Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|035930
Gene name
Locationscaffold_13:616543..617270
Strand-
Gene length (bp)727
Transcript length (bp)615
Coding sequence length (bp)615
Protein length (aa) 205

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00293 NUDIX NUDIX domain 5.7E-10 2 76

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q75UV1|NDX1_THETH Diadenosine hexaphosphate hydrolase OS=Thermus thermophilus GN=ndx1 PE=1 SV=1 7 67 7.0E-08

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 66 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|035930
MVLIQQSTNKIVVVHESSKGYWFFPRGRKDLGESLEAAALREAYEESGYRAELMPVYNPSRAPAPPGERQRYEEP
NTEPVYMTTTAAVNTVMTTESVNMTTLASVNMEDYHTQSPDKNLGYEYLVSWYIGQIPADAIPERGTGMPDEVNY
VSHLLDYDRAMDKVYGFERDVLRYAWAVYTHTLEVKNRTVGEAGGQKESVHAAA*
Coding >AgabiH97|035930
ATGGTGCTGATACAGCAGTCCACGAACAAGATAGTAGTCGTTCATGAGTCATCCAAAGGATACTGGTTTTTTCCC
AGGGGACGCAAGGACTTAGGCGAGAGTCTTGAAGCAGCCGCGCTGAGAGAAGCATACGAGGAGAGTGGTTATCGT
GCCGAACTCATGCCAGTTTACAACCCAAGCAGGGCGCCCGCTCCACCGGGCGAACGACAACGGTACGAGGAACCC
AATACGGAGCCGGTTTATATGACCACCACGGCTGCTGTCAATACCGTTATGACCACGGAGTCTGTCAATATGACC
ACCTTGGCTTCCGTCAATATGGAGGATTACCATACCCAGAGCCCAGACAAGAATTTGGGATACGAATATCTCGTC
TCATGGTATATTGGTCAGATCCCGGCTGATGCGATACCGGAGAGAGGTACAGGCATGCCAGACGAAGTAAATTAT
GTTAGCCATTTGTTGGATTACGACAGGGCCATGGATAAAGTATACGGCTTCGAGCGGGATGTTTTACGCTATGCA
TGGGCGGTGTACACCCACACTCTGGAGGTCAAAAATAGGACAGTGGGAGAAGCAGGAGGTCAAAAGGAGAGCGTT
CATGCCGCCGCCTGA
Transcript >AgabiH97|035930
ATGGTGCTGATACAGCAGTCCACGAACAAGATAGTAGTCGTTCATGAGTCATCCAAAGGATACTGGTTTTTTCCC
AGGGGACGCAAGGACTTAGGCGAGAGTCTTGAAGCAGCCGCGCTGAGAGAAGCATACGAGGAGAGTGGTTATCGT
GCCGAACTCATGCCAGTTTACAACCCAAGCAGGGCGCCCGCTCCACCGGGCGAACGACAACGGTACGAGGAACCC
AATACGGAGCCGGTTTATATGACCACCACGGCTGCTGTCAATACCGTTATGACCACGGAGTCTGTCAATATGACC
ACCTTGGCTTCCGTCAATATGGAGGATTACCATACCCAGAGCCCAGACAAGAATTTGGGATACGAATATCTCGTC
TCATGGTATATTGGTCAGATCCCGGCTGATGCGATACCGGAGAGAGGTACAGGCATGCCAGACGAAGTAAATTAT
GTTAGCCATTTGTTGGATTACGACAGGGCCATGGATAAAGTATACGGCTTCGAGCGGGATGTTTTACGCTATGCA
TGGGCGGTGTACACCCACACTCTGGAGGTCAAAAATAGGACAGTGGGAGAAGCAGGAGGTCAAAAGGAGAGCGTT
CATGCCGCCGCCTGA
Gene >AgabiH97|035930
ATGGTGCTGATACAGCAGTCCACGAACAAGATAGTAGTCGTTCATGAGTCATCCAAAGGATACTGGTTTTTTCCC
AGGGGACGCAAGGACTTAGGCGAGAGTCTTGAAGCAGCCGCGCTGAGAGAAGCATACGAGGAGGTGAGTGTGTCT
CTCACCCTTGCAGTGCTACGTAAAGTACAAGTTCTAACTCTTCCAGAGTGGTTATCGTGCCGAACTCATGCCAGT
TTACAACCCAAGCAGGGCGCCCGCTCCACCGGGCGAACGACAACGGTACGAGGAACCCAATACGGAGCCGGTTTA
TATGACCACCACGGCTGCTGTCAATACCGTTATGACCACGGAGTCTGTCAATATGACCACCTTGGCTTCCGTCAA
TATGGAGGATTACCATACCCAGAGCCCAGACAAGAATTTGGGATACGAATATCTCGTCTCATGGTATATTGGTCA
GATCCCGGCTGATGCGGTACGTTCATGTAGTAGAGATTCCATCTCATTTCTTAATGTGGTCAACAATTAGATACC
GGAGAGAGGTACAGGCATGCCAGACGAAGTAAATTATGTTAGCCATTTGTTGGATTACGACAGGGCCATGGATAA
AGTATACGGCTTCGAGCGGGATGTTTTACGCTATGCATGGGCGGTGTACACCCACACTCTGGAGGTCAAAAATAG
GACAGTGGGAGAAGCAGGAGGTCAAAAGGAGAGCGTTCATGCCGCCGCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail