Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|035890
Gene name
Locationscaffold_13:607006..611313
Strand-
Gene length (bp)4307
Transcript length (bp)3039
Coding sequence length (bp)3039
Protein length (aa) 1013

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF15979 Glyco_hydro_115 Glycosyl hydrolase family 115 7.2E-132 204 551
PF17829 GH115_C Gylcosyl hydrolase family 115 C-terminal domain 1.3E-55 829 1008

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 26 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|035890
MMLQGVKSLFFLSALLASLWDGAYAVIGAPSCVAFQSASDTFPIVNRGHAAPVYISSDDWPGVQRAAGDFVADIQ
RVTGAKPALVNLTLSGNSSITSDSRGGVLPVFVGTLGRSALIDSIVNSTGLDVSGVRGQWEAYLSREVKNPIPGV
DSGYVIVGADKRGTIFALYEHSEQFGVSPWYWWADVPITKHSELHVKSHGCSHGTPTVKYRGIFLNDEQPCLQSW
AMEKFTNGTGSPNLNSPFNHLFYAGLFELLLRLKANYLWPAMWGSAFALDDSANQFLADYYGIAMGTSHQEPMMR
ATPNEFTIVGKGSWDYTANKDEIYNYWLEGTKRAEPYESIFTLGMRGFGDLPLSETTDIELLEGVIDDQTTILKT
VFGSDVDLLQIPQIWTLYQEVEGYYDDGMRVPDYVTLLWADDLFGNVRRYPVPSERNRTGGAGVYYHLDLVGGAR
SYKWVASSQIPKIYEQMSIAVDRVASRLWVLNVGDLKPYERDTEFFLTYGWNASRWNPDNLDTFVSGWAQREFDL
DSDDAHSVADIVANLSRFNSRRKPELWTSTTYSLIDYREAQQWMDEWGKVEKASTDIYSKLPDDTKPAFFQLVHH
PVSASANAARMLWNIGMNNLRSSQAFLSTNDYADTAEELFEHDWDFENDYHTLLDGKWDHMMDQTHLGYYYWQQP
MTNSMNAINRVQKRKQALAGYMRIGVESSNGAWPGDNPNQCAQGYNCPPPTVALDSYSVFSNRYIDIGAGGPASF
SFKISSNTSWVDISPSSGDVSPQDPEKRVFLSVKDWSSLSDGANTAQLKVAATSKGQPSMTVTIDFSAIKAGSTG
DFHGFVEGDGVVSMEAAHATRNTTVDGISWKNFPGLGRTLSGVTPWPRSDQAFDVGTGPTLEYDFFTFNTIAGSG
NITVTALLSPSNNAQGQDNPLTIAVALDSEEPIVHQPMPDSAAGKQPAAWDGVNGFAANNIIPVETKFTNVSAGK
HTFKIMMTQPAIVVQKIVIDVGGLKPSYLGPPESHRV*
Coding >AgabiH97|035890
ATGATGCTACAAGGTGTCAAATCTCTGTTTTTCCTCTCTGCGCTTCTTGCTAGCCTGTGGGATGGGGCATATGCT
GTAATTGGCGCACCTTCTTGTGTCGCCTTCCAGTCTGCTTCGGACACATTTCCGATCGTCAATCGCGGACATGCA
GCACCCGTTTATATCTCTTCGGACGATTGGCCTGGTGTTCAACGAGCAGCTGGGGATTTTGTTGCCGACATTCAG
AGAGTCACGGGTGCCAAACCAGCTCTTGTTAACCTCACACTATCCGGAAATTCCTCAATTACATCAGATTCGCGA
GGAGGTGTTCTACCAGTTTTCGTTGGTACTCTGGGACGTTCGGCTTTGATTGACTCTATTGTTAATTCTACTGGT
CTCGATGTTTCTGGAGTTCGTGGACAGTGGGAAGCGTACTTGTCTAGGGAGGTCAAGAACCCTATACCTGGTGTT
GACAGTGGATATGTTATCGTTGGAGCTGACAAAAGAGGGACGATCTTTGCTCTGTACGAGCATTCTGAACAATTT
GGCGTATCTCCTTGGTATTGGTGGGCTGACGTACCTATCACCAAACACTCAGAACTGCATGTGAAGTCTCATGGA
TGTTCACATGGAACTCCAACGGTCAAATATAGAGGTATATTCTTGAACGATGAGCAGCCATGCTTGCAAAGTTGG
GCTATGGAAAAATTTACCAATGGAACTGGATCGCCCAACTTAAATTCGCCCTTCAATCATCTCTTCTACGCCGGA
CTGTTTGAGTTACTGTTGCGCCTGAAGGCAAATTACCTTTGGCCTGCGATGTGGGGAAGCGCGTTCGCTTTGGAT
GATTCTGCCAACCAGTTCCTTGCAGATTATTATGGAATCGCTATGGGCACCAGTCATCAAGAACCGATGATGAGG
GCGACCCCAAACGAATTCACAATAGTCGGCAAAGGTTCCTGGGATTATACGGCGAATAAGGATGAGATTTACAAC
TATTGGTTGGAGGGCACTAAACGCGCAGAACCTTACGAGTCTATTTTTACACTCGGCATGCGCGGTTTCGGTGAT
TTGCCACTGTCCGAAACCACCGACATCGAACTTCTAGAAGGGGTTATTGATGATCAAACCACGATTCTCAAAACC
GTCTTTGGGTCAGATGTTGATCTTTTGCAGATCCCTCAGATTTGGACCCTCTACCAAGAAGTGGAAGGCTACTAT
GACGACGGTATGAGAGTACCGGACTATGTGACCTTGCTTTGGGCAGATGACCTCTTTGGTAATGTCCGAAGGTAT
CCCGTGCCTTCCGAGAGAAACAGGACCGGCGGTGCTGGTGTCTACTATCACTTAGATTTAGTGGGTGGAGCAAGG
AGCTACAAATGGGTTGCTAGCTCTCAAATTCCGAAGATCTATGAACAGATGTCGATCGCAGTTGACCGCGTCGCG
TCACGTCTCTGGGTTCTCAATGTCGGCGATTTGAAACCTTATGAAAGAGATACGGAATTTTTCTTGACTTACGGT
TGGAACGCGAGTCGATGGAATCCGGATAACCTTGATACCTTTGTGTCTGGATGGGCTCAGAGGGAATTCGACCTT
GATTCCGATGATGCGCATTCCGTAGCCGATATTGTGGCAAATTTGTCGAGGTTCAATTCCAGGAGGAAACCCGAA
CTCTGGACGAGCACAACCTACAGCTTGATTGATTACAGGGAGGCTCAGCAATGGATGGATGAATGGGGCAAAGTA
GAGAAAGCGTCAACTGACATTTATTCTAAGCTCCCCGATGATACCAAGCCGGCATTTTTCCAGTTGGTCCATCAT
CCTGTCAGCGCCAGCGCCAATGCTGCTCGCATGCTCTGGAACATTGGAATGAACAATTTGCGATCTTCTCAAGCT
TTCCTCAGTACAAACGACTACGCTGACACGGCTGAGGAACTATTTGAACATGATTGGGACTTTGAGAATGACTAC
CATACATTGTTAGATGGAAAATGGGACCATATGATGGATCAAACTCACCTCGGATATTATTACTGGCAACAGCCA
ATGACCAACTCCATGAACGCCATTAATCGCGTTCAGAAACGCAAACAAGCCCTCGCCGGCTACATGCGTATCGGT
GTCGAAAGCTCAAACGGAGCTTGGCCAGGTGATAATCCAAATCAATGCGCACAAGGATATAACTGTCCTCCTCCA
ACAGTCGCCCTTGATTCATATTCGGTATTCTCCAACCGTTATATTGATATTGGAGCCGGAGGACCAGCGTCATTC
TCATTCAAGATTTCAAGTAATACTTCTTGGGTTGACATCTCCCCTTCATCTGGAGATGTCTCCCCCCAGGACCCC
GAGAAGAGAGTGTTCTTAAGCGTGAAGGACTGGTCCAGCCTTAGTGATGGCGCCAATACGGCACAGCTGAAAGTG
GCTGCAACCTCGAAGGGCCAACCTTCCATGACTGTTACTATCGATTTTTCAGCTATAAAAGCAGGATCTACTGGC
GATTTCCATGGTTTCGTCGAAGGGGACGGTGTTGTTTCCATGGAGGCAGCTCATGCCACGCGAAATACGACTGTA
GATGGTATCTCTTGGAAGAACTTCCCTGGCCTGGGAAGGACTCTATCTGGAGTCACACCTTGGCCTCGCAGCGAT
CAAGCCTTTGATGTCGGGACTGGTCCAACCTTGGAGTATGATTTCTTCACTTTCAACACTATCGCCGGATCCGGA
AATATCACTGTTACAGCTCTACTCTCTCCCTCAAACAACGCGCAGGGACAAGACAACCCCTTGACTATCGCTGTT
GCTTTAGATTCGGAAGAACCAATTGTCCACCAGCCTATGCCAGATTCTGCTGCTGGTAAACAGCCTGCTGCTTGG
GATGGTGTCAACGGTTTCGCCGCCAACAATATCATACCCGTTGAGACTAAATTCACCAATGTATCTGCAGGTAAA
CACACTTTCAAAATCATGATGACGCAGCCCGCCATTGTTGTGCAGAAGATTGTGATTGACGTTGGAGGATTAAAA
CCCAGTTATCTAGGACCTCCCGAGAGTCACCGGGTTTAA
Transcript >AgabiH97|035890
ATGATGCTACAAGGTGTCAAATCTCTGTTTTTCCTCTCTGCGCTTCTTGCTAGCCTGTGGGATGGGGCATATGCT
GTAATTGGCGCACCTTCTTGTGTCGCCTTCCAGTCTGCTTCGGACACATTTCCGATCGTCAATCGCGGACATGCA
GCACCCGTTTATATCTCTTCGGACGATTGGCCTGGTGTTCAACGAGCAGCTGGGGATTTTGTTGCCGACATTCAG
AGAGTCACGGGTGCCAAACCAGCTCTTGTTAACCTCACACTATCCGGAAATTCCTCAATTACATCAGATTCGCGA
GGAGGTGTTCTACCAGTTTTCGTTGGTACTCTGGGACGTTCGGCTTTGATTGACTCTATTGTTAATTCTACTGGT
CTCGATGTTTCTGGAGTTCGTGGACAGTGGGAAGCGTACTTGTCTAGGGAGGTCAAGAACCCTATACCTGGTGTT
GACAGTGGATATGTTATCGTTGGAGCTGACAAAAGAGGGACGATCTTTGCTCTGTACGAGCATTCTGAACAATTT
GGCGTATCTCCTTGGTATTGGTGGGCTGACGTACCTATCACCAAACACTCAGAACTGCATGTGAAGTCTCATGGA
TGTTCACATGGAACTCCAACGGTCAAATATAGAGGTATATTCTTGAACGATGAGCAGCCATGCTTGCAAAGTTGG
GCTATGGAAAAATTTACCAATGGAACTGGATCGCCCAACTTAAATTCGCCCTTCAATCATCTCTTCTACGCCGGA
CTGTTTGAGTTACTGTTGCGCCTGAAGGCAAATTACCTTTGGCCTGCGATGTGGGGAAGCGCGTTCGCTTTGGAT
GATTCTGCCAACCAGTTCCTTGCAGATTATTATGGAATCGCTATGGGCACCAGTCATCAAGAACCGATGATGAGG
GCGACCCCAAACGAATTCACAATAGTCGGCAAAGGTTCCTGGGATTATACGGCGAATAAGGATGAGATTTACAAC
TATTGGTTGGAGGGCACTAAACGCGCAGAACCTTACGAGTCTATTTTTACACTCGGCATGCGCGGTTTCGGTGAT
TTGCCACTGTCCGAAACCACCGACATCGAACTTCTAGAAGGGGTTATTGATGATCAAACCACGATTCTCAAAACC
GTCTTTGGGTCAGATGTTGATCTTTTGCAGATCCCTCAGATTTGGACCCTCTACCAAGAAGTGGAAGGCTACTAT
GACGACGGTATGAGAGTACCGGACTATGTGACCTTGCTTTGGGCAGATGACCTCTTTGGTAATGTCCGAAGGTAT
CCCGTGCCTTCCGAGAGAAACAGGACCGGCGGTGCTGGTGTCTACTATCACTTAGATTTAGTGGGTGGAGCAAGG
AGCTACAAATGGGTTGCTAGCTCTCAAATTCCGAAGATCTATGAACAGATGTCGATCGCAGTTGACCGCGTCGCG
TCACGTCTCTGGGTTCTCAATGTCGGCGATTTGAAACCTTATGAAAGAGATACGGAATTTTTCTTGACTTACGGT
TGGAACGCGAGTCGATGGAATCCGGATAACCTTGATACCTTTGTGTCTGGATGGGCTCAGAGGGAATTCGACCTT
GATTCCGATGATGCGCATTCCGTAGCCGATATTGTGGCAAATTTGTCGAGGTTCAATTCCAGGAGGAAACCCGAA
CTCTGGACGAGCACAACCTACAGCTTGATTGATTACAGGGAGGCTCAGCAATGGATGGATGAATGGGGCAAAGTA
GAGAAAGCGTCAACTGACATTTATTCTAAGCTCCCCGATGATACCAAGCCGGCATTTTTCCAGTTGGTCCATCAT
CCTGTCAGCGCCAGCGCCAATGCTGCTCGCATGCTCTGGAACATTGGAATGAACAATTTGCGATCTTCTCAAGCT
TTCCTCAGTACAAACGACTACGCTGACACGGCTGAGGAACTATTTGAACATGATTGGGACTTTGAGAATGACTAC
CATACATTGTTAGATGGAAAATGGGACCATATGATGGATCAAACTCACCTCGGATATTATTACTGGCAACAGCCA
ATGACCAACTCCATGAACGCCATTAATCGCGTTCAGAAACGCAAACAAGCCCTCGCCGGCTACATGCGTATCGGT
GTCGAAAGCTCAAACGGAGCTTGGCCAGGTGATAATCCAAATCAATGCGCACAAGGATATAACTGTCCTCCTCCA
ACAGTCGCCCTTGATTCATATTCGGTATTCTCCAACCGTTATATTGATATTGGAGCCGGAGGACCAGCGTCATTC
TCATTCAAGATTTCAAGTAATACTTCTTGGGTTGACATCTCCCCTTCATCTGGAGATGTCTCCCCCCAGGACCCC
GAGAAGAGAGTGTTCTTAAGCGTGAAGGACTGGTCCAGCCTTAGTGATGGCGCCAATACGGCACAGCTGAAAGTG
GCTGCAACCTCGAAGGGCCAACCTTCCATGACTGTTACTATCGATTTTTCAGCTATAAAAGCAGGATCTACTGGC
GATTTCCATGGTTTCGTCGAAGGGGACGGTGTTGTTTCCATGGAGGCAGCTCATGCCACGCGAAATACGACTGTA
GATGGTATCTCTTGGAAGAACTTCCCTGGCCTGGGAAGGACTCTATCTGGAGTCACACCTTGGCCTCGCAGCGAT
CAAGCCTTTGATGTCGGGACTGGTCCAACCTTGGAGTATGATTTCTTCACTTTCAACACTATCGCCGGATCCGGA
AATATCACTGTTACAGCTCTACTCTCTCCCTCAAACAACGCGCAGGGACAAGACAACCCCTTGACTATCGCTGTT
GCTTTAGATTCGGAAGAACCAATTGTCCACCAGCCTATGCCAGATTCTGCTGCTGGTAAACAGCCTGCTGCTTGG
GATGGTGTCAACGGTTTCGCCGCCAACAATATCATACCCGTTGAGACTAAATTCACCAATGTATCTGCAGGTAAA
CACACTTTCAAAATCATGATGACGCAGCCCGCCATTGTTGTGCAGAAGATTGTGATTGACGTTGGAGGATTAAAA
CCCAGTTATCTAGGACCTCCCGAGAGTCACCGGGTTTAA
Gene >AgabiH97|035890
ATGATGCTACAAGGTGTCAAATCTCTGTTTTTCCTCTCTGCGCTTCTTGCTAGCCTGTGGGATGGGGCATATGCT
GTAATTGGCGCACCTTCTTGTGTCGCCTTCCAGTCTGCTTCGGACACATTTCCGATCGTCAATCGCGGACATGCA
GCACCCGTTTATATCTCTTCGGACGATTGGCCTGGTGTTCAACGAGCAGCTGGGGATTTTGTTGCCGACATTCAG
AGAGTCACGGGTGCCAAACCAGCTCTTGTTAACCTCACACTATCCGGAAATTCCTCAATTACATCAGATTCGCGA
GGAGGTGTTCTACCAGTTTTCGTTGGTACTCTGGGACGTTCGGCTTTGATTGACTCTATTGTTAATTCTACTGGT
CTCGATGTTTCTGGAGTTCGTGGACAGTGGGAAGCGTACTTGTCTAGGGAGGTCAAGAACCCTATACCTGGTGTT
GACAGTGGATATGTTATCGTTGGAGCTGACAAAAGAGGGACGATCTTTGCTCTGTACGAGCATTCTGAACAATTT
GGTGAGAATACCATTCCCCTCGTTTCCGGAAATGGTAACTGACACCGAATTCACCTATTTAGGCGTATCTCCTTG
GTATTGGTGAGCCTGATGACCAATTTTATCCTTCTGTTTGCTGCCGAACACTCATATGATCCAGGTGGGCTGACG
TACCTATCACCAAACACTCAGAACTGCATGTGAAGTCTCATGGATGTTCACATGGAACTCCAACGGTCAAATATA
GAGGTATATTCTTGAACGATGAGCAGCCATGCTTGCAAAGTTGGGCTATGGAAAAATTTACCAATGGAACTGGAT
CGCCCAACTTAAATTCGCCCTTCAATCATCTCTTCTACGCCGGACTGTAAGTTCCAGGTTCCTTTACAGAAGCAA
TAGCTTGGTCTGATAAGCTACAGGTTTGAGTTACTGTTGCGCCTGAAGGCAAATTACCTTTGGCCTGGTGAGTCG
CTAACCCTATTAGTTTATCCGTCTTTGTGATAACAATGATGGTTCAGCGATGTGGGGAAGGTGATTTGTTCATTG
CTGATGCACTTTCGCCGCGTTTGACGCGTTGTAATTCCGAAAAATTATCAGCGCGTTCGCTTTGGATGATTCTGC
CAACCAGTTCCTTGCAGATTATTATGGAATCGCTATGGGCACCAGGTATGTATATGCAAATGATTGATTCGCTGA
ATGAATCTGGAGAATATCTCAGTCATCAAGAACCGATGATGAGGGCGACCCCAAACGAATTCACAATAGTCGGCA
AAGGTTCCTGGGATTATACGGCGAATAAGGATGAGATTTACAACTATTGGTTGGAGGGCACTAAACGCGCAGAAC
CTTACGAGTCTATTTTTACACTCGGCATGCGCGGTTTCGGTGATTGTAAGTGGTTTCCCCCCGAATCCACGTTGC
TAGCGCATTGATTCTCTTTAGTGCCACTGTCCGAAACCACCGACATCGAACTTCTAGAAGGGGTTATTGATGATC
AAACCACGATTCTCAAAACCGTCTTTGGGTCAGATGTTGATCTTTTGCAGATCCCTCAGATTTGGACCCTCTGTA
AGCGTTGAACGTTGAACGTTGATTATTAGGCCATAAAAGCGATCTAACGCGGGTTTATCGTAGACCAAGAAGTGG
AAGGCTACTATGACGACGGTATGAGAGTACCGGACTATGTGACCTTGCTTTGGGCAGATGACCTCTTTGGTAATG
TCCGAAGGTATCCCGTGCCTTCCGAGAGAAACAGGACCGGCGGTGCTGGTGTCTACTATCACGTAAGCGGCAATA
TGTTTCTTTTGTTGTGTATAATTAATGGATCCCTTCTGTAGTTAGATTTAGTGGGTGGAGCAAGGAGCTACAAAT
GGGTTGCTGTAAGTGTCGGGACTCACTCCAAATTTAAGAACTCGTCAAAGCTGATCACCTGAACAGAGCTCTCAA
ATTCCGAAGGTCCGCTGCTTGTGGAATGGAGGGACACATCCGAATATACTGATGCGCATATATGTAGATCTATGA
ACAGATGTCGATCGCAGTTGACCGCGTCGCGTCACGTCTCTGGGTTCTCAATGTCGGCGATTTGAAACCTTATGA
AAGAGATACGGAATTTTTCTTGACTTACGGTTGGAACGCGAGTCGATGGAATCCGGATAACCTTGATACCTTTGT
GTCTGGATGGGCTCAGAGGGAATTCGACCTTGATTCCGATGATGCGCATTCCGTAGCCGATATTGTGGCAAATTT
GTCGAGGTTCAATTCCAGGAGGAAACCCGAACTCTGGACGAGCACAACCTACAGCTTGATTGATTACAGGGAGTG
AGTCTGCTAAACCATCTCCAAATCACAAAACATCTTGCTAAGATATTGGTGTTTTAGGGCTCAGCAATGGATGGA
TGAATGGGGCAAAGTAGAGAAAGCGTCAACTGACATTTATTCTAAGCTCCCCGATGATACCAAGCCGGCATTTTT
CCAGTTGGTCCATCATCCTGTCAGCGCCAGCGCCAATGCTGCTCGCATGGTACAGTACATATTACTGCGATGCAA
CCGAATAATTGACCGAAACTCTAGCTCTGGAACATTGGAATGAACAATTTGCGATCTTCTCAAGCTTTCGTAGGT
TCTTGGCTTGTACACTGAAAGTATATTTGTGTTGATTTTGGTCTAGCTCAGTACAAACGACTACGCTGACACGGC
TGAGGAACTATTTGAACATGATTGGGACTTTGAGAATGACTACCATACATTGTTAGATGGTACGTTTTAAGCCTA
CGTTGCTCGTTCAATGTCGCTAATGTTGCCCATTCAGGAAAATGGGACCAGTAAGCTAATATATCGATCATATAA
AAGTACAATGATGAACCCGACATCAGTATGATGGATCAAACTCGTACGTTTTCATGAGTAGCTAGTATGCCGCCT
GATCAATGAACAACTCAGACCTCGGATATTATTACTGGCAACAGCCAATGACCAACTCGTACGCAAATTCAATCC
TCATCAACGTTTAATTTAGATTAATCATTGTCATAGCATGAACGCCATTAATCGCGTTCAGAAACGCAAACAAGC
CCTCGCCGGCTACATGCGTATCGGTGTCGAAAGCTCAAACGGAGCTTGGTGCGAACTTTTCTGGAGCCTAGAACG
TTTGACGTCCTGACATGCTCTCTCACAGGCCAGGTGATAATCCAAATCAATGCGCACAAGGATATAACTGTCCTC
CTCCAACAGTCGCCCTTGATTCATATTCGGTATTCTCCAACCGTTATATTGATATTGGAGCCGGAGGACCAGCGT
CATTCTCATTCAAGATTTCAAGTAATACTTCTTGGGTTGACATCTCCCCTTCATCTGGAGATGTCTCCCCCCAGG
ACCCCGAGAAGAGAGTGTTCTTAAGCGTGAAGGACTGGTCCAGCCTTAGTGATGGCGCCAATACGGCACAGCTGA
AAGTGGCTGCAACCTCGAAGGGCCAACCTTCCATGACTGTTACTATCGATTTTTCAGCTATAAAAGCAGGATCTA
CTGGCGATTTCCATGGTATATGGCCCTCCTTTCTCGATATCCGGTAATTATTGGGCTCACCAATGGTGCTAGGTT
TCGTCGAAGGGGACGGTGTTGTTTCCATGGAGGCAGCTCATGCCACGCGAAATACGACTGTAGATGGTATCTCTT
GGAAGAACTTCCCTGGCCTGGGAAGGACTCTATCTGGAGTCACACCTTGGCCTCGCAGCGATCAAGCCTTTGATG
TCGGGACTGGTCCAACCTTGTGCGTGATAGCCTTAACCTAACTAAGTCACGGAATTGACGGCAGTCTGTTAGGGA
GTATGATTTCTTCACTTTCAACACTATCGCCGGATCCGGAAATATCACTGTTACAGCTCTACTCTCTCCCTCAAA
CAACGCGCAGGGACAAGACAACCCCTTGACTATCGCTGTTGCTTTAGATTCGGAAGAACCAATTGTCCACCAGCC
TATGCCAGATTCTGCTGCTGGTAAACAGCCTGCTGCTTGGGATGGTGTCAACGGTTTCGCCGCCAACAATATCAT
ACCCGTTGAGACTAAATTCACCAATGTATCTGCAGGTAAACACACTTTCAAAGTAAGTCATATGTTCTGCTTTGT
TTGATCAAATACTCAAGTATTGAAAACAGATCATGATGACGCAGCCCGCCATTGTTGTGCAGAAGATTGTGATTG
GTGAGCTCAGTCGCTTTCAGACACGCCTTACTCCTTTTCTAACTTGTTCAGACGTTGGAGGATTAAAACCCAGTT
ATCTAGGACCTCCCGAGAGTCACCGGGTTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail