Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|036270
Gene name
Locationscaffold_13:719797..721128
Strand-
Gene length (bp)1331
Transcript length (bp)981
Coding sequence length (bp)981
Protein length (aa) 327

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00412 LIM LIM domain 1.6E-12 10 67
PF00412 LIM LIM domain 3.5E-10 255 309

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P50462|CSRP3_MOUSE Cysteine and glycine-rich protein 3 OS=Mus musculus GN=Csrp3 PE=1 SV=1 4 67 4.0E-16
sp|Q4U0T9|CSRP3_BOVIN Cysteine and glycine-rich protein 3 OS=Bos taurus GN=CSRP3 PE=2 SV=1 4 67 4.0E-16
sp|P50461|CSRP3_HUMAN Cysteine and glycine-rich protein 3 OS=Homo sapiens GN=CSRP3 PE=1 SV=1 4 67 4.0E-16
sp|P50463|CSRP3_RAT Cysteine and glycine-rich protein 3 OS=Rattus norvegicus GN=Csrp3 PE=1 SV=1 4 67 9.0E-16
sp|Q5RCT4|CSRP1_PONAB Cysteine and glycine-rich protein 1 OS=Pongo abelii GN=CSRP1 PE=2 SV=3 4 67 4.0E-15
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P50462|CSRP3_MOUSE Cysteine and glycine-rich protein 3 OS=Mus musculus GN=Csrp3 PE=1 SV=1 4 67 4.0E-16
sp|Q4U0T9|CSRP3_BOVIN Cysteine and glycine-rich protein 3 OS=Bos taurus GN=CSRP3 PE=2 SV=1 4 67 4.0E-16
sp|P50461|CSRP3_HUMAN Cysteine and glycine-rich protein 3 OS=Homo sapiens GN=CSRP3 PE=1 SV=1 4 67 4.0E-16
sp|P50463|CSRP3_RAT Cysteine and glycine-rich protein 3 OS=Rattus norvegicus GN=Csrp3 PE=1 SV=1 4 67 9.0E-16
sp|Q5RCT4|CSRP1_PONAB Cysteine and glycine-rich protein 1 OS=Pongo abelii GN=CSRP1 PE=2 SV=3 4 67 4.0E-15
sp|P21291|CSRP1_HUMAN Cysteine and glycine-rich protein 1 OS=Homo sapiens GN=CSRP1 PE=1 SV=3 4 67 4.0E-15
sp|P97315|CSRP1_MOUSE Cysteine and glycine-rich protein 1 OS=Mus musculus GN=Csrp1 PE=1 SV=3 4 67 5.0E-15
sp|P47875|CSRP1_RAT Cysteine and glycine-rich protein 1 OS=Rattus norvegicus GN=Csrp1 PE=1 SV=2 4 67 5.0E-15
sp|Q3MHY1|CSRP1_BOVIN Cysteine and glycine-rich protein 1 OS=Bos taurus GN=CSRP1 PE=2 SV=3 5 67 5.0E-15
sp|Q05158|CSRP2_COTJA Cysteine and glycine-rich protein 2 OS=Coturnix coturnix japonica GN=CSRP2 PE=1 SV=2 4 72 1.0E-14
sp|P50460|CSRP2_CHICK Cysteine and glycine-rich protein 2 OS=Gallus gallus GN=CSRP2 PE=2 SV=3 4 72 1.0E-14
sp|P67967|CSRP1_COTJA Cysteine and glycine-rich protein 1 OS=Coturnix coturnix japonica GN=CSRP1 PE=2 SV=2 5 67 2.0E-14
sp|P67966|CSRP1_CHICK Cysteine and glycine-rich protein 1 OS=Gallus gallus GN=CSRP1 PE=1 SV=2 5 67 2.0E-14
sp|P36201|CRIP2_RAT Cysteine-rich protein 2 OS=Rattus norvegicus GN=Crip2 PE=2 SV=1 255 322 6.0E-14
sp|Q9DCT8|CRIP2_MOUSE Cysteine-rich protein 2 OS=Mus musculus GN=Crip2 PE=1 SV=1 255 322 7.0E-14
sp|Q0VFX8|CRIP2_BOVIN Cysteine-rich protein 2 OS=Bos taurus GN=CRIP2 PE=2 SV=1 255 322 7.0E-14
sp|Q56K04|CRIP1_BOVIN Cysteine-rich protein 1 OS=Bos taurus GN=CRIP1 PE=3 SV=3 253 317 8.0E-14
sp|P52943|CRIP2_HUMAN Cysteine-rich protein 2 OS=Homo sapiens GN=CRIP2 PE=1 SV=1 255 322 8.0E-14
sp|P97314|CSRP2_MOUSE Cysteine and glycine-rich protein 2 OS=Mus musculus GN=Csrp2 PE=1 SV=3 4 72 8.0E-14
sp|Q62908|CSRP2_RAT Cysteine and glycine-rich protein 2 OS=Rattus norvegicus GN=Csrp2 PE=2 SV=3 4 72 8.0E-14
sp|Q16527|CSRP2_HUMAN Cysteine and glycine-rich protein 2 OS=Homo sapiens GN=CSRP2 PE=1 SV=3 4 72 9.0E-14
sp|Q32LE9|CSRP2_BOVIN Cysteine and glycine-rich protein 2 OS=Bos taurus GN=CSRP2 PE=2 SV=3 4 72 9.0E-14
sp|P50238|CRIP1_HUMAN Cysteine-rich protein 1 OS=Homo sapiens GN=CRIP1 PE=1 SV=3 253 317 2.0E-13
sp|Q6Q6R5|CRIP3_HUMAN Cysteine-rich protein 3 OS=Homo sapiens GN=CRIP3 PE=2 SV=2 251 315 3.0E-13
sp|Q62908|CSRP2_RAT Cysteine and glycine-rich protein 2 OS=Rattus norvegicus GN=Csrp2 PE=2 SV=3 1 68 4.0E-13
sp|P63255|CRIP1_RAT Cysteine-rich protein 1 OS=Rattus norvegicus GN=Crip1 PE=1 SV=2 253 317 4.0E-13
sp|P63254|CRIP1_MOUSE Cysteine-rich protein 1 OS=Mus musculus GN=Crip1 PE=1 SV=2 253 317 4.0E-13
sp|P97314|CSRP2_MOUSE Cysteine and glycine-rich protein 2 OS=Mus musculus GN=Csrp2 PE=1 SV=3 1 67 5.0E-13
sp|Q16527|CSRP2_HUMAN Cysteine and glycine-rich protein 2 OS=Homo sapiens GN=CSRP2 PE=1 SV=3 1 67 5.0E-13
sp|Q32LE9|CSRP2_BOVIN Cysteine and glycine-rich protein 2 OS=Bos taurus GN=CSRP2 PE=2 SV=3 1 67 5.0E-13
sp|Q5R7Y1|CRIP2_PONAB Cysteine-rich protein 2 OS=Pongo abelii GN=CRIP2 PE=2 SV=1 255 322 5.0E-13
sp|P97315|CSRP1_MOUSE Cysteine and glycine-rich protein 1 OS=Mus musculus GN=Csrp1 PE=1 SV=3 233 314 7.0E-13
sp|P47875|CSRP1_RAT Cysteine and glycine-rich protein 1 OS=Rattus norvegicus GN=Csrp1 PE=1 SV=2 233 314 7.0E-13
sp|Q3MHY1|CSRP1_BOVIN Cysteine and glycine-rich protein 1 OS=Bos taurus GN=CSRP1 PE=2 SV=3 233 314 7.0E-13
sp|Q5RCT4|CSRP1_PONAB Cysteine and glycine-rich protein 1 OS=Pongo abelii GN=CSRP1 PE=2 SV=3 1 67 8.0E-13
sp|P21291|CSRP1_HUMAN Cysteine and glycine-rich protein 1 OS=Homo sapiens GN=CSRP1 PE=1 SV=3 1 67 8.0E-13
sp|P97315|CSRP1_MOUSE Cysteine and glycine-rich protein 1 OS=Mus musculus GN=Csrp1 PE=1 SV=3 1 67 8.0E-13
sp|P47875|CSRP1_RAT Cysteine and glycine-rich protein 1 OS=Rattus norvegicus GN=Csrp1 PE=1 SV=2 1 67 8.0E-13
sp|P50462|CSRP3_MOUSE Cysteine and glycine-rich protein 3 OS=Mus musculus GN=Csrp3 PE=1 SV=1 251 321 1.0E-12
sp|P50461|CSRP3_HUMAN Cysteine and glycine-rich protein 3 OS=Homo sapiens GN=CSRP3 PE=1 SV=1 251 321 1.0E-12
sp|Q5RCT4|CSRP1_PONAB Cysteine and glycine-rich protein 1 OS=Pongo abelii GN=CSRP1 PE=2 SV=3 233 314 1.0E-12
sp|P21291|CSRP1_HUMAN Cysteine and glycine-rich protein 1 OS=Homo sapiens GN=CSRP1 PE=1 SV=3 233 314 1.0E-12
sp|Q3MHY1|CSRP1_BOVIN Cysteine and glycine-rich protein 1 OS=Bos taurus GN=CSRP1 PE=2 SV=3 1 98 1.0E-12
sp|Q05158|CSRP2_COTJA Cysteine and glycine-rich protein 2 OS=Coturnix coturnix japonica GN=CSRP2 PE=1 SV=2 1 67 1.0E-12
sp|P50460|CSRP2_CHICK Cysteine and glycine-rich protein 2 OS=Gallus gallus GN=CSRP2 PE=2 SV=3 1 67 1.0E-12
sp|P36201|CRIP2_RAT Cysteine-rich protein 2 OS=Rattus norvegicus GN=Crip2 PE=2 SV=1 255 325 1.0E-12
sp|Q9DCT8|CRIP2_MOUSE Cysteine-rich protein 2 OS=Mus musculus GN=Crip2 PE=1 SV=1 255 325 1.0E-12
sp|Q6Q6R3|CRIP3_MOUSE Cysteine-rich protein 3 OS=Mus musculus GN=Crip3 PE=2 SV=1 255 322 1.0E-12
sp|Q4U0T9|CSRP3_BOVIN Cysteine and glycine-rich protein 3 OS=Bos taurus GN=CSRP3 PE=2 SV=1 251 321 2.0E-12
sp|P67967|CSRP1_COTJA Cysteine and glycine-rich protein 1 OS=Coturnix coturnix japonica GN=CSRP1 PE=2 SV=2 252 314 3.0E-12
sp|P67966|CSRP1_CHICK Cysteine and glycine-rich protein 1 OS=Gallus gallus GN=CSRP1 PE=1 SV=2 252 314 3.0E-12
sp|P50462|CSRP3_MOUSE Cysteine and glycine-rich protein 3 OS=Mus musculus GN=Csrp3 PE=1 SV=1 1 72 4.0E-12
sp|Q4U0T9|CSRP3_BOVIN Cysteine and glycine-rich protein 3 OS=Bos taurus GN=CSRP3 PE=2 SV=1 1 72 5.0E-12
sp|P50461|CSRP3_HUMAN Cysteine and glycine-rich protein 3 OS=Homo sapiens GN=CSRP3 PE=1 SV=1 1 72 5.0E-12
sp|P50463|CSRP3_RAT Cysteine and glycine-rich protein 3 OS=Rattus norvegicus GN=Csrp3 PE=1 SV=1 1 72 5.0E-12
sp|Q0VFX8|CRIP2_BOVIN Cysteine-rich protein 2 OS=Bos taurus GN=CRIP2 PE=2 SV=1 255 315 5.0E-12
sp|P52943|CRIP2_HUMAN Cysteine-rich protein 2 OS=Homo sapiens GN=CRIP2 PE=1 SV=1 255 315 6.0E-12
sp|P67967|CSRP1_COTJA Cysteine and glycine-rich protein 1 OS=Coturnix coturnix japonica GN=CSRP1 PE=2 SV=2 1 67 7.0E-12
sp|P67966|CSRP1_CHICK Cysteine and glycine-rich protein 1 OS=Gallus gallus GN=CSRP1 PE=1 SV=2 1 67 7.0E-12
sp|P67967|CSRP1_COTJA Cysteine and glycine-rich protein 1 OS=Coturnix coturnix japonica GN=CSRP1 PE=2 SV=2 248 320 8.0E-12
sp|P67966|CSRP1_CHICK Cysteine and glycine-rich protein 1 OS=Gallus gallus GN=CSRP1 PE=1 SV=2 248 320 8.0E-12
sp|Q6Q6R5|CRIP3_HUMAN Cysteine-rich protein 3 OS=Homo sapiens GN=CRIP3 PE=2 SV=2 255 322 8.0E-12
sp|P50461|CSRP3_HUMAN Cysteine and glycine-rich protein 3 OS=Homo sapiens GN=CSRP3 PE=1 SV=1 248 319 1.0E-11
sp|Q4U0T9|CSRP3_BOVIN Cysteine and glycine-rich protein 3 OS=Bos taurus GN=CSRP3 PE=2 SV=1 248 319 2.0E-11
sp|Q5RCT4|CSRP1_PONAB Cysteine and glycine-rich protein 1 OS=Pongo abelii GN=CSRP1 PE=2 SV=3 248 319 2.0E-11
sp|P21291|CSRP1_HUMAN Cysteine and glycine-rich protein 1 OS=Homo sapiens GN=CSRP1 PE=1 SV=3 248 319 2.0E-11
sp|P97315|CSRP1_MOUSE Cysteine and glycine-rich protein 1 OS=Mus musculus GN=Csrp1 PE=1 SV=3 248 319 2.0E-11
sp|P47875|CSRP1_RAT Cysteine and glycine-rich protein 1 OS=Rattus norvegicus GN=Csrp1 PE=1 SV=2 248 319 2.0E-11
sp|Q05158|CSRP2_COTJA Cysteine and glycine-rich protein 2 OS=Coturnix coturnix japonica GN=CSRP2 PE=1 SV=2 255 319 2.0E-11
sp|P50460|CSRP2_CHICK Cysteine and glycine-rich protein 2 OS=Gallus gallus GN=CSRP2 PE=2 SV=3 255 319 2.0E-11
sp|Q24400|MLP2_DROME Muscle LIM protein Mlp84B OS=Drosophila melanogaster GN=Mlp84B PE=1 SV=1 251 319 2.0E-11
sp|P50463|CSRP3_RAT Cysteine and glycine-rich protein 3 OS=Rattus norvegicus GN=Csrp3 PE=1 SV=1 251 321 3.0E-11
sp|P50462|CSRP3_MOUSE Cysteine and glycine-rich protein 3 OS=Mus musculus GN=Csrp3 PE=1 SV=1 248 319 4.0E-11
sp|Q3MHY1|CSRP1_BOVIN Cysteine and glycine-rich protein 1 OS=Bos taurus GN=CSRP1 PE=2 SV=3 248 319 4.0E-11
sp|P97314|CSRP2_MOUSE Cysteine and glycine-rich protein 2 OS=Mus musculus GN=Csrp2 PE=1 SV=3 246 319 4.0E-11
sp|Q62908|CSRP2_RAT Cysteine and glycine-rich protein 2 OS=Rattus norvegicus GN=Csrp2 PE=2 SV=3 246 319 4.0E-11
sp|Q62908|CSRP2_RAT Cysteine and glycine-rich protein 2 OS=Rattus norvegicus GN=Csrp2 PE=2 SV=3 248 319 4.0E-11
sp|Q16527|CSRP2_HUMAN Cysteine and glycine-rich protein 2 OS=Homo sapiens GN=CSRP2 PE=1 SV=3 246 319 4.0E-11
sp|Q32LE9|CSRP2_BOVIN Cysteine and glycine-rich protein 2 OS=Bos taurus GN=CSRP2 PE=2 SV=3 246 319 4.0E-11
sp|P50463|CSRP3_RAT Cysteine and glycine-rich protein 3 OS=Rattus norvegicus GN=Csrp3 PE=1 SV=1 248 319 5.0E-11
sp|Q05158|CSRP2_COTJA Cysteine and glycine-rich protein 2 OS=Coturnix coturnix japonica GN=CSRP2 PE=1 SV=2 248 319 7.0E-11
sp|P50460|CSRP2_CHICK Cysteine and glycine-rich protein 2 OS=Gallus gallus GN=CSRP2 PE=2 SV=3 248 319 7.0E-11
sp|Q24400|MLP2_DROME Muscle LIM protein Mlp84B OS=Drosophila melanogaster GN=Mlp84B PE=1 SV=1 10 67 8.0E-11
sp|P97314|CSRP2_MOUSE Cysteine and glycine-rich protein 2 OS=Mus musculus GN=Csrp2 PE=1 SV=3 248 319 1.0E-10
sp|Q16527|CSRP2_HUMAN Cysteine and glycine-rich protein 2 OS=Homo sapiens GN=CSRP2 PE=1 SV=3 248 319 1.0E-10
sp|Q32LE9|CSRP2_BOVIN Cysteine and glycine-rich protein 2 OS=Bos taurus GN=CSRP2 PE=2 SV=3 248 319 1.0E-10
sp|Q5R7Y1|CRIP2_PONAB Cysteine-rich protein 2 OS=Pongo abelii GN=CRIP2 PE=2 SV=1 255 315 1.0E-10
sp|Q24400|MLP2_DROME Muscle LIM protein Mlp84B OS=Drosophila melanogaster GN=Mlp84B PE=1 SV=1 252 320 1.0E-09
sp|P53777|MLP1_DROME Muscle LIM protein 1 OS=Drosophila melanogaster GN=Mlp60A PE=2 SV=1 10 67 1.0E-09
sp|Q24400|MLP2_DROME Muscle LIM protein Mlp84B OS=Drosophila melanogaster GN=Mlp84B PE=1 SV=1 255 319 2.0E-09
sp|Q24400|MLP2_DROME Muscle LIM protein Mlp84B OS=Drosophila melanogaster GN=Mlp84B PE=1 SV=1 10 67 3.0E-09
sp|Q6Q6R5|CRIP3_HUMAN Cysteine-rich protein 3 OS=Homo sapiens GN=CRIP3 PE=2 SV=2 5 70 2.0E-08
sp|P36201|CRIP2_RAT Cysteine-rich protein 2 OS=Rattus norvegicus GN=Crip2 PE=2 SV=1 5 77 3.0E-08
sp|Q9DCT8|CRIP2_MOUSE Cysteine-rich protein 2 OS=Mus musculus GN=Crip2 PE=1 SV=1 5 77 3.0E-08
sp|Q0VFX8|CRIP2_BOVIN Cysteine-rich protein 2 OS=Bos taurus GN=CRIP2 PE=2 SV=1 5 77 3.0E-08
sp|Q24400|MLP2_DROME Muscle LIM protein Mlp84B OS=Drosophila melanogaster GN=Mlp84B PE=1 SV=1 255 319 3.0E-08
sp|P53777|MLP1_DROME Muscle LIM protein 1 OS=Drosophila melanogaster GN=Mlp60A PE=2 SV=1 251 309 3.0E-08
sp|Q56K04|CRIP1_BOVIN Cysteine-rich protein 1 OS=Bos taurus GN=CRIP1 PE=3 SV=3 10 72 4.0E-08
sp|Q24400|MLP2_DROME Muscle LIM protein Mlp84B OS=Drosophila melanogaster GN=Mlp84B PE=1 SV=1 10 100 4.0E-08
sp|P52943|CRIP2_HUMAN Cysteine-rich protein 2 OS=Homo sapiens GN=CRIP2 PE=1 SV=1 10 77 6.0E-08
sp|P50238|CRIP1_HUMAN Cysteine-rich protein 1 OS=Homo sapiens GN=CRIP1 PE=1 SV=3 10 72 6.0E-08
sp|Q5R7Y1|CRIP2_PONAB Cysteine-rich protein 2 OS=Pongo abelii GN=CRIP2 PE=2 SV=1 10 77 7.0E-08
sp|Q24400|MLP2_DROME Muscle LIM protein Mlp84B OS=Drosophila melanogaster GN=Mlp84B PE=1 SV=1 10 67 1.0E-07
sp|P36201|CRIP2_RAT Cysteine-rich protein 2 OS=Rattus norvegicus GN=Crip2 PE=2 SV=1 7 72 2.0E-07
sp|P52943|CRIP2_HUMAN Cysteine-rich protein 2 OS=Homo sapiens GN=CRIP2 PE=1 SV=1 7 72 2.0E-07
sp|P63255|CRIP1_RAT Cysteine-rich protein 1 OS=Rattus norvegicus GN=Crip1 PE=1 SV=2 10 72 2.0E-07
sp|P63254|CRIP1_MOUSE Cysteine-rich protein 1 OS=Mus musculus GN=Crip1 PE=1 SV=2 10 72 2.0E-07
sp|Q9BIW5|LIMC_DICDI LIM domain-containing protein C OS=Dictyostelium discoideum GN=limC PE=2 SV=1 9 73 2.0E-07
sp|Q9DCT8|CRIP2_MOUSE Cysteine-rich protein 2 OS=Mus musculus GN=Crip2 PE=1 SV=1 7 72 3.0E-07
sp|Q0VFX8|CRIP2_BOVIN Cysteine-rich protein 2 OS=Bos taurus GN=CRIP2 PE=2 SV=1 7 121 6.0E-07
sp|Q24400|MLP2_DROME Muscle LIM protein Mlp84B OS=Drosophila melanogaster GN=Mlp84B PE=1 SV=1 251 314 7.0E-07
sp|Q9BIW5|LIMC_DICDI LIM domain-containing protein C OS=Dictyostelium discoideum GN=limC PE=2 SV=1 254 315 7.0E-07
sp|Q9BIW5|LIMC_DICDI LIM domain-containing protein C OS=Dictyostelium discoideum GN=limC PE=2 SV=1 252 303 1.0E-06
sp|Q6Q6R3|CRIP3_MOUSE Cysteine-rich protein 3 OS=Mus musculus GN=Crip3 PE=2 SV=1 10 115 2.0E-06
sp|Q24400|MLP2_DROME Muscle LIM protein Mlp84B OS=Drosophila melanogaster GN=Mlp84B PE=1 SV=1 10 88 3.0E-06
sp|Q5R7Y1|CRIP2_PONAB Cysteine-rich protein 2 OS=Pongo abelii GN=CRIP2 PE=2 SV=1 7 72 4.0E-06
sp|Q8I7C3|LASP1_DROME LIM and SH3 domain protein Lasp OS=Drosophila melanogaster GN=Lasp PE=1 SV=2 255 303 4.0E-06
sp|Q80XB4|NRAP_MOUSE Nebulin-related-anchoring protein OS=Mus musculus GN=Nrap PE=1 SV=3 255 303 4.0E-06
sp|P53669|LIMK1_RAT LIM domain kinase 1 OS=Rattus norvegicus GN=Limk1 PE=1 SV=1 249 317 7.0E-06
sp|P53668|LIMK1_MOUSE LIM domain kinase 1 OS=Mus musculus GN=Limk1 PE=1 SV=1 249 317 1.0E-05
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|036270
MHPFGGAQLCPRCTKTVYAAEQVMGPGRKLYHKPCLSCMICKKRLDSYSLVEHDQEPYCKTCYAKNFSTRDLRQA
NLPVREPSSNPSSPPRTGLTGSSMPTSPPRFGQSNARSPPSSPPKAMISSPTPKRTSFDTTQSHDSEDAGPKEVP
IVPLPGSKSSPVAERPVPVHPSQRSDGISNEPKRLYNSSFSTYGKGTNTTSAALNLLEQEGVKNLVPKTTGTRYG
AALSGKVNFQRTGTPTGGSPRKWGSESPHCPKCSQRVYFAEQVKAIGQTWHKNCLRCHECNTLLDSNRLRDHDSV
PYCVRCYGKFHGPQGSGYALLGKAGG*
Coding >AgabiH97|036270
ATGCACCCCTTTGGCGGCGCCCAGCTCTGCCCCAGATGCACAAAGACCGTCTACGCCGCAGAACAGGTCATGGGC
CCAGGCAGAAAGCTTTATCACAAGCCATGCCTTTCCTGCATGATCTGCAAGAAGCGACTCGACTCATACAGTCTC
GTGGAACACGACCAGGAGCCATACTGTAAGACTTGTTACGCAAAGAACTTCAGCACTCGCGACCTCCGTCAGGCC
AATCTACCCGTTAGAGAACCCTCCTCTAACCCATCTTCCCCTCCGAGGACAGGGCTTACCGGCTCTTCTATGCCT
ACCTCGCCCCCTCGTTTTGGCCAATCGAACGCCCGCTCACCTCCGTCATCCCCGCCTAAGGCAATGATTTCTTCT
CCCACCCCTAAGCGCACCTCCTTCGACACCACGCAGTCTCATGATAGCGAGGACGCGGGACCCAAAGAAGTTCCA
ATTGTTCCTTTACCTGGCTCAAAGTCTTCGCCGGTGGCCGAGCGCCCTGTTCCTGTTCATCCTTCCCAGCGCTCT
GATGGCATTTCAAACGAACCCAAACGCCTGTACAATTCCTCCTTCTCCACCTATGGAAAAGGTACCAACACCACT
TCTGCCGCCCTGAATCTTTTGGAACAAGAAGGTGTTAAGAACCTTGTGCCGAAGACGACCGGAACTCGATATGGT
GCAGCTTTGAGTGGTAAAGTCAACTTTCAGAGGACTGGCACGCCAACTGGCGGTTCTCCTCGTAAATGGGGTTCA
GAATCTCCTCACTGTCCCAAATGCTCTCAGCGAGTCTATTTCGCGGAGCAGGTTAAAGCCATTGGTCAAACATGG
CACAAAAACTGCCTCAGGTGCCATGAATGTAATACCCTTTTGGATTCTAATCGCCTTCGTGACCATGATAGTGTA
CCATACTGTGTAAGATGTTATGGCAAGTTCCACGGCCCACAAGGTAGTGGATATGCTCTTCTTGGCAAGGCTGGT
GGCTGA
Transcript >AgabiH97|036270
ATGCACCCCTTTGGCGGCGCCCAGCTCTGCCCCAGATGCACAAAGACCGTCTACGCCGCAGAACAGGTCATGGGC
CCAGGCAGAAAGCTTTATCACAAGCCATGCCTTTCCTGCATGATCTGCAAGAAGCGACTCGACTCATACAGTCTC
GTGGAACACGACCAGGAGCCATACTGTAAGACTTGTTACGCAAAGAACTTCAGCACTCGCGACCTCCGTCAGGCC
AATCTACCCGTTAGAGAACCCTCCTCTAACCCATCTTCCCCTCCGAGGACAGGGCTTACCGGCTCTTCTATGCCT
ACCTCGCCCCCTCGTTTTGGCCAATCGAACGCCCGCTCACCTCCGTCATCCCCGCCTAAGGCAATGATTTCTTCT
CCCACCCCTAAGCGCACCTCCTTCGACACCACGCAGTCTCATGATAGCGAGGACGCGGGACCCAAAGAAGTTCCA
ATTGTTCCTTTACCTGGCTCAAAGTCTTCGCCGGTGGCCGAGCGCCCTGTTCCTGTTCATCCTTCCCAGCGCTCT
GATGGCATTTCAAACGAACCCAAACGCCTGTACAATTCCTCCTTCTCCACCTATGGAAAAGGTACCAACACCACT
TCTGCCGCCCTGAATCTTTTGGAACAAGAAGGTGTTAAGAACCTTGTGCCGAAGACGACCGGAACTCGATATGGT
GCAGCTTTGAGTGGTAAAGTCAACTTTCAGAGGACTGGCACGCCAACTGGCGGTTCTCCTCGTAAATGGGGTTCA
GAATCTCCTCACTGTCCCAAATGCTCTCAGCGAGTCTATTTCGCGGAGCAGGTTAAAGCCATTGGTCAAACATGG
CACAAAAACTGCCTCAGGTGCCATGAATGTAATACCCTTTTGGATTCTAATCGCCTTCGTGACCATGATAGTGTA
CCATACTGTGTAAGATGTTATGGCAAGTTCCACGGCCCACAAGGTAGTGGATATGCTCTTCTTGGCAAGGCTGGT
GGCTGA
Gene >AgabiH97|036270
ATGCACCCCTTTGGCGGCGCCCAGCTCTGCCCCAGATGCACAAAGACCGTCTACGCCGCAGAACAGGTATGCCGC
ATTCTCTCAACCTATCTGGTCCTGACTGGTCTGTCAGGTCATGGGCCCAGGCAGAAAGGTTGGCCAATCTCCCGC
CCCATTGCGATACTCACTGACCCTGTTCCCCAGCTTTATCACAAGGTACTCCCTTCGTTTTCCATACAAAGAACT
CTTTCTTAGGCACCCCAGCCATGCCTTTCCTGCATGATCTGCAAGAAGCGACTCGACTCATACAGTCTCGTGGAA
CACGACCAGGAGGTACGCTTTCCGCACATCTCGGCTCAACCTTTGATTGACGCCGCTTCTTAGCCATACTGGTAG
GCATTTGTGTTAATAGCAGTATATCTTCCTCATTTCTACTCAGTAAGACTTGTTACGCAAAGAACTTCAGCACTC
GCGACCTCCGTCAGGCCAATCTACCCGTTAGAGAACCCTCCTCTAACCCATCTTCCCCTCCGAGGACAGGGCTTA
CCGGCTCTTCTATGCCTACCTCGCCCCCTCGTTTTGGCCAATCGAACGCCCGCTCACCTCCGTCATCCCCGCCTA
AGGCAATGATTTCTTCTCCCACCCCTAAGCGCACCTCCTTCGACACCACGCAGTCTCATGATAGCGAGGACGCGG
GACCCAAAGAAGTTCCAATTGTTCCTTTACCTGGCTCAAAGTCTTCGCCGGTGGCCGAGCGCCCTGTTCCTGTTC
ATCCTTCCCAGCGCTCTGATGGCATTTCAAACGAACCCAAACGCCTGTACAATTCCTCCTTCTCCACCTATGGAA
AAGGTACCAACACCACTTCTGCCGCCCTGAATCTTTTGGAACAAGAAGGTGTTAAGAACCTTGTGCCGAAGACGA
CCGGAACTCGATATGGTGCAGCTTTGAGTGGTAAAGTCAACTTTCAGAGGACTGGCACGCCAACTGGCGGTTCTC
CTCGTAAATGGGGTTCAGAATCTCCTCACTGTCCCAAATGCTCTCAGCGAGTCTATTTCGCGGAGCAGGTGAGTC
GTTTCTGTAGTAGAATATTATTAGCATATTAAATCCAATATCTAGGTTAAAGCCATTGGTCAAACATGGCACAAA
AACTGCCTCAGGTGCCATGAATGTAATACCCTTTTGGATTCTAATCGCCTTCGTGACCATGATAGTGTACCATAC
TGTGTAAGATGTTATGGCAAGGTGAGTTTCTACGCAGCCTTCAATGCGCTTGGTTATGACGTGCTGCGCTTTCAC
AGTTCCACGGCCCACAAGGTAGTGGATATGCTCTTCTTGGCAAGGCTGGTGGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail