.0E-15
sp|Q12316|YG13B_YEAST Transposon Ty1-GR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR3 PE=3 SV=3 973 1432 9.0E-15
sp|Q12141|YG11B_YEAST Transposon Ty1-GR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR1 PE=3 SV=1 973 1432 1.0E-14
sp|Q12490|YB11B_YEAST Transposon Ty1-BL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-BL PE=1 SV=1 973 1432 2.0E-14
sp|Q07163|TY1AB_YEASX Transposon TyH3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae GN=TY1B PE=1 SV=2 973 1432 2.0E-14
sp|Q04711|YM11B_YEAST Transposon Ty1-ML1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ML1 PE=3 SV=2 973 1432 3.0E-14
sp|P0C2I2|YD14B_YEAST Transposon Ty1-DR5 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR5 PE=3 SV=1 973 1432 3.0E-14
sp|Q12269|YG12B_YEAST Transposon Ty1-GR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-GR2 PE=3 SV=3 973 1432 3.0E-14
sp|P0C2J0|YP13B_YEAST Transposon Ty1-PR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR2 PE=3 SV=1 973 1432 3.0E-14
sp|Q12491|YB21B_YEAST Transposon Ty2-B Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-B PE=3 SV=1 973 1432 3.0E-14
sp|Q04670|YM14B_YEAST Transposon Ty1-MR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-MR2 PE=3 SV=2 973 1432 4.0E-14
sp|P25384|YC21B_YEAST Transposon Ty2-C Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-C PE=3 SV=2 973 1432 4.0E-14
sp|Q04214|YM13B_YEAST Transposon Ty1-MR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-MR1 PE=1 SV=2 973 1432 5.0E-14
sp|Q12501|YO22B_YEAST Transposon Ty2-OR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-OR2 PE=1 SV=1 973 1432 5.0E-14
sp|P0CX64|YG22B_YEAST Transposon Ty2-GR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-GR2 PE=3 SV=1 973 1432 5.0E-14
sp|P0CX63|YF21B_YEAST Transposon Ty2-F Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-F PE=3 SV=1 973 1432 5.0E-14
sp|Q12337|YG21B_YEAST Transposon Ty2-GR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-GR1 PE=5 SV=2 973 1432 5.0E-14
sp|Q03619|YE12B_YEAST Transposon Ty1-ER2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ER2 PE=3 SV=1 973 1432 6.0E-14
sp|Q03494|YD22B_YEAST Transposon Ty2-DR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR2 PE=3 SV=2 973 1432 6.0E-14
sp|P0C2J3|YL21B_YEAST Transposon Ty2-LR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-LR1 PE=3 SV=1 973 1432 7.0E-14
sp|Q12472|YD21B_YEAST Transposon Ty2-DR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR1 PE=1 SV=3 973 1432 7.0E-14
sp|Q12113|YO21B_YEAST Transposon Ty2-OR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-OR1 PE=3 SV=1 973 1432 8.0E-14
sp|Q03434|YM12B_YEAST Transposon Ty1-ML2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ML2 PE=3 SV=2 973 1432 9.0E-14
sp|P0C2I5|YL12B_YEAST Transposon Ty1-LR2 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR2 PE=3 SV=1 973 1432 1.0E-13
sp|Q12273|YO11B_YEAST Transposon Ty1-OL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-OL PE=3 SV=1 973 1432 1.0E-13
sp|O13535|YH11B_YEAST Transposon Ty1-H Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-H PE=3 SV=1 973 1432 1.0E-13
sp|Q03612|YE11B_YEAST Transposon Ty1-ER1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-ER1 PE=3 SV=1 973 1432 1.0E-13
sp|Q12414|YP11B_YEAST Transposon Ty1-PL Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PL PE=3 SV=1 973 1432 1.0E-13
sp|Q99231|YD12B_YEAST Transposon Ty1-DR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR3 PE=1 SV=2 973 1432 1.0E-13
sp|Q12088|YL11B_YEAST Transposon Ty1-LR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR1 PE=3 SV=1 973 1432 2.0E-13
sp|Q03855|YD11B_YEAST Transposon Ty1-DR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR1 PE=3 SV=2 973 1432 2.0E-13
sp|P0C2I9|YP12B_YEAST Transposon Ty1-PR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR1 PE=3 SV=1 973 1432 4.0E-13
sp|Q07791|YD23B_YEAST Transposon Ty2-DR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY2B-DR3 PE=3 SV=1 973 1432 4.0E-13
sp|O13527|YA11B_YEAST Truncated transposon Ty1-A Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-A PE=3 SV=3 973 1432 5.0E-13
sp|P47098|YJ11B_YEAST Transposon Ty1-JR1 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-JR1 PE=3 SV=3 973 1432 7.0E-13
sp|P92520|M820_ARATH Uncharacterized mitochondrial protein AtMg00820 OS=Arabidopsis thaliana GN=AtMg00820 PE=4 SV=1 947 1035 2.0E-12
sp|P93290|M240_ARATH Uncharacterized mitochondrial protein AtMg00240 OS=Arabidopsis thaliana GN=AtMg00240 PE=4 SV=1 1237 1321 1.0E-08
sp|P92512|M710_ARATH Uncharacterized mitochondrial protein AtMg00710 OS=Arabidopsis thaliana GN=AtMg00710 PE=4 SV=1 687 755 2.0E-08
sp|P0C2J1|YP14B_YEAST Transposon Ty1-PR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-PR3 PE=1 SV=1 859 1432 3.0E-07
sp|Q07793|YD13B_YEAST Transposon Ty1-DR4 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-DR4 PE=3 SV=2 973 1263 4.0E-07
sp|P0C2I6|YL13B_YEAST Transposon Ty1-LR3 Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TY1B-LR3 PE=3 SV=1 859 1432 7.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 42 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|036400
MAGTGGSAPPIFADAAKFNGTNWVAWNGLIRIAADLRGVFGYLDGTIPNPSPQNNITPTPTPTTAADAATTAQTP
VDTPWESTAPSATKWRVRNAWTMGLLIYNTADPVGLGININGSTAEAWKSYTDTYQITSEIALLNAEQDLHNVVF
NDGEDFVDFISRLRTKWSNATALGAQISDISFRTIILNALPCSWDPIVATLYTTQTSRDAINQLMTHWARISRDR
TNNTQTSTSALQTISNNRGRDRQRSQNSNLLCTNSNCGRRGHTIENCYWPGGGKAGQFPAGFGKQRGTTNAATTN
AEQTSANSAANTTEQVFALVAHDQHDAVSEVPPSPTHPSSSPSDKSNVRPSYNIIPLTFGTIEADDWRGNDNELT
QSIPECHNVDINVNDVATLLDSGASDHCFVGRPLFSKYQTISPPRKGNSAGKDSTFTVDGAGMVEFTTVIDGVSS
RIVLSDVLHTPHLRSNLISVSKLVSKGMSVSFDGDVARVKRSGNVIVLTAIKRNGLYVVPTTSSSRPEANISQSK
KQAVAFDIWHRRLGHAVAGPTELKALCEDCIYGTHTTHPFPDSSSAETEALQRVYIDIWGPSPVQSAGGLKYFML
IIDGATSYRMVNFLPTKLADATLKVFRDFHRQAEQQTGKTLKRVKVDMGREWFNASWDTYVKEHGITLDFTTPYA
HQQNGKAERSMRTLLDTARTMLTDSGLPQKYWADAVLTAAYIRNFIPNTRTPDVIPAEAWTNQRQDLSHLRPFGS
VAYAHIPAEVSPSKLSARSVKLVLIGYYDRTGYKLMDRLTGAAFKSRDVIFEEAKPHYSTDPIVTYPADDAQATT
PRSSVIAPRPKPISSLHPTPAAPTLSHNPLPITPPKPPAVPQSQKTPDISDSEDEVSKAVMPDGDTPIAIRKPKR
EVKLSARMKDSLEYMNRPTASMVSAFVVDDSAVPSTFKQAMLRPDLWMEPMLKELAVMEEKSVFRLVPRPVDKNV
VKSKWVFANKYDEEGRIVTRKARLVAKGFTQILGEDYDETYTSVARLESVRLVCAVAASLGLRLWQVDFVSAFLN
SKNSFEVYMEPPPGFDEGGDRVWLLLKTLYGTMQGAHDWAQTLEHAYQGHGYYTSKADPQVRFKTVNNELTLTST
WTDDILGASSTEMGEIKAKEELRSSYEIKDLGTARFILGMKIERNDADGSITLSQRAYCERMLERFSMNDANPRR
TPLPASVTLSIKDSPKTEEEIVDMKGVPYREALGSLMWLQVATRPDLSFAVNLLSRFANNPGRAHWNALKHTLAY
VKATLDYGVTYYHNSSLRPFGYVDSDYAGDVDGRRSTEGHIFFVGGGPVSWASKRQETVVLSTVEAEYMAFTRAT
QQAIWLDKFMCEIGLKQERPTNVFGDNTGAIANTQNNKNHRRTKHINVKHHFIKETAMMGLVAYPYVCSAENLAD
ILTKSLPKDAVTYSCEEMGLCG*
Coding >AgabiH97|036400
ATGGCTGGCACTGGCGGTAGTGCACCCCCAATTTTCGCTGACGCAGCGAAATTCAACGGAACGAACTGGGTTGCT
TGGAATGGGTTGATTCGGATAGCCGCCGATTTACGAGGCGTCTTTGGTTACCTCGATGGTACAATCCCCAACCCA
TCCCCACAGAATAACATTACTCCAACCCCGACTCCCACCACAGCAGCGGACGCCGCTACAACAGCCCAAACACCG
GTTGATACACCCTGGGAGTCGACTGCTCCCTCGGCTACCAAGTGGCGAGTTAGGAATGCCTGGACAATGGGCTTG
CTCATATATAACACGGCCGATCCGGTAGGACTTGGCATAAACATCAACGGATCAACTGCAGAAGCTTGGAAATCA
TACACAGACACCTACCAGATCACCTCCGAGATTGCCCTTCTCAACGCCGAGCAAGACCTTCATAACGTAGTTTTC
AATGATGGGGAGGACTTCGTCGACTTCATCTCGCGTCTTCGCACAAAGTGGTCGAATGCTACAGCACTCGGTGCT
CAAATCAGTGACATCTCGTTCAGGACTATCATCTTGAATGCATTGCCGTGTTCATGGGATCCCATCGTCGCTACT
CTTTATACCACTCAGACTTCTCGTGATGCTATAAATCAACTCATGACTCACTGGGCGAGGATCAGTCGCGACCGC
ACCAATAACACCCAAACTTCAACCTCGGCACTCCAAACCATTTCCAATAACCGTGGTCGTGATCGTCAGCGCTCG
CAGAACTCCAATCTTTTGTGCACCAACTCCAACTGTGGTAGGCGTGGCCACACGATCGAAAACTGCTATTGGCCA
GGAGGGGGGAAAGCAGGACAGTTCCCTGCAGGTTTCGGCAAACAGAGAGGAACGACCAACGCTGCGACTACCAAT
GCCGAGCAGACATCCGCTAACTCGGCAGCGAATACTACTGAGCAAGTTTTCGCGCTCGTTGCCCATGATCAGCAC
GACGCCGTCTCAGAGGTACCACCTTCCCCAACCCATCCTTCATCATCTCCTTCTGACAAATCCAATGTCAGGCCG
TCCTACAATATCATCCCACTTACATTCGGGACGATTGAAGCAGATGATTGGAGGGGGAACGACAATGAACTTACA
CAGTCTATACCTGAGTGCCACAATGTCGATATAAATGTTAACGATGTTGCTACTTTGCTTGATTCCGGAGCGAGC
GACCACTGTTTCGTCGGCAGACCTCTGTTCTCCAAATACCAAACCATCTCACCACCTCGTAAGGGGAATTCTGCG
GGGAAAGATTCAACGTTTACGGTTGACGGTGCAGGGATGGTGGAATTTACCACTGTCATAGACGGTGTATCGTCG
AGGATCGTGCTGAGCGACGTTCTCCACACGCCGCACCTCCGTTCTAACTTGATCTCGGTGTCCAAGTTGGTCTCT
AAAGGAATGAGTGTGAGCTTTGATGGCGACGTAGCGAGAGTGAAGAGGTCGGGAAATGTTATTGTACTTACAGCA
ATCAAAAGGAATGGCCTATATGTTGTACCGACCACGAGTTCCTCGCGTCCTGAGGCGAACATCTCTCAGAGCAAG
AAACAGGCAGTGGCTTTCGACATCTGGCACCGACGACTCGGTCATGCTGTTGCTGGTCCTACAGAGTTGAAAGCT
TTATGTGAAGACTGCATATATGGAACACACACAACTCACCCCTTCCCTGACTCGAGCTCTGCTGAAACTGAAGCC
CTACAACGTGTCTACATCGATATTTGGGGACCGTCGCCTGTCCAGTCGGCCGGTGGGTTGAAATACTTCATGTTG
ATCATCGACGGCGCCACATCTTACCGAATGGTGAATTTCCTACCCACGAAGTTGGCTGATGCTACACTGAAGGTC
TTCCGGGACTTCCATCGCCAGGCAGAACAGCAAACGGGCAAAACGCTGAAGCGAGTAAAGGTGGACATGGGGAGG
GAATGGTTCAACGCCTCGTGGGACACGTACGTAAAAGAACACGGTATCACCCTTGACTTTACCACCCCATACGCC
CACCAGCAAAATGGCAAGGCTGAGCGGTCTATGCGTACGCTCCTTGACACGGCCCGTACGATGCTCACCGACTCC
GGCTTGCCGCAGAAATATTGGGCTGATGCTGTCCTCACTGCTGCGTATATTCGTAACTTCATCCCAAATACCCGT
ACACCTGATGTCATACCTGCCGAGGCGTGGACAAACCAGAGACAGGATCTTTCACACCTCCGTCCCTTTGGTTCT
GTTGCATATGCTCACATCCCCGCCGAAGTCAGCCCTTCGAAGTTGTCTGCACGCTCTGTCAAGCTAGTCCTTATT
GGGTACTATGATAGGACAGGTTATAAGCTGATGGATCGATTGACCGGCGCCGCTTTCAAGTCGCGCGACGTGATT
TTCGAGGAGGCTAAACCCCACTACTCGACGGATCCCATTGTCACCTATCCTGCTGACGACGCCCAGGCCACAACA
CCCCGCTCATCAGTCATTGCACCTCGACCCAAACCAATTTCATCCTTACACCCTACTCCTGCTGCTCCTACTCTA
TCACATAACCCGTTACCTATCACACCTCCAAAGCCGCCTGCCGTTCCACAATCGCAGAAGACTCCCGATATTTCG
GATAGCGAGGATGAGGTATCCAAAGCTGTCATGCCGGACGGTGACACCCCCATTGCTATCCGCAAGCCTAAACGG
GAGGTTAAGCTGAGTGCAAGGATGAAGGACAGTCTGGAATACATGAATAGGCCTACTGCAAGCATGGTTTCTGCG
TTTGTAGTGGACGACTCCGCAGTTCCTAGCACCTTCAAGCAGGCTATGTTACGCCCGGACCTCTGGATGGAGCCC
ATGTTGAAGGAACTCGCTGTCATGGAGGAGAAGAGTGTCTTTCGTCTCGTCCCTCGGCCAGTTGACAAGAATGTC
GTCAAGTCTAAGTGGGTCTTTGCGAATAAGTATGACGAAGAGGGTAGGATTGTGACTAGGAAAGCGAGGTTGGTG
GCGAAAGGATTCACACAGATCCTGGGGGAAGACTATGATGAGACTTACACTTCGGTTGCTCGGTTGGAGTCCGTA
CGGCTAGTTTGTGCGGTCGCCGCTTCTCTTGGCCTACGCCTCTGGCAAGTCGACTTCGTTTCTGCATTCTTGAAC
AGTAAAAATTCCTTCGAAGTCTACATGGAACCACCGCCGGGTTTTGACGAGGGGGGAGATCGAGTGTGGCTGCTC
CTCAAAACCCTCTATGGGACAATGCAGGGCGCCCATGATTGGGCGCAGACTCTCGAACATGCCTACCAAGGACAC
GGATATTATACTTCCAAAGCAGATCCACAAGTCCGCTTCAAGACTGTCAATAACGAGCTCACCTTGACATCTACA
TGGACTGATGACATACTTGGCGCGTCCTCGACGGAAATGGGGGAGATTAAAGCCAAAGAGGAGCTGAGGAGTAGC
TATGAGATCAAGGATTTGGGAACGGCGAGATTCATTCTGGGGATGAAGATTGAACGTAATGACGCCGACGGCAGC
ATCACCTTATCACAACGGGCATACTGTGAACGAATGCTTGAGCGCTTCAGCATGAACGACGCAAATCCTCGCCGA
ACTCCTTTACCTGCTAGTGTTACTCTCTCGATCAAGGACTCGCCTAAGACGGAGGAGGAGATTGTGGACATGAAG
GGTGTACCATATCGTGAGGCCCTTGGATCCCTCATGTGGCTACAAGTCGCAACTCGTCCCGATTTATCATTTGCT
GTCAATCTACTTTCACGTTTCGCGAATAATCCTGGCAGAGCTCACTGGAACGCACTCAAACACACACTCGCATAT
GTCAAGGCGACGCTCGATTACGGAGTGACATACTACCATAATTCCAGCCTCCGTCCATTTGGATATGTCGACTCT
GACTACGCCGGAGATGTTGACGGGCGCCGCTCCACAGAGGGGCATATATTCTTCGTAGGGGGAGGACCAGTATCT
TGGGCTAGCAAGCGACAGGAAACTGTTGTGCTATCGACGGTGGAGGCGGAGTACATGGCCTTTACTAGGGCGACT
CAACAGGCCATTTGGCTTGACAAGTTCATGTGCGAGATTGGGTTGAAGCAGGAAAGACCTACGAATGTCTTTGGA
GATAACACCGGAGCGATAGCGAACACACAGAACAACAAGAACCACCGCCGAACTAAACACATCAACGTCAAACAT
CATTTCATTAAGGAGACGGCAATGATGGGTCTGGTGGCATATCCTTATGTCTGTTCAGCTGAGAATCTGGCCGAC
ATCCTCACAAAATCACTTCCGAAGGACGCTGTTACATATTCTTGCGAGGAGATGGGCTTGTGTGGATGA
Transcript >AgabiH97|036400
ATGGCTGGCACTGGCGGTAGTGCACCCCCAATTTTCGCTGACGCAGCGAAATTCAACGGAACGAACTGGGTTGCT
TGGAATGGGTTGATTCGGATAGCCGCCGATTTACGAGGCGTCTTTGGTTACCTCGATGGTACAATCCCCAACCCA
TCCCCACAGAATAACATTACTCCAACCCCGACTCCCACCACAGCAGCGGACGCCGCTACAACAGCCCAAACACCG
GTTGATACACCCTGGGAGTCGACTGCTCCCTCGGCTACCAAGTGGCGAGTTAGGAATGCCTGGACAATGGGCTTG
CTCATATATAACACGGCCGATCCGGTAGGACTTGGCATAAACATCAACGGATCAACTGCAGAAGCTTGGAAATCA
TACACAGACACCTACCAGATCACCTCCGAGATTGCCCTTCTCAACGCCGAGCAAGACCTTCATAACGTAGTTTTC
AATGATGGGGAGGACTTCGTCGACTTCATCTCGCGTCTTCGCACAAAGTGGTCGAATGCTACAGCACTCGGTGCT
CAAATCAGTGACATCTCGTTCAGGACTATCATCTTGAATGCATTGCCGTGTTCATGGGATCCCATCGTCGCTACT
CTTTATACCACTCAGACTTCTCGTGATGCTATAAATCAACTCATGACTCACTGGGCGAGGATCAGTCGCGACCGC
ACCAATAACACCCAAACTTCAACCTCGGCACTCCAAACCATTTCCAATAACCGTGGTCGTGATCGTCAGCGCTCG
CAGAACTCCAATCTTTTGTGCACCAACTCCAACTGTGGTAGGCGTGGCCACACGATCGAAAACTGCTATTGGCCA
GGAGGGGGGAAAGCAGGACAGTTCCCTGCAGGTTTCGGCAAACAGAGAGGAACGACCAACGCTGCGACTACCAAT
GCCGAGCAGACATCCGCTAACTCGGCAGCGAATACTACTGAGCAAGTTTTCGCGCTCGTTGCCCATGATCAGCAC
GACGCCGTCTCAGAGGTACCACCTTCCCCAACCCATCCTTCATCATCTCCTTCTGACAAATCCAATGTCAGGCCG
TCCTACAATATCATCCCACTTACATTCGGGACGATTGAAGCAGATGATTGGAGGGGGAACGACAATGAACTTACA
CAGTCTATACCTGAGTGCCACAATGTCGATATAAATGTTAACGATGTTGCTACTTTGCTTGATTCCGGAGCGAGC
GACCACTGTTTCGTCGGCAGACCTCTGTTCTCCAAATACCAAACCATCTCACCACCTCGTAAGGGGAATTCTGCG
GGGAAAGATTCAACGTTTACGGTTGACGGTGCAGGGATGGTGGAATTTACCACTGTCATAGACGGTGTATCGTCG
AGGATCGTGCTGAGCGACGTTCTCCACACGCCGCACCTCCGTTCTAACTTGATCTCGGTGTCCAAGTTGGTCTCT
AAAGGAATGAGTGTGAGCTTTGATGGCGACGTAGCGAGAGTGAAGAGGTCGGGAAATGTTATTGTACTTACAGCA
ATCAAAAGGAATGGCCTATATGTTGTACCGACCACGAGTTCCTCGCGTCCTGAGGCGAACATCTCTCAGAGCAAG
AAACAGGCAGTGGCTTTCGACATCTGGCACCGACGACTCGGTCATGCTGTTGCTGGTCCTACAGAGTTGAAAGCT
TTATGTGAAGACTGCATATATGGAACACACACAACTCACCCCTTCCCTGACTCGAGCTCTGCTGAAACTGAAGCC
CTACAACGTGTCTACATCGATATTTGGGGACCGTCGCCTGTCCAGTCGGCCGGTGGGTTGAAATACTTCATGTTG
ATCATCGACGGCGCCACATCTTACCGAATGGTGAATTTCCTACCCACGAAGTTGGCTGATGCTACACTGAAGGTC
TTCCGGGACTTCCATCGCCAGGCAGAACAGCAAACGGGCAAAACGCTGAAGCGAGTAAAGGTGGACATGGGGAGG
GAATGGTTCAACGCCTCGTGGGACACGTACGTAAAAGAACACGGTATCACCCTTGACTTTACCACCCCATACGCC
CACCAGCAAAATGGCAAGGCTGAGCGGTCTATGCGTACGCTCCTTGACACGGCCCGTACGATGCTCACCGACTCC
GGCTTGCCGCAGAAATATTGGGCTGATGCTGTCCTCACTGCTGCGTATATTCGTAACTTCATCCCAAATACCCGT
ACACCTGATGTCATACCTGCCGAGGCGTGGACAAACCAGAGACAGGATCTTTCACACCTCCGTCCCTTTGGTTCT
GTTGCATATGCTCACATCCCCGCCGAAGTCAGCCCTTCGAAGTTGTCTGCACGCTCTGTCAAGCTAGTCCTTATT
GGGTACTATGATAGGACAGGTTATAAGCTGATGGATCGATTGACCGGCGCCGCTTTCAAGTCGCGCGACGTGATT
TTCGAGGAGGCTAAACCCCACTACTCGACGGATCCCATTGTCACCTATCCTGCTGACGACGCCCAGGCCACAACA
CCCCGCTCATCAGTCATTGCACCTCGACCCAAACCAATTTCATCCTTACACCCTACTCCTGCTGCTCCTACTCTA
TCACATAACCCGTTACCTATCACACCTCCAAAGCCGCCTGCCGTTCCACAATCGCAGAAGACTCCCGATATTTCG
GATAGCGAGGATGAGGTATCCAAAGCTGTCATGCCGGACGGTGACACCCCCATTGCTATCCGCAAGCCTAAACGG
GAGGTTAAGCTGAGTGCAAGGATGAAGGACAGTCTGGAATACATGAATAGGCCTACTGCAAGCATGGTTTCTGCG
TTTGTAGTGGACGACTCCGCAGTTCCTAGCACCTTCAAGCAGGCTATGTTACGCCCGGACCTCTGGATGGAGCCC
ATGTTGAAGGAACTCGCTGTCATGGAGGAGAAGAGTGTCTTTCGTCTCGTCCCTCGGCCAGTTGACAAGAATGTC
GTCAAGTCTAAGTGGGTCTTTGCGAATAAGTATGACGAAGAGGGTAGGATTGTGACTAGGAAAGCGAGGTTGGTG
GCGAAAGGATTCACACAGATCCTGGGGGAAGACTATGATGAGACTTACACTTCGGTTGCTCGGTTGGAGTCCGTA
CGGCTAGTTTGTGCGGTCGCCGCTTCTCTTGGCCTACGCCTCTGGCAAGTCGACTTCGTTTCTGCATTCTTGAAC
AGTAAAAATTCCTTCGAAGTCTACATGGAACCACCGCCGGGTTTTGACGAGGGGGGAGATCGAGTGTGGCTGCTC
CTCAAAACCCTCTATGGGACAATGCAGGGCGCCCATGATTGGGCGCAGACTCTCGAACATGCCTACCAAGGACAC
GGATATTATACTTCCAAAGCAGATCCACAAGTCCGCTTCAAGACTGTCAATAACGAGCTCACCTTGACATCTACA
TGGACTGATGACATACTTGGCGCGTCCTCGACGGAAATGGGGGAGATTAAAGCCAAAGAGGAGCTGAGGAGTAGC
TATGAGATCAAGGATTTGGGAACGGCGAGATTCATTCTGGGGATGAAGATTGAACGTAATGACGCCGACGGCAGC
ATCACCTTATCACAACGGGCATACTGTGAACGAATGCTTGAGCGCTTCAGCATGAACGACGCAAATCCTCGCCGA
ACTCCTTTACCTGCTAGTGTTACTCTCTCGATCAAGGACTCGCCTAAGACGGAGGAGGAGATTGTGGACATGAAG
GGTGTACCATATCGTGAGGCCCTTGGATCCCTCATGTGGCTACAAGTCGCAACTCGTCCCGATTTATCATTTGCT
GTCAATCTACTTTCACGTTTCGCGAATAATCCTGGCAGAGCTCACTGGAACGCACTCAAACACACACTCGCATAT
GTCAAGGCGACGCTCGATTACGGAGTGACATACTACCATAATTCCAGCCTCCGTCCATTTGGATATGTCGACTCT
GACTACGCCGGAGATGTTGACGGGCGCCGCTCCACAGAGGGGCATATATTCTTCGTAGGGGGAGGACCAGTATCT
TGGGCTAGCAAGCGACAGGAAACTGTTGTGCTATCGACGGTGGAGGCGGAGTACATGGCCTTTACTAGGGCGACT
CAACAGGCCATTTGGCTTGACAAGTTCATGTGCGAGATTGGGTTGAAGCAGGAAAGACCTACGAATGTCTTTGGA
GATAACACCGGAGCGATAGCGAACACACAGAACAACAAGAACCACCGCCGAACTAAACACATCAACGTCAAACAT
CATTTCATTAAGGAGACGGCAATGATGGGTCTGGTGGCATATCCTTATGTCTGTTCAGCTGAGAATCTGGCCGAC
ATCCTCACAAAATCACTTCCGAAGGACGCTGTTACATATTCTTGCGAGGAGATGGGCTTGTGTGGATGA
Gene >AgabiH97|036400
ATGGCTGGCACTGGCGGTAGTGCACCCCCAATTTTCGCTGACGCAGCGAAATTCAACGGAACGAACTGGGTTGCT
TGGAATGGGTTGATTCGGATAGCCGCCGATTTACGAGGCGTCTTTGGTTACCTCGATGGTACAATCCCCAACCCA
TCCCCACAGAATAACATTACTCCAACCCCGACTCCCACCACAGCAGCGGACGCCGCTACAACAGCCCAAACACCG
GTTGATACACCCTGGGAGTCGACTGCTCCCTCGGCTACCAAGTGGCGAGTTAGGAATGCCTGGACAATGGGCTTG
CTCATATATAACACGGCCGATCCGGTAGGACTTGGCATAAACATCAACGGATCAACTGCAGAAGCTTGGAAATCA
TACACAGACACCTACCAGATCACCTCCGAGATTGCCCTTCTCAACGCCGAGCAAGACCTTCATAACGTAGTTTTC
AATGATGGGGAGGACTTCGTCGACTTCATCTCGCGTCTTCGCACAAAGTGGTCGAATGCTACAGCACTCGGTGCT
CAAATCAGTGACATCTCGTTCAGGACTATCATCTTGAATGCATTGCCGTGTTCATGGGATCCCATCGTCGCTACT
CTTTATACCACTCAGACTTCTCGTGATGCTATAAATCAACTCATGACTCACTGGGCGAGGATCAGTCGCGACCGC
ACCAATAACACCCAAACTTCAACCTCGGCACTCCAAACCATTTCCAATAACCGTGGTCGTGATCGTCAGCGCTCG
CAGAACTCCAATCTTTTGTGCACCAACTCCAACTGTGGTAGGCGTGGCCACACGATCGAAAACTGCTATTGGCCA
GGAGGGGGGAAAGCAGGACAGTTCCCTGCAGGTTTCGGCAAACAGAGAGGAACGACCAACGCTGCGACTACCAAT
GCCGAGCAGACATCCGCTAACTCGGCAGCGAATACTACTGAGCAAGTTTTCGCGCTCGTTGCCCATGATCAGCAC
GACGCCGTCTCAGAGGTACCACCTTCCCCAACCCATCCTTCATCATCTCCTTCTGACAAATCCAATGTCAGGCCG
TCCTACAATATCATCCCACTTACATTCGGGACGATTGAAGCAGATGATTGGAGGGGGAACGACAATGAACTTACA
CAGTCTATACCTGAGTGCCACAATGTCGATATAAATGTTAACGATGTTGCTACTTTGCTTGATTCCGGAGCGAGC
GACCACTGTTTCGTCGGCAGACCTCTGTTCTCCAAATACCAAACCATCTCACCACCTCGTAAGGGGAATTCTGCG
GGGAAAGATTCAACGTTTACGGTTGACGGTGCAGGGATGGTGGAATTTACCACTGTCATAGACGGTGTATCGTCG
AGGATCGTGCTGAGCGACGTTCTCCACACGCCGCACCTCCGTTCTAACTTGATCTCGGTGTCCAAGTTGGTCTCT
AAAGGAATGAGTGTGAGCTTTGATGGCGACGTAGCGAGAGTGAAGAGGTCGGGAAATGTTATTGTACTTACAGCA
ATCAAAAGGAATGGCCTATATGTTGTACCGACCACGAGTTCCTCGCGTCCTGAGGCGAACATCTCTCAGAGCAAG
AAACAGGCAGTGGCTTTCGACATCTGGCACCGACGACTCGGTCATGCTGGTGTCGAAACGATAAAGAGGATGATA
AAGGGAAATACAGTATGGTCGATGGTGTCGAAGTTGCTGGTCCTACAGAGTTGAAAGCTTTATGTGAAGACTGCA
TATATGGAACACACACAACTCACCCCTTCCCTGACTCGAGCTCTGCTGAAACTGAAGCCCTACAACGTGTCTACA
TCGATATTTGGGGACCGTCGCCTGTCCAGTCGGCCGGTGGGTTGAAATACTTCATGTTGATCATCGACGGCGCCA
CATCTTACCGAATGGTGAATTTCCTACCCACGAAGTTGGCTGATGCTACACTGAAGGTCTTCCGGGACTTCCATC
GCCAGGCAGAACAGCAAACGGGCAAAACGCTGAAGCGAGTAAAGGTGGACATGGGGAGGGAATGGTTCAACGCCT
CGTGGGACACGTACGTAAAAGAACACGGTATCACCCTTGACTTTACCACCCCATACGCCCACCAGCAAAATGGCA
AGGCTGAGCGGTCTATGCGTACGCTCCTTGACACGGCCCGTACGATGCTCACCGACTCCGGCTTGCCGCAGAAAT
ATTGGGCTGATGCTGTCCTCACTGCTGCGTATATTCGTAACTTCATCCCAAATACCCGTACACCTGATGTCATAC
CTGCCGAGGCGTGGACAAACCAGAGACAGGATCTTTCACACCTCCGTCCCTTTGGTTCTGTTGCATATGCTCACA
TCCCCGCCGAAGTCAGCCCTTCGAAGTTGTCTGCACGCTCTGTCAAGCTAGTCCTTATTGGGTACTATGATAGGA
CAGGTTATAAGCTGATGGATCGATTGACCGGCGCCGCTTTCAAGTCGCGCGACGTGATTTTCGAGGAGGCTAAAC
CCCACTACTCGACGGATCCCATTGTCACCTATCCTGCTGACGACGCCCAGGCCACAACACCCCGCTCATCAGTCA
TTGCACCTCGACCCAAACCAATTTCATCCTTACACCCTACTCCTGCTGCTCCTACTCTATCACATAACCCGTTAC
CTATCACACCTCCAAAGCCGCCTGCCGTTCCACAATCGCAGAAGACTCCCGATATTTCGGATAGCGAGGATGAGG
TATCCAAAGCTGTCATGCCGGACGGTGACACCCCCATTGCTATCCGCAAGCCTAAACGGGAGGTTAAGCTGAGTG
CAAGGATGAAGGACAGTCTGGAATACATGAATAGGCCTACTGCAAGCATGGTTTCTGCGTTTGTAGTGGACGACT
CCGCAGTTCCTAGCACCTTCAAGCAGGCTATGTTACGCCCGGACCTCTGGATGGAGCCCATGTTGAAGGAACTCG
CTGTCATGGAGGAGAAGAGTGTCTTTCGTCTCGTCCCTCGGCCAGTTGACAAGAATGTCGTCAAGTCTAAGTGGG
TCTTTGCGAATAAGTATGACGAAGAGGGTAGGATTGTGACTAGGAAAGCGAGGTTGGTGGCGAAAGGATTCACAC
AGATCCTGGGGGAAGACTATGATGAGACTTACACTTCGGTTGCTCGGTTGGAGTCCGTACGGCTAGTTTGTGCGG
TCGCCGCTTCTCTTGGCCTACGCCTCTGGCAAGTCGACTTCGTTTCTGCATTCTTGAACAGTAAAAATTCCTTCG
AAGTCTACATGGAACCACCGCCGGGTTTTGACGAGGGGGGAGATCGAGTGTGGCTGCTCCTCAAAACCCTCTATG
GGACAATGCAGGGCGCCCATGATTGGGCGCAGACTCTCGAACATGCCTACCAAGGACACGGATATTATACTTCCA
AAGCAGATCCACAAGTCCGCTTCAAGACTGTCAATAACGAGCTCACCTTGACATCTACATGGACTGATGACATAC
TTGGCGCGTCCTCGACGGAAATGGGGGAGATTAAAGCCAAAGAGGAGCTGAGGAGTAGCTATGAGATCAAGGATT
TGGGAACGGCGAGATTCATTCTGGGGATGAAGATTGAACGTAATGACGCCGACGGCAGCATCACCTTATCACAAC
GGGCATACTGTGAACGAATGCTTGAGCGCTTCAGCATGAACGACGCAAATCCTCGCCGAACTCCTTTACCTGCTA
GTGTTACTCTCTCGATCAAGGACTCGCCTAAGACGGAGGAGGAGATTGTGGACATGAAGGGTGTACCATATCGTG
AGGCCCTTGGATCCCTCATGTGGCTACAAGTCGCAACTCGTCCCGATTTATCATTTGCTGTCAATCTACTTTCAC
GTTTCGCGAATAATCCTGGCAGAGCTCACTGGAACGCACTCAAACACACACTCGCATATGTCAAGGCGACGCTCG
ATTACGGAGTGACATACTACCATAATTCCAGCCTCCGTCCATTTGGATATGTCGACTCTGACTACGCCGGAGATG
TTGACGGGCGCCGCTCCACAGAGGGGCATATATTCTTCGTAGGGGGAGGACCAGTATCTTGGGCTAGCAAGCGAC
AGGAAACTGTTGTGCTATCGACGGTGGAGGCGGAGTACATGGCCTTTACTAGGGCGACTCAACAGGCCATTTGGC
TTGACAAGTTCATGTGCGAGATTGGGTTGAAGCAGGAAAGACCTACGAATGTCTTTGGAGATAACACCGGAGCGA
TAGCGAACACACAGAACAACAAGAACCACCGCCGAACTAAACACATCAACGTCAAACATCATTTCATTAAGGAGA
CGGCAATGATGGGTCTGGTGGCATATCCTTATGTCTGTTCAGCTGAGAATCTGGCCGACATCCTCACAAAATCAC
TTCCGAAGGACGCTGTTACATATTCTTGCGAGGAGATGGGCTTGTGTGGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail