Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|036220
Gene name
Locationscaffold_13:706351..710704
Strand+
Gene length (bp)4353
Transcript length (bp)3951
Coding sequence length (bp)3951
Protein length (aa) 1317

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12859 ANAPC1 Anaphase-promoting complex subunit 1 WD40 beta-propeller domain 6.1E-06 105 239

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9H1A4|APC1_HUMAN Anaphase-promoting complex subunit 1 OS=Homo sapiens GN=ANAPC1 PE=1 SV=1 753 1305 2.0E-95
sp|P53995|APC1_MOUSE Anaphase-promoting complex subunit 1 OS=Mus musculus GN=Anapc1 PE=1 SV=2 749 1305 2.0E-94
sp|P24686|BIME_EMENI Negative regulator of mitosis OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bimE PE=2 SV=2 772 1305 3.0E-91
sp|Q9URV2|APC1_SCHPO Anaphase-promoting complex subunit 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cut4 PE=1 SV=1 501 1307 6.0E-83
sp|Q9FFF9|APC1_ARATH Anaphase-promoting complex subunit 1 OS=Arabidopsis thaliana GN=APC1 PE=2 SV=1 375 1305 1.0E-70
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9H1A4|APC1_HUMAN Anaphase-promoting complex subunit 1 OS=Homo sapiens GN=ANAPC1 PE=1 SV=1 753 1305 2.0E-95
sp|P53995|APC1_MOUSE Anaphase-promoting complex subunit 1 OS=Mus musculus GN=Anapc1 PE=1 SV=2 749 1305 2.0E-94
sp|P24686|BIME_EMENI Negative regulator of mitosis OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bimE PE=2 SV=2 772 1305 3.0E-91
sp|Q9URV2|APC1_SCHPO Anaphase-promoting complex subunit 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cut4 PE=1 SV=1 501 1307 6.0E-83
sp|Q9FFF9|APC1_ARATH Anaphase-promoting complex subunit 1 OS=Arabidopsis thaliana GN=APC1 PE=2 SV=1 375 1305 1.0E-70
sp|Q54NC6|APC1_DICDI Anaphase-promoting complex subunit 1 OS=Dictyostelium discoideum GN=anapc1 PE=3 SV=1 873 1170 2.0E-48
sp|P53886|APC1_YEAST Anaphase-promoting complex subunit 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=APC1 PE=1 SV=2 960 1307 3.0E-43
sp|O18191|APC1_CAEEL Anaphase-promoting complex subunit 1 OS=Caenorhabditis elegans GN=mat-2 PE=1 SV=3 868 1307 8.0E-43
sp|Q54NC6|APC1_DICDI Anaphase-promoting complex subunit 1 OS=Dictyostelium discoideum GN=anapc1 PE=3 SV=1 1191 1305 4.0E-17
sp|Q54NC6|APC1_DICDI Anaphase-promoting complex subunit 1 OS=Dictyostelium discoideum GN=anapc1 PE=3 SV=1 757 846 1.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0005680 anaphase-promoting complex Yes
GO:0140535 intracellular protein-containing complex No
GO:0000152 nuclear ubiquitin ligase complex No
GO:0005575 cellular_component No
GO:0031461 cullin-RING ubiquitin ligase complex No
GO:0000151 ubiquitin ligase complex No
GO:1990234 transferase complex No
GO:1902494 catalytic complex No
GO:0140513 nuclear protein-containing complex No
GO:0032991 protein-containing complex No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 68 0.5

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|036220
MEAPFAADGRLPLPPQSTKNSSERPTFGPFTRSKTTSRTNASRSTLIPAIFVFLRSIGKIILQNGMEYSFSLPFI
VRKAWPLFPHGVMIQRVLEPSEFVEAELTGEAVLPTVFSMTSPLAEAAAVGLTAGIIGGCRSHTYTLKDEDENLI
RPLRSIPSTEMIVTVTRQGRDCSIYVVVTVDVERRKLSIWRYAYIKPKDMPTPLTENHSREQKKRQSFAAPVSRR
TSAIYDGAGRLRHPLSPGRRSPDTSPTADIFDVPLPSMPPLSALPRMAPALSTAKTLQSLVSGGSLQRSASGNAA
ARRVSINKNDTNATMDRMAFGARVDTDLEIPIEHGRMKAAYWMHRVYTQDIAEEDAKSWRDITFSAFDERYDGKE
ERCLLSFQLSKSQVAHVLSVVCGDEEVKAEHIAQIPAIASASICATREHAWDFIVLKPDHRLVLLTHGLREIPIT
ISGGLNAFPDGPRMDVDEGLQPVLHLSRVRTSSVAITFANEQRARLDLLFRPNCPLTTGCLSMLAHCLTSEGFFL
LHCAFLDRWSTREYSLIENIEFSCLTDAIYTIFQLQSEPAKRRGLWEQLGRSASHRNFKEDPVLRKLRRPPDAGQ
LKPILSVKKPSKFLSSMLYGFHTYAEYLRFNVSRFNDLLRLVPVICRIAVEVRPEWADYWQRLVPDPTSSWPRAG
ASPYLDDRLPVWPTDISAIFYGRLGNPEWKVPWHDVSYIAARFGVEPSFAYGRGDPLDGFQDLSVLYTHLTDGQT
PDVRTRAERAILQLVSRDRTKLLDLLPLGIVAPLREAARTCQLNPPPNWPLDAYMAIGRNDLAALADENVEHLNR
DGLRINKDFFSPSKPRQTINHLVSAARAAGGGEVDVVTGVELDLEAFTSIRFGQDRRLEEVGRMLCSSTTTSIKI
PDRPDLSEHDQTKEQQNHVIRVADRTLALPYGRAMFTFGSLSTVTREAYRIPKLEFTVRVQPLNITVPPEAGKIP
VESLSWGEFHNGVAAGLRISPTATGVESSWIAFNKPSELSPEHAGFLLGLGLTGHLKHMMTWHTFSYLTPKHDLT
SIGVLLGLSAANVGSADQHVTKLLAVHTPALLPTPSVDLNVSLMTQAAGLAGVGLLYLGTKNRRMAEVCLNQISR
RDLVQPDLSNEHREAYTFAAALAFGMIMLGKGTTIPADSHLLSRLNVLVHGDADPMLAKNIRMPFDINLTSPAAT
IALGLMYLRTERQDIADLLPIPDTVLTLNRIQPSFLAIRTIARNLIMWNEIAPSNEWLISQLPESVREAIEARSK
HGQAVDESLELAYYNILAGCCFVIGLKYAAIGVYEWPGFRP*
Coding >AgabiH97|036220
ATGGAGGCGCCATTCGCCGCAGATGGTCGTTTGCCTCTTCCTCCTCAATCTACCAAAAATTCCTCTGAGCGCCCT
ACTTTCGGTCCTTTCACCCGTTCCAAAACTACTTCGCGGACAAACGCTAGTCGTTCGACCCTCATTCCTGCGATC
TTTGTCTTCCTCCGGAGTATTGGAAAAATAATTTTGCAGAATGGCATGGAATATTCCTTTTCGTTGCCTTTCATT
GTCAGGAAGGCATGGCCTTTATTTCCCCATGGCGTCATGATCCAGCGTGTACTTGAACCCAGTGAATTCGTTGAA
GCCGAGTTGACAGGAGAGGCTGTTCTTCCCACCGTATTCTCTATGACGAGCCCTCTGGCCGAAGCCGCTGCAGTC
GGGTTGACAGCTGGAATAATTGGTGGATGCCGAAGTCATACATATACTTTGAAGGATGAAGATGAAAACTTGATT
AGGCCTCTCAGGTCGATTCCGTCTACCGAGATGATCGTCACTGTCACTCGTCAAGGACGCGACTGCTCTATCTAT
GTTGTCGTTACTGTGGACGTCGAACGGCGAAAACTGTCCATTTGGCGGTACGCGTACATCAAGCCCAAGGATATG
CCAACACCGCTCACAGAAAATCATTCACGAGAACAAAAGAAACGACAATCGTTCGCCGCGCCAGTAAGCAGACGT
ACATCTGCTATATACGACGGTGCAGGGCGTCTGCGCCACCCTCTTTCCCCTGGCCGTCGGTCACCCGACACCTCC
CCTACTGCTGATATTTTCGACGTTCCTCTTCCGAGTATGCCACCTCTTTCTGCCCTTCCGAGAATGGCGCCTGCT
CTTTCAACCGCAAAGACGCTACAGTCGCTTGTTTCGGGAGGTTCTTTGCAACGGTCGGCCTCAGGCAATGCAGCT
GCTAGACGGGTTTCCATAAACAAGAATGATACCAATGCGACGATGGATCGTATGGCTTTTGGTGCCCGTGTGGAT
ACGGATCTGGAGATCCCTATAGAGCATGGAAGAATGAAGGCCGCGTATTGGATGCACAGAGTTTATACTCAAGAT
ATTGCAGAAGAAGACGCAAAGTCATGGCGCGACATCACATTTTCTGCTTTTGATGAACGGTACGATGGGAAGGAG
GAGCGATGCCTGCTTTCTTTTCAACTTTCAAAATCTCAAGTTGCACATGTACTTTCCGTCGTTTGTGGAGACGAA
GAAGTGAAGGCCGAACATATTGCTCAGATACCTGCTATTGCCTCTGCATCGATATGTGCCACTCGTGAACACGCA
TGGGATTTCATTGTTCTCAAACCTGACCACCGGCTCGTACTTCTGACCCATGGCCTCCGAGAAATTCCCATCACA
ATAAGTGGAGGACTCAATGCGTTTCCCGACGGTCCCAGAATGGATGTTGATGAAGGTTTACAACCTGTCCTTCAT
CTGTCGCGCGTTCGAACTTCCTCTGTCGCCATCACCTTTGCCAATGAACAACGAGCACGCTTAGACCTGCTGTTT
AGGCCAAATTGTCCTCTGACAACGGGATGCCTTTCCATGCTTGCACACTGTCTGACCTCTGAGGGTTTCTTTCTA
CTACATTGCGCCTTCCTCGACCGTTGGAGTACGAGGGAGTACTCTTTAATTGAGAATATCGAGTTCAGTTGCCTG
ACAGACGCTATCTACACTATCTTCCAGCTTCAAAGCGAACCAGCCAAGCGACGTGGGCTTTGGGAGCAACTCGGA
CGTTCAGCATCTCACAGAAACTTCAAGGAAGATCCTGTTTTACGCAAGCTTCGTAGGCCACCAGACGCTGGCCAG
CTGAAACCCATACTTTCCGTTAAAAAGCCTTCAAAGTTCCTTTCCTCTATGCTATATGGATTTCACACTTACGCG
GAGTACCTGCGCTTCAATGTCAGTCGATTTAACGACCTATTAAGATTGGTTCCTGTGATTTGTCGGATAGCAGTG
GAAGTTCGTCCAGAATGGGCTGATTATTGGCAAAGACTTGTGCCTGATCCTACGAGCAGTTGGCCAAGAGCGGGA
GCTTCGCCTTATCTAGACGATCGATTACCAGTATGGCCGACTGACATTTCTGCCATATTTTATGGACGCCTTGGT
AACCCGGAATGGAAAGTCCCATGGCATGATGTATCATACATTGCTGCCAGGTTCGGAGTGGAACCATCCTTTGCG
TACGGCAGGGGTGATCCACTTGACGGTTTTCAAGATTTGTCAGTTTTGTATACGCATTTAACAGACGGTCAAACG
CCAGACGTACGGACTCGGGCAGAACGCGCCATTCTTCAACTTGTATCAAGGGACCGTACTAAGCTACTTGATTTA
TTGCCTCTTGGCATTGTCGCTCCGTTGCGAGAAGCTGCTAGAACATGTCAATTGAATCCACCCCCAAATTGGCCA
CTTGATGCGTATATGGCGATTGGCAGGAACGATTTAGCAGCGTTGGCTGATGAAAATGTAGAACACTTGAATAGA
GATGGGCTGAGAATAAATAAAGACTTTTTTAGTCCTAGCAAACCACGTCAAACCATCAACCATCTCGTCTCAGCT
GCTCGAGCGGCAGGCGGTGGTGAAGTGGATGTGGTTACTGGTGTAGAACTAGATCTCGAGGCGTTCACAAGCATT
CGATTTGGTCAGGATCGCCGATTGGAAGAAGTTGGTCGCATGTTGTGCTCGTCCACAACTACATCTATCAAAATT
CCCGATCGCCCTGATCTTAGTGAACATGATCAAACTAAGGAGCAACAGAACCATGTCATTCGTGTAGCAGATCGA
ACTCTCGCACTCCCTTATGGCCGTGCAATGTTCACTTTTGGGTCTCTTTCTACGGTCACCCGTGAAGCTTATAGG
ATCCCCAAGCTCGAGTTTACAGTTCGTGTGCAGCCTTTGAATATCACTGTCCCTCCAGAAGCTGGAAAGATTCCT
GTCGAGTCGCTCAGCTGGGGCGAGTTTCATAACGGCGTGGCCGCGGGTTTGCGTATATCTCCAACTGCTACCGGA
GTGGAAAGTTCTTGGATTGCTTTCAATAAGCCATCGGAGTTGTCTCCCGAACACGCTGGGTTCTTGTTAGGGCTT
GGATTGACGGGACACCTCAAGCACATGATGACTTGGCATACGTTCAGCTACTTGACTCCAAAACATGACTTGACA
TCGATTGGAGTTCTGTTGGGATTGTCCGCTGCAAACGTTGGGAGCGCTGACCAGCACGTTACGAAGCTGTTAGCG
GTACATACGCCGGCCTTACTACCTACGCCCTCAGTTGACCTCAATGTATCGCTGATGACCCAAGCTGCTGGACTT
GCTGGAGTGGGGTTGTTGTATCTAGGGACGAAGAATCGTCGAATGGCCGAAGTTTGCTTGAATCAGATTAGCAGG
AGGGATTTGGTTCAGCCTGACTTGAGTAATGAGCATCGAGAGGCGTATACGTTTGCAGCAGCACTTGCGTTCGGT
ATGATCATGCTGGGAAAGGGGACTACCATTCCAGCCGATTCACATTTACTCTCAAGACTGAACGTTCTCGTCCAT
GGTGATGCGGATCCGATGCTCGCAAAGAATATACGCATGCCATTTGATATCAATCTCACATCGCCTGCGGCAACG
ATTGCTCTCGGACTAATGTATCTTCGGACGGAGAGACAAGATATTGCGGATTTATTGCCTATCCCTGATACGGTA
CTCACACTCAATCGAATTCAACCAAGCTTCCTGGCGATCAGAACGATTGCAAGGAACTTGATTATGTGGAACGAA
ATTGCACCGTCAAACGAATGGCTGATTTCACAATTGCCGGAAAGCGTACGGGAGGCGATTGAAGCGAGGTCAAAA
CACGGTCAAGCAGTTGATGAATCATTGGAGTTGGCATACTATAACATATTGGCCGGCTGTTGTTTCGTCATTGGT
TTGAAGTATGCTGCGATTGGCGTATACGAATGGCCTGGCTTTCGACCATAG
Transcript >AgabiH97|036220
ATGGAGGCGCCATTCGCCGCAGATGGTCGTTTGCCTCTTCCTCCTCAATCTACCAAAAATTCCTCTGAGCGCCCT
ACTTTCGGTCCTTTCACCCGTTCCAAAACTACTTCGCGGACAAACGCTAGTCGTTCGACCCTCATTCCTGCGATC
TTTGTCTTCCTCCGGAGTATTGGAAAAATAATTTTGCAGAATGGCATGGAATATTCCTTTTCGTTGCCTTTCATT
GTCAGGAAGGCATGGCCTTTATTTCCCCATGGCGTCATGATCCAGCGTGTACTTGAACCCAGTGAATTCGTTGAA
GCCGAGTTGACAGGAGAGGCTGTTCTTCCCACCGTATTCTCTATGACGAGCCCTCTGGCCGAAGCCGCTGCAGTC
GGGTTGACAGCTGGAATAATTGGTGGATGCCGAAGTCATACATATACTTTGAAGGATGAAGATGAAAACTTGATT
AGGCCTCTCAGGTCGATTCCGTCTACCGAGATGATCGTCACTGTCACTCGTCAAGGACGCGACTGCTCTATCTAT
GTTGTCGTTACTGTGGACGTCGAACGGCGAAAACTGTCCATTTGGCGGTACGCGTACATCAAGCCCAAGGATATG
CCAACACCGCTCACAGAAAATCATTCACGAGAACAAAAGAAACGACAATCGTTCGCCGCGCCAGTAAGCAGACGT
ACATCTGCTATATACGACGGTGCAGGGCGTCTGCGCCACCCTCTTTCCCCTGGCCGTCGGTCACCCGACACCTCC
CCTACTGCTGATATTTTCGACGTTCCTCTTCCGAGTATGCCACCTCTTTCTGCCCTTCCGAGAATGGCGCCTGCT
CTTTCAACCGCAAAGACGCTACAGTCGCTTGTTTCGGGAGGTTCTTTGCAACGGTCGGCCTCAGGCAATGCAGCT
GCTAGACGGGTTTCCATAAACAAGAATGATACCAATGCGACGATGGATCGTATGGCTTTTGGTGCCCGTGTGGAT
ACGGATCTGGAGATCCCTATAGAGCATGGAAGAATGAAGGCCGCGTATTGGATGCACAGAGTTTATACTCAAGAT
ATTGCAGAAGAAGACGCAAAGTCATGGCGCGACATCACATTTTCTGCTTTTGATGAACGGTACGATGGGAAGGAG
GAGCGATGCCTGCTTTCTTTTCAACTTTCAAAATCTCAAGTTGCACATGTACTTTCCGTCGTTTGTGGAGACGAA
GAAGTGAAGGCCGAACATATTGCTCAGATACCTGCTATTGCCTCTGCATCGATATGTGCCACTCGTGAACACGCA
TGGGATTTCATTGTTCTCAAACCTGACCACCGGCTCGTACTTCTGACCCATGGCCTCCGAGAAATTCCCATCACA
ATAAGTGGAGGACTCAATGCGTTTCCCGACGGTCCCAGAATGGATGTTGATGAAGGTTTACAACCTGTCCTTCAT
CTGTCGCGCGTTCGAACTTCCTCTGTCGCCATCACCTTTGCCAATGAACAACGAGCACGCTTAGACCTGCTGTTT
AGGCCAAATTGTCCTCTGACAACGGGATGCCTTTCCATGCTTGCACACTGTCTGACCTCTGAGGGTTTCTTTCTA
CTACATTGCGCCTTCCTCGACCGTTGGAGTACGAGGGAGTACTCTTTAATTGAGAATATCGAGTTCAGTTGCCTG
ACAGACGCTATCTACACTATCTTCCAGCTTCAAAGCGAACCAGCCAAGCGACGTGGGCTTTGGGAGCAACTCGGA
CGTTCAGCATCTCACAGAAACTTCAAGGAAGATCCTGTTTTACGCAAGCTTCGTAGGCCACCAGACGCTGGCCAG
CTGAAACCCATACTTTCCGTTAAAAAGCCTTCAAAGTTCCTTTCCTCTATGCTATATGGATTTCACACTTACGCG
GAGTACCTGCGCTTCAATGTCAGTCGATTTAACGACCTATTAAGATTGGTTCCTGTGATTTGTCGGATAGCAGTG
GAAGTTCGTCCAGAATGGGCTGATTATTGGCAAAGACTTGTGCCTGATCCTACGAGCAGTTGGCCAAGAGCGGGA
GCTTCGCCTTATCTAGACGATCGATTACCAGTATGGCCGACTGACATTTCTGCCATATTTTATGGACGCCTTGGT
AACCCGGAATGGAAAGTCCCATGGCATGATGTATCATACATTGCTGCCAGGTTCGGAGTGGAACCATCCTTTGCG
TACGGCAGGGGTGATCCACTTGACGGTTTTCAAGATTTGTCAGTTTTGTATACGCATTTAACAGACGGTCAAACG
CCAGACGTACGGACTCGGGCAGAACGCGCCATTCTTCAACTTGTATCAAGGGACCGTACTAAGCTACTTGATTTA
TTGCCTCTTGGCATTGTCGCTCCGTTGCGAGAAGCTGCTAGAACATGTCAATTGAATCCACCCCCAAATTGGCCA
CTTGATGCGTATATGGCGATTGGCAGGAACGATTTAGCAGCGTTGGCTGATGAAAATGTAGAACACTTGAATAGA
GATGGGCTGAGAATAAATAAAGACTTTTTTAGTCCTAGCAAACCACGTCAAACCATCAACCATCTCGTCTCAGCT
GCTCGAGCGGCAGGCGGTGGTGAAGTGGATGTGGTTACTGGTGTAGAACTAGATCTCGAGGCGTTCACAAGCATT
CGATTTGGTCAGGATCGCCGATTGGAAGAAGTTGGTCGCATGTTGTGCTCGTCCACAACTACATCTATCAAAATT
CCCGATCGCCCTGATCTTAGTGAACATGATCAAACTAAGGAGCAACAGAACCATGTCATTCGTGTAGCAGATCGA
ACTCTCGCACTCCCTTATGGCCGTGCAATGTTCACTTTTGGGTCTCTTTCTACGGTCACCCGTGAAGCTTATAGG
ATCCCCAAGCTCGAGTTTACAGTTCGTGTGCAGCCTTTGAATATCACTGTCCCTCCAGAAGCTGGAAAGATTCCT
GTCGAGTCGCTCAGCTGGGGCGAGTTTCATAACGGCGTGGCCGCGGGTTTGCGTATATCTCCAACTGCTACCGGA
GTGGAAAGTTCTTGGATTGCTTTCAATAAGCCATCGGAGTTGTCTCCCGAACACGCTGGGTTCTTGTTAGGGCTT
GGATTGACGGGACACCTCAAGCACATGATGACTTGGCATACGTTCAGCTACTTGACTCCAAAACATGACTTGACA
TCGATTGGAGTTCTGTTGGGATTGTCCGCTGCAAACGTTGGGAGCGCTGACCAGCACGTTACGAAGCTGTTAGCG
GTACATACGCCGGCCTTACTACCTACGCCCTCAGTTGACCTCAATGTATCGCTGATGACCCAAGCTGCTGGACTT
GCTGGAGTGGGGTTGTTGTATCTAGGGACGAAGAATCGTCGAATGGCCGAAGTTTGCTTGAATCAGATTAGCAGG
AGGGATTTGGTTCAGCCTGACTTGAGTAATGAGCATCGAGAGGCGTATACGTTTGCAGCAGCACTTGCGTTCGGT
ATGATCATGCTGGGAAAGGGGACTACCATTCCAGCCGATTCACATTTACTCTCAAGACTGAACGTTCTCGTCCAT
GGTGATGCGGATCCGATGCTCGCAAAGAATATACGCATGCCATTTGATATCAATCTCACATCGCCTGCGGCAACG
ATTGCTCTCGGACTAATGTATCTTCGGACGGAGAGACAAGATATTGCGGATTTATTGCCTATCCCTGATACGGTA
CTCACACTCAATCGAATTCAACCAAGCTTCCTGGCGATCAGAACGATTGCAAGGAACTTGATTATGTGGAACGAA
ATTGCACCGTCAAACGAATGGCTGATTTCACAATTGCCGGAAAGCGTACGGGAGGCGATTGAAGCGAGGTCAAAA
CACGGTCAAGCAGTTGATGAATCATTGGAGTTGGCATACTATAACATATTGGCCGGCTGTTGTTTCGTCATTGGT
TTGAAGTATGCTGCGATTGGCGTATACGAATGGCCTGGCTTTCGACCATAG
Gene >AgabiH97|036220
ATGGAGGCGCCATTCGCCGCAGATGGTCGTTTGGTCAGGAAGGAGAAACCATCCAATGGGCTTGTCTGGGACTGC
TTGATGAGGTGGAACCCTCCAATTCCGTTCCTCAGCCTCTTCCTCCTCAATCTACCAAAAATTCCTCTGAGCGCC
CTACTTTCGGTCCTTTCACCCGTTCCAAAACTACTTCGCGGACAAACGCTAGTCGTTCGACCCTCATTCCTGCGA
TCTTTGTCTTCCTCCGGAGTATTGGAAAAATAATTTTGCAGAATGGCATGGAATATTCCTTTTCGTTGCCTTTCA
TTGTCAGGAAGGCATGGCCTTTATTTCCCCATGGCGTCATGATCCAGCGTGTACTTGAACCCAGTGAATTCGTTG
AAGCCGAGTTGACAGGAGAGGCTGTTCTTCCCACCGTATTCTCTATGACGAGCCCTCTGGCCGAAGCCGCTGCAG
TCGGGTTGACAGCTGGAATAATTGGTGGATGCCGAAGTCATACATATACTTTGAAGGATGAAGATGAAAACTTGA
TTAGGCCTCTCAGGTCGATTCCGTCTACCGAGATGATCGTCACTGTCACTCGTCAAGGACGCGACTGCTCTATCT
ATGTTGTCGTTACTGTGGACGTCGAACGGCGAAAACTGTCCATTTGGCGGTACGCGTACATCAAGCCCAAGGATA
TGCCAACACCGCTCACAGAAAATCATTCACGAGAACAAAAGAAACGACAATCGTTCGCCGCGCCAGTAAGCAGAC
GTACATCTGCTATATACGACGGTGCAGGGCGTCTGCGCCACCCTCTTTCCCCTGGCCGTCGGTCACCCGACACCT
CCCCTACTGCTGATATTTTCGACGTTCCTCTTCCGAGTATGCCACCTCTTTCTGCCCTTCCGAGAATGGCGCCTG
CTCTTTCAACCGCAAAGACGCTACAGTCGCTTGTTTCGGGAGGTTCTTTGCAACGGTCGGCCTCAGGCAATGCAG
CTGCTAGACGGGTTTCCATAAACAAGAATGATACCAATGCGACGATGGATCGTATGGCTTTTGGTGCCCGTGTGG
ATACGGATCTGGAGATCCCTATAGAGCATGGAAGAATGAAGGCCGCGTATTGGATGCACAGAGTTTATACTCAAG
ATATTGCAGAAGAAGAGTAAGTCTTTTGATAATTGTTCCATCTCGATACTAACTGACGCAGCGCAAAGTCATGGC
GCGACATCACATTTTCTGCTTTTGATGAACGGTACGATGGGAAGGAGGAGCGATGCCTGCTTTCTTTTCAACTTT
CAAAATCTCAAGTTGCACATGTACTTTCCGTCGTTTGTGGAGACGAAGAAGTGAAGGCCGAACATATTGCTCAGA
TACCTGCTATTGCCTCTGCATCGATATGTGCCACTCGTGAACACGCATGGGATTTCATTGTTCTCAAACCTGACC
ACCGGCTCGTACTTCTGACCCATGGCCTCCGAGAAATTCCCATCACAATAAGTGGAGGACTCAATGCGTTTCCCG
ACGGTCCCAGAATGGATGTTGATGAAGGTTTACAACCTGTCCTTCATCTGTCGCGCGTTCGAACTTCCTCTGTCG
CCATCACCTTTGCCAATGAACAACGAGCACGCTTAGACCTGCTGTTTAGGCCAAATTGTCCTCTGACAACGGGAT
GCCTTTCCATGCTTGCACACTGTCTGACCTCTGAGGGTTTCTTTCTACTACATTGCGCCTTCCTCGACCGTTGGA
GTACGAGGGAGTACTCTTTAATTGAGAATATCGAGTTCAGTTGCCTGACAGACGCTATCTACACTATCTTCCAGC
TTCAAAGCGAACCAGCCAAGCGACGTGGGCTTTGGGAGCAACTCGGACGTTCAGCATCTCACAGAAACTTCAAGG
AAGATCCTGTTTTACGCAAGCTTCGTAGGCCACCAGACGCTGGCCAGCTGAAACCCATACTTTCCGTTAAAAAGC
CTTCAAAGTTCCTTTCCTCTATGCTATATGGATTTCACACTTACGCGGAGTACCTGCGCTTCAATGTCAGTCGAT
TTAACGACCTATTAAGATTGGTTCCTGTGATTTGTCGGATAGCAGTGGAAGTTCGTCCAGAATGGGCTGATTATT
GGCAAAGACTTGTGCCTGATCCTACGAGCAGTTGGCCAAGAGCGGGAGCTTCGCGTACGCCTAGTCTATACTTCA
CCCGGCAGTATTTTGACTAACGTTTTTGATGAATTACAGCTTATCTAGACGATCGATTACCAGTATGGCCGACTG
ACATTTCTGCCATATTTTATGGACGCCTTGGTAACCCGGAATGGAAAGTCCCATGGCATGATGTATCATACATTG
CTGCCAGGTTCGGAGTGGAACCATCCTTTGCGTACGGCAGGGGTGATCCACTTGACGGTTTTCAAGATTTGTCAG
TTTTGTATACGCATTTAACAGACGGTCAAACGCCAGACGTACGGACTCGGGCAGAACGCGCCATTCTTCAACTTG
TATCAAGGGACCGTACTAAGCTACTTGATTTATTGCCTCTTGGCATTGTCGCTCCGTTGCGAGAAGCTGCTAGAA
CATGTCAATTGAATCCACCCCCAAATTGGCCACTTGATGCGTATATGGCGATTGGCAGGAACGATTTAGCAGCGT
TGGCTGATGAAAATGTAGAACACTTGAATAGAGATGGGCTGAGAATAAATAAAGACTTTTTTGTACGTTTTCTTC
GCATTTTCAGATGGTTATTTCTGCTCACTATTCTTTTTTCAACATAACAGAGTCCTAGCAAACCACGTCAAACCA
TCAACCATCTCGTCTCAGCTGCTCGAGCGGCAGGCGGTGGTGAAGTGGATGTGGTTACTGGTGTAGAACTAGATC
TCGAGGCGTTCACAAGCATTCGATTTGGTCAGGATCGCCGATTGGAAGAAGTTGGTCGCATGTTGTGCTCGTCCA
CAACTACATCTATCAAAATTCCCGATCGCCCTGATCTTAGGTACTTTCATATTAATATGCTCGCTTAACTTTTGC
TGACGAGCTCTTCAGTGAACATGATCAAACTAAGGAGCAACAGAACCATGTCATTCGTGTAGCAGATCGAACTCT
CGCACTCCCTTATGGCCGTGCAATGTTCACTTTTGGGTCTCTTTCTACGGTCACCCGTGAAGCTTATAGGATCCC
CAAGCTCGAGTTTACAGTTCGTGTGCAGCCTTTGAATATCACTGTCCCTCCAGAAGCTGGAAAGATTCCTGTCGA
GTCGCTCAGCTGGGGCGAGTTTCATAACGGCGTGGCCGCGGGTTTGCGTATATCTCCAACTGCTACCGGAGTGGA
AAGTTCTTGGATTGCTTTCAATAAGCCATCGGAGTTGTCTCCCGAACACGCTGGGTTCTTGTTAGGGCTTGGATT
GACGGGACACCTCAAGCACATGATGACTTGGCATACGTTCAGCTACTTGACTCCAAAACATGACTTGACATCGAT
TGGAGTTCTGTTGGGATTGTCCGCTGCAAACGTTGGGAGCGCTGACCAGCACGTTACGAAGCTGTTAGCGGTACA
TACGCCGGCCTTACTACCTACGCCCTCAGTTGACCTCAATGTATCGCTGATGACCCAAGCTGCTGGACTTGCTGG
AGTGGGGTTGTTGTATCTAGGGACGAAGAATCGTCGAATGGCCGAAGTTTGCTTGAATCAGATTAGCAGGAGGGA
TTTGGTTCAGCCTGACTTGAGTAATGAGCATCGAGAGGCGTATACGTTTGCAGCAGCACTTGCGTTCGGTATGAT
CATGCTGGGAAAGGGGACTACCATTCCAGCCGATTCACATTTACTCTCAAGACTGAACGTTCTCGTCCATGGTGA
TGCGGATCCGATGCTCGCAAAGAATATACGCATGCCATTTGATATCAATCTCACATCGCCTGCGGCAACGATTGC
TCTCGGACTAATGTATCTTCGGACGGAGAGACAAGATATTGCGGATTTATTGCCTATCCCTGATACGGTACTCAC
ACTCAATCGAATTCAACCAAGCTTCCTGGCGATCAGAACGATTGCAAGGAACTTGATTATGTGGAACGAAATTGC
ACCGTCAAACGAATGGCTGATTTCACAATTGCCGGAAAGCGTACGGGAGGCGATTGAAGCGAGGTCAAAACACGG
TCAAGCAGTTGATGAATCATTGGAGTTGGCATACTATAACATATTGGCCGGCTGTTGTTTCGTCATTGGTTTGAA
GTATGCTGGTACTGCGCGGGAGGAAGCATACTCATTGATCGTGCGTTACTTTGATATGTATCAGCGATTGGCGTA
TACGAATGGTCGGTTCCCATTCAATGTAGCTCATTCATTCTTGCTCATCCTATTTTTAGGCCTGGCTTTCGACCA
TAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail